BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF027M05

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009765489.1|  PREDICTED: uncharacterized protein LOC104217035    299   9e-95   Nicotiana sylvestris
emb|CDP13254.1|  unnamed protein product                                298   1e-94   Coffea canephora [robusta coffee]
ref|XP_002515055.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    298   3e-94   Ricinus communis
gb|KHG05074.1|  Endoglucanase                                           297   5e-94   Gossypium arboreum [tree cotton]
gb|KDO82155.1|  hypothetical protein CISIN_1g008330mg                   291   3e-93   Citrus sinensis [apfelsine]
gb|KJB15656.1|  hypothetical protein B456_002G188600                    293   2e-92   Gossypium raimondii
ref|XP_011034023.1|  PREDICTED: uncharacterized protein LOC105132312    291   9e-92   Populus euphratica
ref|XP_002285424.1|  PREDICTED: uncharacterized protein LOC100244027    291   1e-91   Vitis vinifera
ref|XP_006438205.1|  hypothetical protein CICLE_v10031098mg             291   1e-91   Citrus clementina [clementine]
ref|XP_002312657.2|  hypothetical protein POPTR_0008s18380g             291   2e-91   Populus trichocarpa [western balsam poplar]
ref|XP_010250986.1|  PREDICTED: uncharacterized protein LOC104593039    291   2e-91   Nelumbo nucifera [Indian lotus]
ref|XP_007223308.1|  hypothetical protein PRUPE_ppa003807mg             290   2e-91   Prunus persica
gb|KDO82151.1|  hypothetical protein CISIN_1g008330mg                   290   2e-91   Citrus sinensis [apfelsine]
ref|XP_006483983.1|  PREDICTED: uncharacterized protein LOC102624331    291   3e-91   Citrus sinensis [apfelsine]
ref|XP_006378253.1|  hypothetical protein POPTR_0010s059502g            284   5e-91   
ref|XP_004239150.1|  PREDICTED: uncharacterized protein LOC101248575    289   8e-91   Solanum lycopersicum
ref|XP_008221942.1|  PREDICTED: uncharacterized protein LOC103321869    289   1e-90   
ref|XP_004245178.1|  PREDICTED: uncharacterized protein LOC101258288    288   2e-90   
ref|XP_010248702.1|  PREDICTED: uncharacterized protein LOC104591536    287   3e-90   Nelumbo nucifera [Indian lotus]
ref|XP_009359244.1|  PREDICTED: uncharacterized protein LOC103949843    287   4e-90   Pyrus x bretschneideri [bai li]
gb|KDP26669.1|  hypothetical protein JCGZ_17827                         286   1e-89   Jatropha curcas
ref|XP_011042367.1|  PREDICTED: uncharacterized protein LOC105138074    285   2e-89   Populus euphratica
ref|XP_006367511.1|  PREDICTED: uncharacterized protein LOC102589547    285   2e-89   
ref|XP_002315653.2|  hypothetical protein POPTR_0010s05960g             279   3e-89   
ref|XP_011042368.1|  PREDICTED: uncharacterized protein LOC105138075    284   5e-89   Populus euphratica
ref|XP_007159685.1|  hypothetical protein PHAVU_002G258500g             284   5e-89   Phaseolus vulgaris [French bean]
ref|XP_010904543.1|  PREDICTED: uncharacterized protein LOC105031942    282   2e-88   Elaeis guineensis
gb|EYU30606.1|  hypothetical protein MIMGU_mgv1a018920mg                278   2e-87   Erythranthe guttata [common monkey flower]
ref|XP_007044872.1|  Cellulase protein                                  280   2e-87   
ref|XP_010100346.1|  hypothetical protein L484_027655                   278   8e-87   
ref|XP_008389746.1|  PREDICTED: uncharacterized protein LOC103452050    278   1e-86   
ref|XP_003539156.1|  PREDICTED: uncharacterized protein LOC100816102    277   2e-86   Glycine max [soybeans]
ref|XP_007132485.1|  hypothetical protein PHAVU_011G098000g             275   6e-86   Phaseolus vulgaris [French bean]
gb|AES72136.2|  cellulase (glycosyl hydrolase family 5)                 276   2e-85   Medicago truncatula
ref|XP_008236799.1|  PREDICTED: uncharacterized protein LOC103335561    274   3e-85   Prunus mume [ume]
ref|XP_008793719.1|  PREDICTED: uncharacterized protein LOC103709945    273   3e-85   
ref|XP_003601885.1|  Endoglucanase                                      276   5e-85   
ref|XP_010682344.1|  PREDICTED: uncharacterized protein LOC104897211    273   6e-85   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH20742.1|  cellulase (glycosyl hydrolase family 5)                 273   8e-85   Medicago truncatula
ref|XP_010249431.1|  PREDICTED: uncharacterized protein LOC104591975    271   2e-84   Nelumbo nucifera [Indian lotus]
ref|XP_004309996.1|  PREDICTED: uncharacterized protein LOC101307271    271   2e-84   Fragaria vesca subsp. vesca
ref|XP_008446127.1|  PREDICTED: uncharacterized protein LOC103488945    271   3e-84   Cucumis melo [Oriental melon]
gb|KGN51727.1|  hypothetical protein Csa_5G593400                       271   6e-84   Cucumis sativus [cucumbers]
ref|XP_004135502.1|  PREDICTED: uncharacterized protein LOC101217177    270   7e-84   
ref|XP_010044528.1|  PREDICTED: uncharacterized protein LOC104433472    269   3e-83   Eucalyptus grandis [rose gum]
ref|XP_004504142.1|  PREDICTED: uncharacterized protein LOC101503968    268   6e-83   Cicer arietinum [garbanzo]
gb|KHN29014.1|  Endoglucanase                                           267   9e-83   Glycine soja [wild soybean]
ref|XP_008389747.1|  PREDICTED: uncharacterized protein LOC103452051    267   2e-82   
ref|XP_003532808.1|  PREDICTED: uncharacterized protein LOC100818309    267   2e-82   Glycine max [soybeans]
ref|XP_009387346.1|  PREDICTED: uncharacterized protein LOC103974285    263   3e-82   
gb|KJB78033.1|  hypothetical protein B456_012G173600                    266   6e-82   Gossypium raimondii
gb|KHN06534.1|  Endoglucanase                                           266   7e-82   Glycine soja [wild soybean]
ref|XP_003524249.1|  PREDICTED: uncharacterized protein LOC100789885    266   8e-82   Glycine max [soybeans]
ref|XP_010250982.1|  PREDICTED: uncharacterized protein LOC104593...    264   2e-81   
ref|XP_010250979.1|  PREDICTED: uncharacterized protein LOC104593...    264   2e-81   
ref|XP_004504189.1|  PREDICTED: uncharacterized protein LOC101490831    263   4e-81   Cicer arietinum [garbanzo]
ref|XP_011086688.1|  PREDICTED: uncharacterized protein LOC105168334    260   1e-79   Sesamum indicum [beniseed]
ref|XP_010249430.1|  PREDICTED: uncharacterized protein LOC104591974    258   2e-79   
ref|XP_006292902.1|  hypothetical protein CARUB_v10019167mg             258   2e-79   
gb|KCW59703.1|  hypothetical protein EUGRSUZ_H02464                     254   3e-78   Eucalyptus grandis [rose gum]
emb|CDY40992.1|  BnaA02g27820D                                          252   3e-78   Brassica napus [oilseed rape]
ref|XP_003552802.1|  PREDICTED: uncharacterized protein LOC100805196    255   4e-78   Glycine max [soybeans]
ref|XP_009385963.1|  PREDICTED: uncharacterized protein LOC103973...    255   6e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385956.1|  PREDICTED: uncharacterized protein LOC103973...    255   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAD31066.1|AC007357_15  F3F19.15                                     253   1e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514260.1|  PREDICTED: uncharacterized protein LOC104790246    253   2e-77   
ref|XP_010026599.1|  PREDICTED: uncharacterized protein LOC104416971    250   2e-77   Eucalyptus grandis [rose gum]
ref|NP_172772.2|  Cellulase (glycosyl hydrolase family 5) protein       254   2e-77   Arabidopsis thaliana [mouse-ear cress]
gb|KCW59699.1|  hypothetical protein EUGRSUZ_H02457                     253   2e-77   Eucalyptus grandis [rose gum]
ref|XP_010026595.1|  PREDICTED: uncharacterized protein LOC104416964    253   3e-77   Eucalyptus grandis [rose gum]
ref|XP_010425288.1|  PREDICTED: uncharacterized protein LOC104710406    253   3e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010458756.1|  PREDICTED: uncharacterized protein LOC104739...    252   4e-77   
ref|XP_007159684.1|  hypothetical protein PHAVU_002G258400g             253   4e-77   Phaseolus vulgaris [French bean]
ref|XP_010691763.1|  PREDICTED: uncharacterized protein LOC104905020    252   5e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006307168.1|  hypothetical protein CARUB_v10008758mg             253   5e-77   Capsella rubella
ref|XP_009152076.1|  PREDICTED: uncharacterized protein LOC103875318    253   7e-77   Brassica rapa
ref|XP_006417151.1|  hypothetical protein EUTSA_v10007253mg             253   7e-77   Eutrema salsugineum [saltwater cress]
emb|CDY13613.1|  BnaA06g33100D                                          252   8e-77   Brassica napus [oilseed rape]
ref|XP_010495004.1|  PREDICTED: uncharacterized protein LOC104772051    252   9e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010026600.1|  PREDICTED: uncharacterized protein LOC104416972    254   1e-76   Eucalyptus grandis [rose gum]
ref|XP_002876948.1|  glycosyl hydrolase family 5 protein                250   1e-76   
ref|XP_010458755.1|  PREDICTED: uncharacterized protein LOC104739...    251   1e-76   Camelina sativa [gold-of-pleasure]
emb|CDX83590.1|  BnaC07g23300D                                          251   2e-76   
ref|XP_010502524.1|  PREDICTED: uncharacterized protein LOC104779826    250   3e-76   
ref|XP_006395579.1|  hypothetical protein EUTSA_v10003968mg             249   3e-76   
ref|XP_010026597.1|  PREDICTED: uncharacterized protein LOC104416968    249   4e-76   
ref|XP_006395580.1|  hypothetical protein EUTSA_v10003968mg             249   5e-76   Eutrema salsugineum [saltwater cress]
ref|XP_010026596.1|  PREDICTED: uncharacterized protein LOC104416965    249   5e-76   
ref|XP_010476303.1|  PREDICTED: uncharacterized protein LOC104755594    250   6e-76   Camelina sativa [gold-of-pleasure]
ref|XP_002889989.1|  glycosyl hydrolase family 5 protein                249   8e-76   Arabidopsis lyrata subsp. lyrata
ref|NP_189245.1|  Cellulase (glycosyl hydrolase family 5) protein       248   1e-75   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43579.1|  hypothetical protein AALP_AA1G144700                    251   2e-75   Arabis alpina [alpine rockcress]
ref|XP_009152075.1|  PREDICTED: uncharacterized protein LOC103875317    248   3e-75   Brassica rapa
ref|XP_010556350.1|  PREDICTED: uncharacterized protein LOC104825676    248   3e-75   Tarenaya hassleriana [spider flower]
emb|CDY16066.1|  BnaC08g40570D                                          248   3e-75   Brassica napus [oilseed rape]
emb|CDY19395.1|  BnaC05g09040D                                          246   7e-75   Brassica napus [oilseed rape]
dbj|BAK05121.1|  predicted protein                                      246   1e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010528075.1|  PREDICTED: uncharacterized protein LOC104805267    246   3e-74   Tarenaya hassleriana [spider flower]
ref|XP_006395581.1|  hypothetical protein EUTSA_v10003934mg             245   5e-74   
ref|XP_009148543.1|  PREDICTED: uncharacterized protein LOC103871957    245   6e-74   Brassica rapa
ref|XP_006290844.1|  hypothetical protein CARUB_v10016955mg             244   8e-74   
ref|XP_002284888.2|  PREDICTED: uncharacterized protein LOC100258876    243   8e-74   Vitis vinifera
emb|CDX98009.1|  BnaA06g07600D                                          244   2e-73   
ref|XP_002876947.1|  predicted protein                                  243   4e-73   
ref|XP_010556349.1|  PREDICTED: uncharacterized protein LOC104825675    242   5e-73   Tarenaya hassleriana [spider flower]
ref|NP_001130915.1|  hydrolase, hydrolyzing O-glycosyl compound p...    243   5e-73   Zea mays [maize]
gb|ACF79301.1|  unknown                                                 243   5e-73   Zea mays [maize]
ref|XP_006648806.1|  PREDICTED: uncharacterized protein LOC102721430    236   7e-73   
ref|NP_189244.1|  Cellulase (glycosyl hydrolase family 5) protein       242   8e-73   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02432.1|  unnamed protein product                                242   8e-73   Arabidopsis thaliana [mouse-ear cress]
gb|ACU18247.1|  unknown                                                 231   8e-73   Glycine max [soybeans]
ref|XP_010535458.1|  PREDICTED: uncharacterized protein LOC104810759    237   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_002446675.1|  hypothetical protein SORBIDRAFT_06g020270          240   5e-72   Sorghum bicolor [broomcorn]
ref|XP_004975985.1|  PREDICTED: uncharacterized protein LOC101760765    240   5e-72   Setaria italica
ref|XP_010514258.1|  PREDICTED: uncharacterized protein LOC104790245    239   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_002284895.1|  PREDICTED: uncharacterized protein LOC100253729    238   1e-71   Vitis vinifera
gb|KFK33555.1|  hypothetical protein AALP_AA5G028800                    238   2e-71   Arabis alpina [alpine rockcress]
ref|XP_010502521.1|  PREDICTED: uncharacterized protein LOC104779823    237   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_002284881.1|  PREDICTED: uncharacterized protein LOC100264047    234   2e-70   Vitis vinifera
gb|AIZ06017.1|  hypothetical protein                                    235   3e-70   Zea nicaraguensis
ref|XP_010492589.1|  PREDICTED: uncharacterized protein LOC104769...    233   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010240029.1|  PREDICTED: uncharacterized protein LOC100839976    235   4e-70   Brachypodium distachyon [annual false brome]
ref|XP_006400290.1|  hypothetical protein EUTSA_v10015581mg             233   6e-70   Eutrema salsugineum [saltwater cress]
ref|XP_010492588.1|  PREDICTED: uncharacterized protein LOC104769...    233   9e-70   Camelina sativa [gold-of-pleasure]
gb|EEE61202.1|  hypothetical protein OsJ_15212                          234   1e-69   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047320.1|  Os02g0596200                                       230   2e-69   
ref|XP_010453833.1|  PREDICTED: uncharacterized protein LOC104735704    231   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010248705.1|  PREDICTED: uncharacterized protein LOC104591...    232   3e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010248706.1|  PREDICTED: uncharacterized protein LOC104591...    232   3e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010437048.1|  PREDICTED: uncharacterized protein LOC104720...    230   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010437042.1|  PREDICTED: uncharacterized protein LOC104720...    230   1e-68   Camelina sativa [gold-of-pleasure]
gb|EEC77495.1|  hypothetical protein OsI_16343                          231   1e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_009126336.1|  PREDICTED: uncharacterized protein LOC103851244    222   1e-68   Brassica rapa
gb|EMT10461.1|  Endoglucanase E1                                        229   2e-68   
ref|XP_002446674.1|  hypothetical protein SORBIDRAFT_06g020260          230   3e-68   Sorghum bicolor [broomcorn]
gb|EAZ23667.1|  hypothetical protein OsJ_07369                          230   5e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002871770.1|  glycosyl hydrolase family 5 protein                228   8e-68   
ref|NP_001132121.1|  hypothetical protein precursor                     229   9e-68   Zea mays [maize]
ref|XP_010492706.1|  PREDICTED: uncharacterized protein LOC104770057    228   1e-67   Camelina sativa [gold-of-pleasure]
gb|AFW62836.1|  hypothetical protein ZEAMMB73_750687                    223   2e-67   
ref|XP_006289374.1|  hypothetical protein CARUB_v10002868mg             227   3e-67   Capsella rubella
ref|XP_010420476.1|  PREDICTED: uncharacterized protein LOC104706046    227   3e-67   Camelina sativa [gold-of-pleasure]
emb|CDX94333.1|  BnaC01g18510D                                          221   4e-67   
ref|XP_009121460.1|  PREDICTED: uncharacterized protein LOC103846306    226   4e-67   Brassica rapa
ref|XP_009107523.1|  PREDICTED: uncharacterized protein LOC103833179    226   5e-67   Brassica rapa
emb|CDX69429.1|  BnaA10g17780D                                          226   5e-67   
ref|XP_009121461.1|  PREDICTED: uncharacterized protein LOC103846308    224   8e-67   Brassica rapa
gb|KFK25904.1|  hypothetical protein AALP_AA8G177600                    225   9e-67   Arabis alpina [alpine rockcress]
ref|XP_003579979.1|  PREDICTED: uncharacterized protein LOC100845861    226   9e-67   Brachypodium distachyon [annual false brome]
gb|EAY86525.1|  hypothetical protein OsI_07905                          226   1e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_006400209.1|  hypothetical protein EUTSA_v10015466mg             224   1e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010420372.1|  PREDICTED: uncharacterized protein LOC104705962    223   2e-66   Camelina sativa [gold-of-pleasure]
ref|NP_197172.1|  glycosyl hydrolase family protein                     223   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001053105.1|  Os04g0480900                                       224   5e-66   
emb|CAH67676.1|  H0510A06.1                                             224   5e-66   Oryza sativa [red rice]
ref|XP_002871731.1|  glycosyl hydrolase family 5 protein                222   6e-66   
ref|XP_008678767.1|  PREDICTED: uncharacterized protein LOC100501...    224   7e-66   Zea mays [maize]
gb|EEC77494.1|  hypothetical protein OsI_16340                          223   8e-66   Oryza sativa Indica Group [Indian rice]
dbj|BAK00694.1|  predicted protein                                      223   9e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009126137.1|  PREDICTED: uncharacterized protein LOC103851062    221   1e-65   Brassica rapa
ref|NP_197252.1|  Glycosyl hydrolase superfamily protein                223   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142284.1|  PREDICTED: uncharacterized protein LOC103866155    221   1e-65   Brassica rapa
ref|XP_009142293.1|  PREDICTED: uncharacterized protein LOC103866164    221   1e-65   Brassica rapa
emb|CDY38091.1|  BnaC02g06820D                                          222   2e-65   Brassica napus [oilseed rape]
emb|CAD41089.2|  OSJNBb0011N17.6                                        223   2e-65   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66880.1|  OSIGBa0158F13.11                                       222   2e-65   Oryza sativa [red rice]
ref|XP_010549752.1|  PREDICTED: uncharacterized protein LOC104820833    222   2e-65   Tarenaya hassleriana [spider flower]
emb|CDX89335.1|  BnaA01g15580D                                          221   3e-65   
gb|KHG22500.1|  Endoglucanase E1                                        220   7e-65   Gossypium arboreum [tree cotton]
ref|XP_002452393.1|  hypothetical protein SORBIDRAFT_04g024910          221   1e-64   
ref|XP_004975980.1|  PREDICTED: uncharacterized protein LOC101758857    219   5e-64   Setaria italica
ref|XP_006652422.1|  PREDICTED: uncharacterized protein LOC102702088    218   7e-64   Oryza brachyantha
emb|CDY38435.1|  BnaA10g17230D                                          218   8e-64   Brassica napus [oilseed rape]
emb|CDY16914.1|  BnaC09g40410D                                          217   9e-64   Brassica napus [oilseed rape]
gb|EAY94563.1|  hypothetical protein OsI_16341                          218   1e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_004955049.1|  PREDICTED: uncharacterized protein LOC101776534    217   2e-63   Setaria italica
ref|XP_004975262.1|  PREDICTED: uncharacterized protein LOC101779133    216   1e-62   Setaria italica
ref|XP_008793758.1|  PREDICTED: uncharacterized protein LOC103709981    214   2e-62   
gb|EYU23408.1|  hypothetical protein MIMGU_mgv1a020519mg                211   2e-61   Erythranthe guttata [common monkey flower]
gb|KHN43979.1|  Endoglucanase E1                                        209   2e-61   Glycine soja [wild soybean]
gb|EMT27118.1|  hypothetical protein F775_19072                         209   3e-60   
ref|XP_002272534.1|  PREDICTED: uncharacterized protein LOC100257079    208   3e-60   Vitis vinifera
emb|CBI34404.3|  unnamed protein product                                208   4e-60   Vitis vinifera
gb|EYU23411.1|  hypothetical protein MIMGU_mgv1a004205mg                206   2e-59   Erythranthe guttata [common monkey flower]
ref|XP_011080895.1|  PREDICTED: uncharacterized protein LOC105164045    206   3e-59   Sesamum indicum [beniseed]
ref|XP_010904544.1|  PREDICTED: uncharacterized protein LOC105031943    206   5e-59   Elaeis guineensis
gb|KCW59700.1|  hypothetical protein EUGRSUZ_H02458                     204   1e-58   Eucalyptus grandis [rose gum]
ref|XP_011080894.1|  PREDICTED: uncharacterized protein LOC105164044    201   2e-58   
ref|XP_010053198.1|  PREDICTED: uncharacterized protein LOC104441706    203   3e-58   Eucalyptus grandis [rose gum]
emb|CAH67677.1|  H0510A06.2                                             203   3e-58   Oryza sativa [red rice]
gb|EPS62091.1|  hypothetical protein M569_12701                         202   4e-58   Genlisea aurea
gb|AFW62835.1|  hypothetical protein ZEAMMB73_750687                    197   1e-57   
emb|CAD41090.2|  OSJNBb0011N17.7                                        201   2e-57   Oryza sativa Japonica Group [Japonica rice]
gb|KHN19917.1|  hypothetical protein glysoja_032397                     199   3e-57   Glycine soja [wild soybean]
gb|KHN06535.1|  Endoglucanase                                           199   4e-57   Glycine soja [wild soybean]
gb|ABR17494.1|  unknown                                                 199   8e-57   Picea sitchensis
ref|XP_002272491.1|  PREDICTED: uncharacterized protein LOC100262188    199   8e-57   Vitis vinifera
ref|XP_002272422.2|  PREDICTED: uncharacterized protein LOC100245045    198   2e-56   Vitis vinifera
ref|XP_010658499.1|  PREDICTED: uncharacterized protein LOC100267...    197   2e-56   
ref|XP_006439449.1|  hypothetical protein CICLE_v10023534mg             198   2e-56   
ref|XP_008678768.1|  PREDICTED: uncharacterized protein LOC100501...    198   3e-56   Zea mays [maize]
ref|XP_002272454.2|  PREDICTED: uncharacterized protein LOC100267...    197   1e-55   
emb|CBI34405.3|  unnamed protein product                                199   4e-55   Vitis vinifera
ref|XP_002272386.2|  PREDICTED: uncharacterized protein LOC100250178    194   9e-55   Vitis vinifera
gb|KGN57439.1|  hypothetical protein Csa_3G186170                       183   3e-54   Cucumis sativus [cucumbers]
gb|AFK46453.1|  unknown                                                 181   6e-54   Lotus japonicus
ref|XP_008467257.1|  PREDICTED: uncharacterized protein LOC103504654    191   1e-53   Cucumis melo [Oriental melon]
gb|KGN50395.1|  hypothetical protein Csa_5G171770                       191   1e-53   Cucumis sativus [cucumbers]
gb|KGN50394.1|  hypothetical protein Csa_5G171760                       190   2e-53   Cucumis sativus [cucumbers]
ref|XP_009381699.1|  PREDICTED: uncharacterized protein LOC103969775    189   3e-53   
ref|XP_008459280.1|  PREDICTED: uncharacterized protein LOC103498458    192   4e-53   Cucumis melo [Oriental melon]
ref|XP_008810943.1|  PREDICTED: uncharacterized protein LOC103722247    189   1e-52   
ref|XP_004168760.1|  PREDICTED: uncharacterized protein LOC101223816    186   7e-52   
ref|XP_009605826.1|  PREDICTED: uncharacterized protein LOC104100317    184   3e-51   Nicotiana tomentosiformis
gb|EYU23409.1|  hypothetical protein MIMGU_mgv1a004243mg                184   5e-51   Erythranthe guttata [common monkey flower]
ref|XP_009773950.1|  PREDICTED: uncharacterized protein LOC104224082    183   8e-51   Nicotiana sylvestris
ref|XP_002893942.1|  predicted protein                                  179   3e-50   
gb|EMS46776.1|  hypothetical protein TRIUR3_23304                       176   4e-50   Triticum urartu
ref|XP_010325669.1|  PREDICTED: uncharacterized protein LOC101257885    180   6e-50   Solanum lycopersicum
gb|ACF85134.1|  unknown                                                 179   1e-49   Zea mays [maize]
emb|CDX83591.1|  BnaC07g23310D                                          177   3e-49   
ref|XP_001769398.1|  predicted protein                                  175   3e-49   
ref|XP_001767510.1|  predicted protein                                  174   6e-49   
emb|CDY13614.1|  BnaA06g33090D                                          174   5e-48   Brassica napus [oilseed rape]
gb|EYU23410.1|  hypothetical protein MIMGU_mgv1a004297mg                175   9e-48   Erythranthe guttata [common monkey flower]
gb|KDP25366.1|  hypothetical protein JCGZ_20522                         175   1e-47   Jatropha curcas
ref|XP_002509879.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    174   2e-47   Ricinus communis
emb|CDP12092.1|  unnamed protein product                                177   3e-47   Coffea canephora [robusta coffee]
gb|KDP25365.1|  hypothetical protein JCGZ_20521                         176   4e-47   Jatropha curcas
gb|KGN45940.1|  hypothetical protein Csa_6G028440                       172   8e-47   Cucumis sativus [cucumbers]
ref|XP_002509878.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    172   1e-46   
emb|CDY16991.1|  BnaC09g41180D                                          171   1e-46   Brassica napus [oilseed rape]
emb|CDX69431.1|  BnaA10g17800D                                          169   2e-46   
ref|XP_003621386.1|  Endoglucanase E1                                   168   4e-46   
ref|XP_004170746.1|  PREDICTED: endoglucanase E1-like                   169   1e-45   
gb|AES77604.2|  hydrolyzing O-glycosyl compounds hydrolase              169   1e-45   Medicago truncatula
ref|XP_007159232.1|  hypothetical protein PHAVU_002G220300g             168   2e-45   Phaseolus vulgaris [French bean]
ref|XP_010916958.1|  PREDICTED: uncharacterized protein LOC105041671    166   7e-45   
gb|AES77610.2|  hydrolyzing O-glycosyl compounds hydrolase              166   3e-44   Medicago truncatula
ref|XP_003621392.1|  Endoglucanase E1                                   165   3e-44   
gb|AFK48266.1|  unknown                                                 157   3e-44   Lotus japonicus
ref|XP_004158142.1|  PREDICTED: uncharacterized LOC101213113            163   3e-44   
ref|XP_004510834.1|  PREDICTED: uncharacterized protein LOC101496378    164   7e-44   
ref|XP_002509877.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    164   9e-44   
gb|KFK38059.1|  hypothetical protein AALP_AA3G064700                    162   2e-43   Arabis alpina [alpine rockcress]
ref|XP_004143723.1|  PREDICTED: uncharacterized protein LOC101213113    163   3e-43   Cucumis sativus [cucumbers]
gb|KEH18775.1|  hydrolyzing O-glycosyl compounds hydrolase              162   4e-43   Medicago truncatula
ref|XP_002298005.2|  hypothetical protein POPTR_0001s10020g             162   6e-43   
ref|XP_007135020.1|  hypothetical protein PHAVU_010G095100g             161   7e-43   Phaseolus vulgaris [French bean]
ref|XP_008467306.1|  PREDICTED: uncharacterized protein LOC103504686    161   1e-42   Cucumis melo [Oriental melon]
ref|XP_011026965.1|  PREDICTED: uncharacterized protein LOC105127394    160   2e-42   Populus euphratica
ref|XP_003621369.1|  Endoglucanase E1                                   160   2e-42   
ref|XP_006289055.1|  hypothetical protein CARUB_v10002452mg             154   6e-42   
gb|KEH28356.1|  hydrolyzing O-glycosyl compounds hydrolase              158   9e-42   Medicago truncatula
ref|XP_003621368.1|  Endoglucanase                                      157   1e-41   
emb|CBI34407.3|  unnamed protein product                                157   1e-41   Vitis vinifera
gb|KHM98801.1|  Chaperone protein ClpB3, chloroplastic                  160   2e-41   Glycine soja [wild soybean]
ref|XP_010261410.1|  PREDICTED: uncharacterized protein LOC104600255    155   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_003617143.1|  Oligoribonuclease                                  159   2e-40   
gb|KHN45741.1|  Endoglucanase                                           154   3e-40   Glycine soja [wild soybean]
gb|KGN50047.1|  hypothetical protein Csa_5G151630                       152   2e-39   Cucumis sativus [cucumbers]
ref|XP_003608279.1|  Endoglucanase                                      152   2e-39   Medicago truncatula
ref|XP_004143963.1|  PREDICTED: uncharacterized protein LOC101211910    151   4e-39   
gb|AFW58605.1|  hypothetical protein ZEAMMB73_652830                    140   6e-38   
gb|AFW58606.1|  hypothetical protein ZEAMMB73_652830                    139   1e-37   
ref|XP_008437726.1|  PREDICTED: uncharacterized protein LOC103483073    146   2e-37   Cucumis melo [Oriental melon]
gb|EAY94564.1|  hypothetical protein OsI_16342                          139   6e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_008437725.1|  PREDICTED: uncharacterized protein LOC103483072    134   6e-35   Cucumis melo [Oriental melon]
gb|KGN50359.1|  hypothetical protein Csa_5G168955                       132   1e-34   Cucumis sativus [cucumbers]
ref|XP_006344017.1|  PREDICTED: uncharacterized protein LOC102582487    136   4e-34   Solanum tuberosum [potatoes]
gb|KDP25367.1|  hypothetical protein JCGZ_20523                         135   2e-33   Jatropha curcas
ref|XP_006671920.1|  cellulase family protein                           134   3e-33   Cordyceps militaris CM01
ref|XP_003717168.1|  cellulase                                          132   7e-33   Magnaporthe oryzae 70-15
ref|XP_009224314.1|  hypothetical protein GGTG_08211                    132   2e-32   Gaeumannomyces tritici R3-111a-1
gb|KEY64284.1|  hypothetical protein S7711_06330                        131   2e-32   Stachybotrys chartarum IBT 7711
gb|KFA75266.1|  hypothetical protein S40288_00156                       131   2e-32   Stachybotrys chartarum IBT 40288
gb|EPS64690.1|  hypothetical protein M569_10090                         131   2e-32   Genlisea aurea
dbj|GAM34669.1|  hypothetical protein TCE0_015f02391                    129   8e-32   Talaromyces cellulolyticus
gb|EKG14335.1|  Glycoside hydrolase family 5                            129   8e-32   Macrophomina phaseolina MS6
emb|CDP16213.1|  unnamed protein product                                130   9e-32   
ref|XP_007814668.1|  cellulase family protein                           129   1e-31   
emb|CBI16819.3|  unnamed protein product                                128   1e-31   
gb|KHO00841.1|  cellulase family protein                                128   2e-31   
ref|XP_002340189.1|  cellulase family protein                           128   2e-31   
ref|XP_008597845.1|  cellulase-like protein                             128   3e-31   
ref|XP_008437728.1|  PREDICTED: uncharacterized protein LOC103483074    129   3e-31   
gb|KFA63501.1|  hypothetical protein S40285_00384                       126   1e-30   
ref|XP_002145195.1|  cellulase family protein                           125   4e-30   
gb|KFH44162.1|  Endoglucanase-like protein                              125   5e-30   
ref|XP_007834259.1|  hypothetical protein PFICI_07487                   124   5e-30   
ref|XP_007910862.1|  putative cellulase family protein                  124   8e-30   
ref|XP_007585086.1|  putative cellulase family protein                  124   9e-30   
gb|KIE00366.1|  cellulase family protein                                122   3e-29   
gb|KGQ09067.1|  hypothetical protein BBAD15_g5599                       122   3e-29   
ref|XP_007357340.1|  glycosyl hydrolase family 5 protein/cellulase      122   4e-29   
ref|XP_006653527.1|  PREDICTED: uncharacterized protein LOC102709173    121   4e-29   
ref|XP_004143962.1|  PREDICTED: uncharacterized protein LOC101211675    122   4e-29   
gb|EQK97843.1|  cellulase family protein                                122   5e-29   
gb|KID89157.1|  cellulase family protein                                121   1e-28   
ref|XP_007819785.1|  cellulase family protein                           120   2e-28   
gb|KFG83308.1|  cellulase family protein                                120   3e-28   
ref|XP_003662646.1|  glycoside hydrolase family 5 protein               120   3e-28   
ref|XP_010497223.1|  PREDICTED: uncharacterized protein LOC104774279    119   3e-28   
gb|KIY63779.1|  glycoside hydrolase family 5 protein                    119   4e-28   
emb|CEJ81391.1|  hypothetical protein VHEMI01518                        119   4e-28   
ref|XP_007792420.1|  putative cellulase family protein                  119   6e-28   
gb|ENH81172.1|  cellulase family protein                                119   7e-28   
gb|KID73106.1|  cellulase family protein                                118   1e-27   
dbj|GAD95395.1|  cellulase family protein                               117   2e-27   
gb|EQB46738.1|  cellulase                                               117   3e-27   
ref|XP_007594136.1|  cellulase                                          117   3e-27   
gb|EFQ33294.1|  cellulase                                               117   3e-27   
gb|KGN57438.1|  hypothetical protein Csa_3G185670                       116   5e-27   
gb|EMT72253.1|  Endoglucanase                                           116   7e-27   
ref|XP_003655929.1|  glycoside hydrolase family 5 protein               115   7e-27   
gb|ERS96619.1|  hypothetical protein HMPREF1624_06828                   115   8e-27   
ref|XP_007273044.1|  cellulase family protein                           115   9e-27   
gb|EWZ81068.1|  hypothetical protein FOWG_15056                         114   2e-26   
gb|EXK27375.1|  hypothetical protein FOMG_16183                         114   2e-26   
ref|XP_007590702.1|  beta-1,6-galactanase                               114   2e-26   
gb|KDN66432.1|  putative cellulase                                      114   2e-26   
gb|EWZ43433.1|  hypothetical protein FOZG_04542                         114   2e-26   
gb|EWY97310.1|  hypothetical protein FOYG_02170                         114   2e-26   
ref|XP_001908470.1|  hypothetical protein                               114   3e-26   
ref|XP_003663765.1|  glycoside hydrolase family 5 protein               114   3e-26   
ref|XP_006341815.1|  PREDICTED: uncharacterized protein LOC102587665    114   4e-26   
gb|ENH72329.1|  Endoglucanase                                           114   4e-26   
gb|EXM17989.1|  hypothetical protein FOTG_13958                         114   4e-26   
ref|XP_001836746.2|  glycosyl hydrolase family 5 protein/cellulase      114   5e-26   
gb|EXA33415.1|  hypothetical protein FOVG_15480                         113   6e-26   
gb|EXL60764.1|  hypothetical protein FOCG_00055                         112   9e-26   
emb|CCF32701.1|  cellulase                                              112   1e-25   
gb|EXK80342.1|  hypothetical protein FOQG_15124                         112   1e-25   
gb|EEC73517.1|  hypothetical protein OsI_07900                          110   2e-25   
gb|KIY64332.1|  glycoside hydrolase family 5 protein                    111   3e-25   
gb|EPS61076.1|  hypothetical protein M569_13724                         111   4e-25   
emb|CCF42701.1|  endo-beta-1                                            108   4e-25   
gb|KDN63966.1|  putative beta-1,6-galactanase                           109   1e-24   
gb|KIH89233.1|  glycosyl hydrolase family 5 protein/cellulase           109   1e-24   
ref|XP_007602986.1|  endo-beta-1                                        110   1e-24   
ref|XP_001228860.1|  hypothetical protein CHGG_02344                    109   2e-24   
ref|XP_003654775.1|  glycoside hydrolase family 5 protein               108   2e-24   
ref|XP_007286355.1|  beta-1,6-galactanase                               108   3e-24   
emb|CCF37606.1|  beta-1,6-galactanase                                   108   3e-24   
gb|EFQ25644.1|  endo-beta-1                                             108   4e-24   
gb|EGU83355.1|  hypothetical protein FOXB_06135                         107   4e-24   
gb|EPE03278.1|  cellulase family protein                                107   5e-24   
gb|KHN04647.1|  Endoglucanase                                           108   5e-24   
ref|XP_008445780.1|  PREDICTED: uncharacterized protein LOC103488703    107   1e-23   
ref|XP_682435.1|  hypothetical protein AN9166.2                         106   2e-23   
ref|NP_001053106.2|  Os04g0481000                                       100   2e-23   
gb|EQB54091.1|  beta-1,6-galactanase                                    106   2e-23   
gb|KHN29015.1|  E3 ubiquitin-protein ligase RGLG2                       108   2e-23   
gb|KFH46053.1|  hypothetical protein ACRE_031990                        105   2e-23   
gb|EFQ30340.1|  beta-1,6-galactanase                                    105   3e-23   
gb|KIH93867.1|  cellulase family protein                                104   8e-23   
ref|XP_003716571.1|  beta-1,6-galactanase                               104   8e-23   
ref|XP_007797018.1|  putative beta- -galactanase protein                107   1e-22   
gb|ENH76760.1|  beta-galactanase                                        103   1e-22   
gb|KDN70454.1|  putative endo-beta-1                                    103   2e-22   
gb|ESZ94649.1|  hypothetical protein SBOR_4958                          103   2e-22   
ref|XP_001727126.2|  cellulase family protein                           103   2e-22   
gb|EFW98553.1|  cellulase family protein                                102   2e-22   
ref|XP_009221743.1|  beta-1,6-galactanase                               103   2e-22   
dbj|BAE60287.1|  unnamed protein product                                103   3e-22   
ref|XP_002375352.1|  cellulase family protein                           103   3e-22   
gb|EQB45939.1|  endo-beta-1                                             103   3e-22   
gb|KEZ38898.1|  hypothetical protein SAPIO_CDS10213                     103   3e-22   
gb|EIT75924.1|  hypothetical protein Ao3042_07759                       103   3e-22   
ref|XP_004168759.1|  PREDICTED: uncharacterized protein LOC101223591    103   3e-22   
ref|XP_001589233.1|  hypothetical protein SS1G_09866                    102   3e-22   
gb|ERS98824.1|  hypothetical protein HMPREF1624_04014                   102   4e-22   
ref|XP_007673934.1|  glycoside hydrolase family 5 protein               102   7e-22   
ref|XP_001558669.1|  hypothetical protein BC1G_02740                    101   8e-22   
gb|EPE02619.1|  beta- -galactanase                                      101   8e-22   
ref|XP_009853760.1|  hypothetical protein NEUTE1DRAFT_148368            101   9e-22   
ref|XP_004170960.1|  PREDICTED: uncharacterized LOC101217177            101   1e-21   
ref|XP_009218474.1|  cellulase                                          102   1e-21   
ref|XP_009254229.1|  hypothetical protein FPSE_02835                    100   1e-21   
ref|XP_003346057.1|  hypothetical protein SMAC_08559                    100   2e-21   
ref|XP_011325159.1|  hypothetical protein FGSG_11184                  99.8    4e-21   
ref|XP_959873.1|  cellulase                                           99.8    4e-21   
gb|EYB22881.1|  hypothetical protein FG05_11184                       99.8    4e-21   
gb|KHE83132.1|  glycoside hydrolase family 5 protein                  99.8    4e-21   
ref|XP_001218590.1|  conserved hypothetical protein                     101   4e-21   
ref|XP_007829998.1|  hypothetical protein PFICI_03226                 99.8    4e-21   
ref|XP_007283182.1|  cellulase family protein                         99.4    5e-21   
gb|KEQ69124.1|  glycosyl hydrolase family 5 protein-like protein/...  99.4    6e-21   
gb|EWG53981.1|  hypothetical protein FVEG_12299                       98.6    1e-20   
ref|XP_007788083.1|  putative beta- -galactanase protein              98.6    1e-20   
dbj|BAF42338.1|  beta-1,6-galactanase                                 98.2    1e-20   
gb|EXM21364.1|  hypothetical protein FOTG_10887                       97.8    2e-20   
ref|XP_003719440.1|  cellulase                                        98.6    2e-20   
gb|EMT67612.1|  Endoglucanase E1                                      97.8    2e-20   
gb|EXL52466.1|  hypothetical protein FOCG_08258                       97.8    2e-20   
gb|EWY82241.1|  hypothetical protein FOYG_14356                       97.8    2e-20   
gb|EWZ31143.1|  hypothetical protein FOZG_15552                       97.8    2e-20   
ref|XP_003834169.1|  similar to glycosyl hydrolase family 5 prote...  97.8    2e-20   
gb|KDO82152.1|  hypothetical protein CISIN_1g008330mg                 97.8    2e-20   
gb|ENH63669.1|  Endoglucanase E1                                      97.8    2e-20   
gb|EGU84192.1|  hypothetical protein FOXB_05301                       97.8    2e-20   
gb|KIL93951.1|  hypothetical protein FAVG1_02513                        100   3e-20   
gb|KIN05076.1|  glycoside hydrolase family 5 protein                  97.1    3e-20   
emb|CBI20317.3|  unnamed protein product                              93.2    5e-20   
emb|CDY38093.1|  BnaC02g06800D                                        96.7    5e-20   
emb|CDX85491.1|  BnaA02g03220D                                        96.3    5e-20   
ref|XP_003049455.1|  hypothetical protein NECHADRAFT_45063            96.3    7e-20   
gb|KIM98514.1|  glycoside hydrolase family 5 protein                  97.1    9e-20   
gb|EHL01724.1|  putative endoglucanase E1                             95.1    2e-19   
ref|XP_008079151.1|  (Trans)glycosidase                               95.1    2e-19   
ref|XP_001221670.1|  hypothetical protein CHGG_05575                  95.1    2e-19   
ref|XP_007916764.1|  putative beta- -galactanase protein              94.7    2e-19   
ref|XP_008020410.1|  glycoside hydrolase family 5 protein             94.7    2e-19   
ref|XP_007695874.1|  glycoside hydrolase family 5 protein             94.7    3e-19   
gb|KEQ65714.1|  glycosyl hydrolase family 5 protein-like protein/...  94.4    4e-19   
gb|EUN23705.1|  glycoside hydrolase family 5 protein                  94.4    4e-19   
emb|CBI20315.3|  unnamed protein product                              90.5    4e-19   
ref|XP_001390007.2|  cellulase family protein                         93.6    5e-19   
emb|CAK38078.1|  unnamed protein product                              93.6    6e-19   
dbj|GAA92545.1|  cellulase family protein                             93.2    8e-19   
ref|XP_753201.1|  cellulase family protein                            92.8    1e-18   
ref|XP_007290132.1|  putative glycosyl hydrolase family 5 protein...  92.8    1e-18   
emb|CDY34588.1|  BnaC03g56880D                                        91.3    2e-18   
gb|EMD93538.1|  glycoside hydrolase family 5 protein                  92.0    2e-18   
ref|XP_007714643.1|  glycoside hydrolase family 5 protein             91.7    3e-18   
ref|XP_007828900.1|  hypothetical protein PFICI_02128                 92.4    3e-18   
ref|XP_001259223.1|  cellulase, putative                              91.7    4e-18   
gb|EMF10750.1|  glycoside hydrolase family 5 protein                  91.3    5e-18   
ref|XP_007880014.1|  hypothetical protein PFL1_04296                  91.3    7e-18   
gb|KFA65247.1|  hypothetical protein S40285_01463                     90.9    1e-17   
ref|XP_010494994.1|  PREDICTED: uncharacterized protein LOC104772040  89.0    1e-17   
ref|XP_007688994.1|  glycoside hydrolase family 5 protein             89.4    2e-17   
emb|CBI20318.3|  unnamed protein product                              88.6    2e-17   
gb|KEQ88759.1|  putative endoglucanase E1                             89.0    2e-17   
ref|XP_003000334.1|  beta-1,6-galactanase                             89.0    3e-17   
gb|KEQ97289.1|  glycoside hydrolase family 5 protein                  87.8    7e-17   
gb|KEY74323.1|  hypothetical protein S7711_00479                      88.2    7e-17   
gb|KFA77893.1|  hypothetical protein S40288_02553                     88.2    8e-17   
ref|XP_003852017.1|  hypothetical protein MYCGRDRAFT_71681            87.4    8e-17   
gb|KFY54743.1|  hypothetical protein V496_07185                       87.4    1e-16   
gb|KFY97953.1|  hypothetical protein V498_01781                       87.4    1e-16   
gb|KDN62736.1|  putative beta-1,6-galactanase                         87.8    1e-16   
ref|XP_009652661.1|  beta-1,6-galactanase                             87.0    2e-16   
gb|KFY05071.1|  hypothetical protein O988_00287                       87.0    2e-16   
ref|XP_003710230.1|  beta-1,6-galactanase                             87.0    2e-16   
ref|WP_020706673.1|  hypothetical protein                             85.9    2e-16   
gb|ELQ40532.1|  cellulase family protein                              86.3    4e-16   
ref|XP_007788248.1|  putative beta- -galactanase protein              85.1    1e-15   
gb|KFZ18118.1|  hypothetical protein V502_04277                       84.7    1e-15   
gb|EYF06416.1|  Hypothetical protein CAP_1946                         84.0    2e-15   
gb|KFY18769.1|  hypothetical protein V493_08357                       84.0    2e-15   
gb|KFX85816.1|  hypothetical protein V490_09391                       84.7    3e-15   
gb|KFZ08766.1|  hypothetical protein V501_05827                       83.6    3e-15   
gb|KFY38525.1|  hypothetical protein V495_06511                       84.3    4e-15   
gb|EQB45951.1|  beta-1,6-galactanase                                  82.4    7e-15   
gb|ENH86025.1|  beta-galactanase                                      82.4    7e-15   
emb|CAD19084.1|  cellulase                                            82.8    1e-14   
gb|KFY79089.1|  hypothetical protein V499_01878                       82.0    1e-14   
gb|KDN53057.1|  glycoside hydrolase family 5 protein                  82.0    1e-14   
ref|WP_037441468.1|  hypothetical protein                             78.6    2e-14   
gb|EFQ34997.1|  beta-1,6-galactanase                                  81.3    2e-14   
ref|XP_007601021.1|  beta-1,6-galactanase                             81.3    2e-14   
ref|XP_002509876.1|  hypothetical protein RCOM_1689350                77.0    3e-14   
gb|KDO76363.1|  hypothetical protein CISIN_1g039248mg                 79.7    5e-14   
ref|XP_007285746.1|  cellulase family protein                         80.1    5e-14   
ref|WP_002615846.1|  glycosyl hydrolase family 5                      80.5    6e-14   
ref|XP_001904357.1|  hypothetical protein                             77.8    6e-14   
dbj|GAC98490.1|  glycoside hydrolase                                  79.7    6e-14   
ref|WP_002631146.1|  hypothetical protein                             80.1    7e-14   
ref|XP_003299126.1|  hypothetical protein PTT_10061                   79.3    1e-13   
emb|CCF49355.1|  related to cellulase                                 79.0    1e-13   
ref|XP_001796881.1|  hypothetical protein SNOG_06513                  78.6    1e-13   
ref|XP_001937210.1|  beta-1,6-galactanase                             77.0    6e-13   
ref|XP_007715431.1|  glycoside hydrolase family 5 protein             76.6    7e-13   
ref|XP_008031104.1|  glycoside hydrolase family 5 protein             76.6    7e-13   
ref|XP_007698919.1|  glycoside hydrolase family 5 protein             76.6    7e-13   
gb|KIH86669.1|  endoglucanase                                         75.9    1e-12   
gb|KEQ66985.1|  Exo-beta-1,3-glucanase                                76.3    1e-12   
gb|KFH41063.1|  Endoglucanase-like protein                            76.3    1e-12   
gb|ERT03116.1|  hypothetical protein HMPREF1624_01421                 75.9    1e-12   
ref|WP_037440274.1|  hypothetical protein                             73.9    1e-12   
gb|KEQ91282.1|  glycoside hydrolase family 5 protein                  75.9    1e-12   
ref|XP_003850716.1|  Exo-beta-1,3-glucanase                           75.9    1e-12   
emb|CDI55906.1|  related to cellulase                                 75.5    2e-12   
gb|ETS60461.1|  hypothetical protein PaG_05301                        75.5    2e-12   
ref|XP_003841187.1|  hypothetical protein LEMA_P091170.1              75.5    2e-12   
gb|EPZ34200.1|  Glycoside hydrolase, family 5 domain-containing p...  75.1    2e-12   
ref|XP_011391775.1|  hypothetical protein UMAG_12007                  75.1    2e-12   
emb|CBQ69840.1|  related to cellulase                                 75.1    2e-12   
dbj|GAC77343.1|  hypothetical protein PANT_26c00006                   75.1    3e-12   
ref|XP_007690633.1|  glycoside hydrolase family 5 protein             74.7    3e-12   
gb|EMD89616.1|  glycoside hydrolase family 5 protein                  74.7    3e-12   
dbj|GAK66794.1|  beta- -galactanase protein                           74.3    4e-12   
gb|KEQ69326.1|  Exo-beta-1,3-glucanase                                74.3    4e-12   
gb|KEQ82680.1|  Exo-beta-1,3-glucanase                                74.3    4e-12   
ref|XP_008715776.1|  hypothetical protein HMPREF1541_03202            73.6    6e-12   
ref|XP_002508623.1|  glycoside hydrolase family 5 protein             74.3    6e-12   
ref|XP_007927008.1|  glycoside hydrolase family 5 protein             73.6    7e-12   
ref|XP_007593142.1|  cellulase                                        73.6    8e-12   
emb|CEG03133.1|  unnamed protein product                              73.6    8e-12   



>ref|XP_009765489.1| PREDICTED: uncharacterized protein LOC104217035 [Nicotiana sylvestris]
Length=562

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            TV +QPL T SRWIVN +G+RVKLACVNWV+H+EV+VAEGL++QPVD IS+ I++MGFNC
Sbjct  27   TVSSQPLYTKSRWIVNSTGQRVKLACVNWVSHMEVMVAEGLNQQPVDAISRAIINMGFNC  86

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            VRLTWPLFLFTNDSL S+TVRQSFKNLGL  SI GLQANNPSIVDL ++ AYQAVV SLA
Sbjct  87   VRLTWPLFLFTNDSLGSITVRQSFKNLGLFASIVGLQANNPSIVDLSVLDAYQAVVASLA  146

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            K  VMIILDNHISKPGWCCS +DGNGFFGD YFDP LW+ GLTKVAT+F GT+NVVGM
Sbjct  147  KNNVMIILDNHISKPGWCCSRFDGNGFFGDKYFDPDLWLQGLTKVATIFKGTNNVVGM  204



>emb|CDP13254.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            + QPL TNSRWIVN SG+RVKLACVNW THLEVVVAEGLSKQPVDVIS+ IVDMGFNCVR
Sbjct  1    MGQPLYTNSRWIVNGSGQRVKLACVNWATHLEVVVAEGLSKQPVDVISRSIVDMGFNCVR  60

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LTWPLFLFTND+LASL+VRQSF+ LGL ESIAG QANNPSIVDL LI AYQAVV SLA  
Sbjct  61   LTWPLFLFTNDTLASLSVRQSFQKLGLTESIAGFQANNPSIVDLSLINAYQAVVASLASN  120

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             VMIILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT+VA MF G +NVVG+
Sbjct  121  NVMIILDNHISKPGWCCSNFDGNGFFGDRYFNPDLWIRGLTEVAAMFCGINNVVGI  176



>ref|XP_002515055.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF47609.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=566

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PLSTNSRWIV+E+G+RVKLACVNWV+HLE VVAEGLSKQP+D+I+KKIV MGFNCV
Sbjct  29   VTALPLSTNSRWIVDENGQRVKLACVNWVSHLEAVVAEGLSKQPMDMIAKKIVSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TND+LASL+VRQSF+ LGLLESI+G+QANNPSI+DLPLI AYQAVV SL  
Sbjct  89   RLTWPLYLVTNDTLASLSVRQSFQGLGLLESISGIQANNPSIIDLPLIKAYQAVVSSLGD  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++AT+FNG +NV+GM
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDTYFNPDLWIKGLTQMATLFNGVTNVIGM  205



>gb|KHG05074.1| Endoglucanase [Gossypium arboreum]
Length=563

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 160/183 (87%), Gaps = 2/183 (1%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H  P   ++ PLSTNSRWIV+E GRRVKLACVNWV+HLE VVAEGLSKQP+D+ISK+IV 
Sbjct  22   HAKP--AMSLPLSTNSRWIVDEEGRRVKLACVNWVSHLEPVVAEGLSKQPMDMISKRIVT  79

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVR TWPLFL TNDSLASLTVRQSF+ LGLLESIAG+Q+NNPSI+D+ LI AYQAV
Sbjct  80   MGFNCVRFTWPLFLITNDSLASLTVRQSFQRLGLLESIAGIQSNNPSIIDVSLIKAYQAV  139

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL K  VM+ILDNH+SKPGWCCS +DGNGFFGD YF+P LW+ GLT++AT+FNG +NV
Sbjct  140  VSSLGKNDVMVILDNHLSKPGWCCSDFDGNGFFGDQYFNPDLWITGLTRMATLFNGVTNV  199

Query  627  VGM  635
            VGM
Sbjct  200  VGM  202



>gb|KDO82155.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=435

 Score =   291 bits (745),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK++VDMGFNCVR
Sbjct  35   IGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVR  94

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL   
Sbjct  95   LTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNN  154

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGM
Sbjct  155  NVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGM  210



>gb|KJB15656.1| hypothetical protein B456_002G188600 [Gossypium raimondii]
Length=563

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 161/183 (88%), Gaps = 2/183 (1%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H  P   ++ PLSTNSRWIV+E GRRVKLACVNWV+HLE VVAEGLSKQP+D+I+K+IV 
Sbjct  22   HAKP--AMSLPLSTNSRWIVDEEGRRVKLACVNWVSHLEPVVAEGLSKQPMDMIAKRIVT  79

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVR TWPLFL TNDSLAS+TVRQSF+ LGLLESIAG+Q+NNPSI+D+ LI AYQAV
Sbjct  80   MGFNCVRFTWPLFLITNDSLASITVRQSFQRLGLLESIAGIQSNNPSIIDVSLIKAYQAV  139

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL K  VM+ILDNH+SKPGWCCS++DGNGFFGD YF+P LW+ GLT++AT+FNG ++V
Sbjct  140  VSSLGKNDVMVILDNHLSKPGWCCSNFDGNGFFGDQYFNPDLWITGLTRMATLFNGVTHV  199

Query  627  VGM  635
            VGM
Sbjct  200  VGM  202



>ref|XP_011034023.1| PREDICTED: uncharacterized protein LOC105132312 [Populus euphratica]
Length=566

 Score =   291 bits (746),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PLSTNSRWIV+E+G+RVKLACVNWV+HLEV+VAEGLS+QP+D I+K+IV MGFNCV
Sbjct  29   VMALPLSTNSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSEQPMDAIAKRIVSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++LGLLESI+G+QANNPSI+DLPL+  YQAVV +L  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLRSLGLLESISGIQANNPSIIDLPLLDVYQAVVSNLGD  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS++DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGM
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGM  205



>ref|XP_002285424.1| PREDICTED: uncharacterized protein LOC100244027 [Vitis vinifera]
Length=552

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVA PL TNSRWIV+E G RVKLACVNW +HLE VVAEGLSKQPV +ISKKI  MGFNCV
Sbjct  24   VVALPLYTNSRWIVDEDGARVKLACVNWPSHLEAVVAEGLSKQPVAMISKKIGSMGFNCV  83

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPLFL TN SLASLTVRQSF+ LGLLESIAG QANNPS+VDLPLI+AYQAVV  LA 
Sbjct  84   RLTWPLFLATNQSLASLTVRQSFQRLGLLESIAGFQANNPSMVDLPLISAYQAVVSGLAD  143

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH+SKPGWCCSS+DGNGFFGD YF+P LWV GLT++ATMF G +NVVGM
Sbjct  144  NNVMVILDNHLSKPGWCCSSFDGNGFFGDQYFNPDLWVQGLTRMATMFRGVTNVVGM  200



>ref|XP_006438205.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
 gb|ESR51445.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
Length=570

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
             +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK+IVDMGFNCV
Sbjct  34   AIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRIVDMGFNCV  93

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL  
Sbjct  94   RLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGN  153

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGM
Sbjct  154  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGM  210



>ref|XP_002312657.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
 gb|EEE90024.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
Length=566

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PLSTNSRWIV+E+G+RVKLACVNWV+HLEV+VAEGLS+QP+D I+K+IV MGFNCV
Sbjct  29   VTALPLSTNSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSEQPMDAIAKRIVSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++LGLLESI+G+QANNPSI+DLPL+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLRSLGLLESISGIQANNPSIIDLPLLNVYQAVVSSLGD  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGM
Sbjct  149  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGM  205



>ref|XP_010250986.1| PREDICTED: uncharacterized protein LOC104593039 [Nelumbo nucifera]
Length=583

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            ++P   VA PL TNSRWIV+E G+RVKLACVNW +HLE +VAEGLSK+P+DVISK+IV M
Sbjct  16   VSPVVAVALPLYTNSRWIVDEDGQRVKLACVNWASHLEAMVAEGLSKRPLDVISKRIVSM  75

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TNDSLAS+TVRQSF++LGL E+I G+Q NNPS+VDLPLI AYQAVV
Sbjct  76   GFNCVRLTWPLFLATNDSLASVTVRQSFRSLGLSETIVGIQVNNPSLVDLPLIQAYQAVV  135

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
             +L +  +M+ILDNHISKPGWCCSS+DGNGFFGD YFDP +W+ GLT +ATMFN T NVV
Sbjct  136  SNLGENNLMVILDNHISKPGWCCSSFDGNGFFGDKYFDPGVWIKGLTSMATMFNATPNVV  195

Query  630  GM  635
            GM
Sbjct  196  GM  197



>ref|XP_007223308.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
 gb|EMJ24507.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
Length=547

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P TV A PLST+SRWIV+ESG+RVKLACVNWV+HLE VVAEGLSKQPVD ISK+I  +GF
Sbjct  29   PATVSAVPLSTSSRWIVDESGQRVKLACVNWVSHLEPVVAEGLSKQPVDAISKRIASLGF  88

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVRLTWP FL TND+LAS+TVRQSF++LGL ESIAGLQ+NNPSI+DL LI AYQAVV S
Sbjct  89   NCVRLTWPTFLATNDTLASVTVRQSFQSLGLSESIAGLQSNNPSIIDLTLIQAYQAVVSS  148

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L K  VM+ILDN +SKPGWCCSS+DGNGFFGD YF P +W+ GLT++AT+F G +NVVGM
Sbjct  149  LGKNNVMVILDNQVSKPGWCCSSFDGNGFFGDQYFSPDIWIKGLTRMATLFKGVANVVGM  208



>gb|KDO82151.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=570

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
             +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK++VDMGFNCV
Sbjct  34   AIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCV  93

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL  
Sbjct  94   RLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGN  153

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGM
Sbjct  154  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGM  210



>ref|XP_006483983.1| PREDICTED: uncharacterized protein LOC102624331 [Citrus sinensis]
Length=588

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
             +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK++VDMGFNCV
Sbjct  52   AIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCV  111

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL  
Sbjct  112  RLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGN  171

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGM
Sbjct  172  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGM  228



>ref|XP_006378253.1| hypothetical protein POPTR_0010s059502g, partial [Populus trichocarpa]
 gb|ERP56050.1| hypothetical protein POPTR_0010s059502g, partial [Populus trichocarpa]
Length=396

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEGLSKQP+D I+K+I+ MGFNCV
Sbjct  29   VMALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSKQPLDGIAKRILSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS++DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGM
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGM  205



>ref|XP_004239150.1| PREDICTED: uncharacterized protein LOC101248575 [Solanum lycopersicum]
Length=572

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H+    V +QPL TNSRWIVN  G+RVKL CVNWV+H++V++AEGL+ QP+D ISK I++
Sbjct  31   HVVVVIVSSQPLYTNSRWIVNSKGQRVKLTCVNWVSHMDVMLAEGLNHQPIDAISKSIIN  90

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWPL+LFTNDSL+S++VRQSFKNLGL  SI GLQANNPSIVDL ++ AY+AV
Sbjct  91   MGFNCVRLTWPLYLFTNDSLSSISVRQSFKNLGLFSSILGLQANNPSIVDLSVLDAYKAV  150

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SLAK  VMIILDNHISKPGWCCS +DGNGFFGD YFDP LW+ GLTKVAT F  T+NV
Sbjct  151  VASLAKNNVMIILDNHISKPGWCCSRFDGNGFFGDEYFDPHLWIQGLTKVATTFKATTNV  210

Query  627  VGM  635
            VGM
Sbjct  211  VGM  213



>ref|XP_008221942.1| PREDICTED: uncharacterized protein LOC103321869 [Prunus mume]
Length=584

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P TV A PLST+SRWIV+ESG+RVKLACVNWV+HLE VVAEGLSKQPVD ISK+I  +GF
Sbjct  66   PATVSAVPLSTSSRWIVDESGQRVKLACVNWVSHLEPVVAEGLSKQPVDAISKRIASLGF  125

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVRLTWP FL TND+LAS+TVRQSF++LGL ESIAGLQ+NNPSI+DL LI AYQAVV S
Sbjct  126  NCVRLTWPTFLATNDTLASVTVRQSFQSLGLSESIAGLQSNNPSIIDLTLIQAYQAVVSS  185

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L K  VM+ILDN +SKPGWCCSS DGNGFFGD YF+P +W+ GLT++AT+F G +NVVGM
Sbjct  186  LGKNNVMVILDNQVSKPGWCCSSSDGNGFFGDQYFNPDIWIKGLTRMATLFKGVANVVGM  245



>ref|XP_004245178.1| PREDICTED: uncharacterized protein LOC101258288 [Solanum lycopersicum]
Length=561

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  278
            P      LSTNSRWIVNE G+RVKL+CVNWV+HLEV+VAEGLSKQP+D ISK I +MGFN
Sbjct  27   PQYSHATLSTNSRWIVNEGGQRVKLSCVNWVSHLEVMVAEGLSKQPIDTISKSITNMGFN  86

Query  279  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            CVRLTWPLFLFTNDSL+SL+VRQSF NLGL+ESIAGLQ NNPSI+DL L+ AYQAVV  L
Sbjct  87   CVRLTWPLFLFTNDSLSSLSVRQSFNNLGLVESIAGLQVNNPSILDLSLLQAYQAVVSGL  146

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
                VM+ILDNHISKPGWCCS++DGNGFFGD YF+P LWV GLTKVAT F   +NVVGM
Sbjct  147  GNNNVMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWVQGLTKVATTFINVTNVVGM  205



>ref|XP_010248702.1| PREDICTED: uncharacterized protein LOC104591536 [Nelumbo nucifera]
Length=555

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            ++   V A PL TNSRWIV+E+G+RVKLACVNW +HLE +VAEGLSKQP+DVISK+IV M
Sbjct  23   ISQQNVTALPLYTNSRWIVDETGQRVKLACVNWASHLESMVAEGLSKQPLDVISKQIVSM  82

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TN SLAS+TVRQSFK+LGL+E+IAG++ NNPS+VDLPLI AYQ VV
Sbjct  83   GFNCVRLTWPLFLVTNSSLASITVRQSFKSLGLIETIAGIEVNNPSLVDLPLIRAYQVVV  142

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
             +LA   +M+ILDNHISK GWCCSS DGNGFFGD YFDP LW+ GLT++ATMF GT+NVV
Sbjct  143  ANLADNNLMVILDNHISKSGWCCSSVDGNGFFGDKYFDPSLWINGLTRMATMFRGTANVV  202

Query  630  GM  635
            GM
Sbjct  203  GM  204



>ref|XP_009359244.1| PREDICTED: uncharacterized protein LOC103949843 [Pyrus x bretschneideri]
Length=552

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  278
            P V A PLST+SRWIV+ESG+RVKLACVNWV+HL+ VVAEGLSKQPVD I+K+I  +GFN
Sbjct  22   PAVSALPLSTSSRWIVDESGQRVKLACVNWVSHLDTVVAEGLSKQPVDAIAKRITSLGFN  81

Query  279  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            CVRLTWPLFL TN++LA++TVRQSF++LGLL+SI+G+Q+NNP++VDLPL+ AYQAVV SL
Sbjct  82   CVRLTWPLFLATNETLAAVTVRQSFQSLGLLDSISGIQSNNPALVDLPLLKAYQAVVSSL  141

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
                VM+ILDNH+SKPGWCCS+ DGNGFFGD YF+P LW+ GLT++AT+F G SNVVGM
Sbjct  142  GSNNVMVILDNHLSKPGWCCSNTDGNGFFGDQYFNPDLWITGLTRMATLFKGVSNVVGM  200



>gb|KDP26669.1| hypothetical protein JCGZ_17827 [Jatropha curcas]
Length=563

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PLST+SRWIV+E G+RVKLACVNWV+HLE VVAEGLS++P+D+I+KKIV MGFNCV
Sbjct  28   VSAVPLSTDSRWIVDEKGQRVKLACVNWVSHLEAVVAEGLSREPMDLIAKKIVSMGFNCV  87

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TN++ ASLTV+QSF+NLGLLESI+G+QANNP+I+DLPLI AYQAVV SL  
Sbjct  88   RLTWPLYLVTNETYASLTVKQSFQNLGLLESISGIQANNPAIIDLPLIKAYQAVVSSLGD  147

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              V++ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++AT+FNG  NVVG+
Sbjct  148  NNVLVILDNHISKPGWCCSNFDGNGFFGDSYFNPDLWINGLTQMATIFNGVPNVVGL  204



>ref|XP_011042367.1| PREDICTED: uncharacterized protein LOC105138074 [Populus euphratica]
Length=561

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEGLSKQP+D I+K+I+ MGFNCV
Sbjct  29   VIALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSKQPMDGIAKRILSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS++DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGM
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGM  205



>ref|XP_006367511.1| PREDICTED: uncharacterized protein LOC102589547 [Solanum tuberosum]
Length=560

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  278
            P      LSTNSRWIVNE G+RVKL+CVNWV+HLEV+VAEGLSKQP+D ISK I +MGFN
Sbjct  26   PQYSHATLSTNSRWIVNEGGQRVKLSCVNWVSHLEVMVAEGLSKQPIDTISKSITNMGFN  85

Query  279  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            CVRLTWPLFLFTNDSL+SLTVRQSF NLGL+ESIAGLQ NNPSI+DL L+ AYQAVV  L
Sbjct  86   CVRLTWPLFLFTNDSLSSLTVRQSFSNLGLVESIAGLQVNNPSILDLSLLHAYQAVVSGL  145

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
                VM+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT VAT F   +NVVGM
Sbjct  146  GNNNVMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIQGLTNVATTFINVTNVVGM  204



>ref|XP_002315653.2| hypothetical protein POPTR_0010s05960g [Populus trichocarpa]
 gb|EEF01824.2| hypothetical protein POPTR_0010s05960g [Populus trichocarpa]
Length=377

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEG+SKQP+D I+K+I+ MGFNCV
Sbjct  7    VMALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGISKQPMDGIAKRILSMGFNCV  66

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  67   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  126

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++A+MF G  NVVGM
Sbjct  127  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFKGVPNVVGM  183



>ref|XP_011042368.1| PREDICTED: uncharacterized protein LOC105138075 [Populus euphratica]
Length=542

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEGLSKQP+D I+K+I+ MGFNCV
Sbjct  29   VIALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSKQPMDGIAKRILSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGM
Sbjct  149  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGM  205



>ref|XP_007159685.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
 gb|ESW31679.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
Length=565

 Score =   284 bits (727),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
             + P      PL T+SRWIV + GRRVKLACVNWV+HLEVVVAEGLSK+PVD ISK I  
Sbjct  27   EVRPVAATGLPLRTDSRWIVGQDGRRVKLACVNWVSHLEVVVAEGLSKKPVDAISKGIKS  86

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWP+ L TNDSLASLTVR SF+NLGLLES+AG+Q NNPSI+DLPLI A+Q V
Sbjct  87   MGFNCVRLTWPILLVTNDSLASLTVRSSFQNLGLLESVAGVQTNNPSIIDLPLIQAFQVV  146

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL    VM+ILDNHI++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG +NV
Sbjct  147  VKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKYFDPNLWMLGLTKMATLFNGVTNV  206

Query  627  VGM  635
            VGM
Sbjct  207  VGM  209



>ref|XP_010904543.1| PREDICTED: uncharacterized protein LOC105031942 [Elaeis guineensis]
Length=563

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            L  PT  A PL T+SRWIV+ESG+RVKLACVNW +HL+ V+AEG+ KQP+D ISKKI  M
Sbjct  21   LQKPTT-ALPLFTSSRWIVDESGQRVKLACVNWPSHLDTVLAEGMGKQPLDTISKKIASM  79

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TNDSLA+LTVRQSF++LGL ES A +Q NNP++VDLPLI A+QAVV
Sbjct  80   GFNCVRLTWPLFLATNDSLANLTVRQSFQSLGLAESFAAIQVNNPALVDLPLIQAFQAVV  139

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
             +L +  +M+ILDNHISKPGWCCS++DGNGFFGD YFDP +WV GLT++ATMFNGT+NVV
Sbjct  140  TNLGENNIMVILDNHISKPGWCCSNFDGNGFFGDKYFDPDVWVKGLTRMATMFNGTTNVV  199

Query  630  GM  635
            GM
Sbjct  200  GM  201



>gb|EYU30606.1| hypothetical protein MIMGU_mgv1a018920mg, partial [Erythranthe 
guttata]
Length=504

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 149/173 (86%), Gaps = 1/173 (1%)
 Frame = +3

Query  120  LSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            LST SRWIV+ES GRRVKL CVNW +HL+ VVAEGLSKQPVD IS++I++MGFNCVRLTW
Sbjct  4    LSTESRWIVDESSGRRVKLVCVNWPSHLDAVVAEGLSKQPVDEISQEIINMGFNCVRLTW  63

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            PLFLFTND+LASLTVRQSF NLGL ES+AG Q NNPSI+DL LI AYQ VV SL + KVM
Sbjct  64   PLFLFTNDTLASLTVRQSFTNLGLSESVAGFQTNNPSIIDLSLIDAYQEVVASLGRKKVM  123

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            IILDNH SKPGWCCS+ DGNGFFGD YF+P+LW+ GLT+VAT FN T NVV M
Sbjct  124  IILDNHTSKPGWCCSNSDGNGFFGDEYFNPQLWLKGLTRVATTFNNTKNVVAM  176



>ref|XP_007044872.1| Cellulase protein [Theobroma cacao]
 gb|EOY00704.1| Cellulase protein [Theobroma cacao]
Length=563

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTNSRWIV+E G+RVKLACVNWV+HLE +VAEGLSK P+DVI+K+IV  GFNCVRLTW
Sbjct  30   PLSTNSRWIVDEKGQRVKLACVNWVSHLEPMVAEGLSKLPMDVIAKRIVSTGFNCVRLTW  89

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            PLFL TNDSLASLTVRQSF+ LGLLESIAG+Q NNPSI+D+ L+ AYQAVV SL +  VM
Sbjct  90   PLFLVTNDSLASLTVRQSFQRLGLLESIAGIQTNNPSIIDVSLLKAYQAVVCSLGENNVM  149

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDNHISKPGWCCS++DGNGFFGD YF+P +W+ GLT++AT+ N  +NVVGM
Sbjct  150  VILDNHISKPGWCCSNFDGNGFFGDQYFNPDIWITGLTRMATLVNAVTNVVGM  202



>ref|XP_010100346.1| hypothetical protein L484_027655 [Morus notabilis]
 gb|EXB82480.1| hypothetical protein L484_027655 [Morus notabilis]
Length=559

 Score =   278 bits (712),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A+PL TNSRWIV+E GRRVKLACVNWV+HLE VVAEGLSKQP+DVI+ +I  +GFNCVRL
Sbjct  35   AEPLYTNSRWIVDEGGRRVKLACVNWVSHLEPVVAEGLSKQPLDVIAAQISALGFNCVRL  94

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWP++L TNDSLASLTVR SF+ LGL ESIAGLQ  NPSIVDL LI AYQAVV SL    
Sbjct  95   TWPIYLATNDSLASLTVRDSFQRLGLEESIAGLQTYNPSIVDLSLIQAYQAVVSSLGSKN  154

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            VM++LDNH++KPGWCCS++DGNGFFGD YFDP LW+ GLT +AT+F G  NV+GM
Sbjct  155  VMVVLDNHVTKPGWCCSNFDGNGFFGDQYFDPDLWIKGLTHMATLFKGVQNVIGM  209



>ref|XP_008389746.1| PREDICTED: uncharacterized protein LOC103452050 [Malus domestica]
Length=552

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  278
            P   A PLST+SRWIV+ESG+RVKLACVNWV+HL+ VVAEGLSKQPVD I+K+I  +GFN
Sbjct  22   PAASALPLSTSSRWIVDESGQRVKLACVNWVSHLDAVVAEGLSKQPVDAIAKRIASLGFN  81

Query  279  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            CVRLTWPL L TN++LA++TVRQSF++LGLLESI+G+Q+NNP++VDLPL+ AYQAVV SL
Sbjct  82   CVRLTWPLLLATNETLAAVTVRQSFQSLGLLESISGIQSNNPALVDLPLLKAYQAVVSSL  141

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
                VM+ILDNH+S PGWCC++ D NGFFGD YF+P LW+ GLT++AT+F G SNVVGM
Sbjct  142  GSNNVMVILDNHLSTPGWCCNNNDDNGFFGDKYFNPDLWITGLTRMATLFKGVSNVVGM  200



>ref|XP_003539156.1| PREDICTED: uncharacterized protein LOC100816102 [Glycine max]
Length=544

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P  V   PL T+ RWIV+ESG+RVKLACVNWV+HL+ VVAEGLS+QP+D ISK+I  MGF
Sbjct  24   PVVVKGFPLHTSERWIVDESGKRVKLACVNWVSHLDAVVAEGLSQQPLDEISKRIKTMGF  83

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVRLTWPLFL TNDS+ASLT+R SF+NLGL++S+ G+QA NPSI+DLPLI AYQAVV S
Sbjct  84   NCVRLTWPLFLVTNDSIASLTLRNSFQNLGLIQSLNGVQAINPSIIDLPLIKAYQAVVKS  143

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L +  VM+ILDNH+S+PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+F G +NVV M
Sbjct  144  LGENDVMVILDNHVSQPGWCCSNLDGNGFFGDQYFDPDLWIMGLTKMATIFKGVTNVVAM  203



>ref|XP_007132485.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
 gb|ESW04479.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
Length=530

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            TV   PL T+ RWIVNE+G+RVKLACVNWV+HL+ VVAEGLS+QP+D ISK+I  MGFNC
Sbjct  21   TVKGFPLHTSDRWIVNENGKRVKLACVNWVSHLDTVVAEGLSQQPLDTISKRIKSMGFNC  80

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            VRLTWPL L TN SLASLTVR SFKNL LL+SI  +QA NPSI+DLPLI AYQ VV SL 
Sbjct  81   VRLTWPLLLLTNHSLASLTVRNSFKNLALLQSIDAVQAINPSIIDLPLIKAYQEVVKSLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  VM+ILDNH++ PGWCCSS DGNGFFGD YFDP LW+IGLT +AT+F G SNVVGM
Sbjct  141  ENDVMVILDNHVTVPGWCCSSMDGNGFFGDQYFDPDLWIIGLTNMATLFKGVSNVVGM  198



>gb|AES72136.2| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=608

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PL TN RWIVNES +RVKLACVNW +HL+  VAEGLS QP+DVISK I  MGFNCV
Sbjct  27   VTALPLHTNGRWIVNESEKRVKLACVNWASHLDTSVAEGLSHQPLDVISKGIKSMGFNCV  86

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL L TNDS AS+ VR S  NLGLL+SI+G+QANNPSI+DLPLI AYQ VV SL  
Sbjct  87   RLTWPLLLLTNDSFASIKVRHSLHNLGLLQSISGIQANNPSIIDLPLIKAYQTVVKSLGD  146

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              +M+ILDNH+++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG +NVVGM
Sbjct  147  MDLMVILDNHVTQPGWCCSNSDGNGFFGDQYFDPDLWLMGLTKMATLFNGVTNVVGM  203



>ref|XP_008236799.1| PREDICTED: uncharacterized protein LOC103335561 [Prunus mume]
Length=544

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  278
            P  V+  LSTNSRWIV+  G+RVKLACVNWV+HLE V+AEGLSKQPVD ISK+I  +GFN
Sbjct  28   PATVSATLSTNSRWIVDYKGQRVKLACVNWVSHLEAVIAEGLSKQPVDTISKRIASLGFN  87

Query  279  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            CV+LTWP FL TND+LAS+TV+QSF++L L ESIAGLQ+NNPSI++L L+ AYQAVV SL
Sbjct  88   CVKLTWPTFLATNDTLASVTVQQSFQSLNLSESIAGLQSNNPSIINLTLLQAYQAVVNSL  147

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             K  VM+ILDNH+SKPGWCCSS DGNGFFGD YF+P +W+ GLT++AT+FNG   VVGM
Sbjct  148  GKNNVMVILDNHVSKPGWCCSSSDGNGFFGDQYFNPDVWIKGLTRMATLFNGVGFVVGM  206



>ref|XP_008793719.1| PREDICTED: uncharacterized protein LOC103709945 [Phoenix dactylifera]
Length=530

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            ++A PLST+SRWIV+ESG+RVKLACVNW +HLE V+AEG+ KQP+D ISK+I  MGFNCV
Sbjct  1    MIALPLSTSSRWIVDESGQRVKLACVNWPSHLETVLAEGMGKQPLDTISKEIASMGFNCV  60

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPLFL TNDSLA+LTV+QSF+ LGL ES+A ++ NN ++VDLPLI A++AVV +L  
Sbjct  61   RLTWPLFLATNDSLANLTVQQSFQALGLAESLAAIRVNNQALVDLPLIQAFKAVVTNLGD  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              +M+ILDNHISKPGWCCS++DGNGFFGD YFDP +WV GLT++AT FNGT+NVVGM
Sbjct  121  NNIMVILDNHISKPGWCCSNFDGNGFFGDKYFDPDVWVKGLTRMATTFNGTTNVVGM  177



>ref|XP_003601885.1| Endoglucanase [Medicago truncatula]
Length=655

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PL TN RWIVNES +RVKLACVNW +HL+  VAEGLS QP+DVISK I  MGFNCV
Sbjct  17   VTALPLHTNGRWIVNESEKRVKLACVNWASHLDTSVAEGLSHQPLDVISKGIKSMGFNCV  76

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL L TNDS AS+ VR S  NLGLL+SI+G+QANNPSI+DLPLI AYQ VV SL  
Sbjct  77   RLTWPLLLLTNDSFASIKVRHSLHNLGLLQSISGIQANNPSIIDLPLIKAYQTVVKSLGD  136

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              +M+ILDNH+++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG +NVVGM
Sbjct  137  MDLMVILDNHVTQPGWCCSNSDGNGFFGDQYFDPDLWLMGLTKMATLFNGVTNVVGM  193



>ref|XP_010682344.1| PREDICTED: uncharacterized protein LOC104897211 [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PLST+SRWIV+E G RVKLACVNW +HLE+VVAEGL +QPVDVISKKI D+GFNCVRL
Sbjct  30   ALPLSTSSRWIVDEEGHRVKLACVNWASHLELVVAEGLGQQPVDVISKKIKDLGFNCVRL  89

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWPL+L TN+SLA LTVR+SF N GL +SI+GLQANNPSIVDL LI A+QAVV SL   K
Sbjct  90   TWPLYLATNESLACLTVRESFVNAGLSDSISGLQANNPSIVDLSLINAFQAVVASLTNNK  149

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            VM+ILDNHIS PGWCCS YDGNGFFGD YF+P LW+ GLTK+AT+F     V+GM
Sbjct  150  VMVILDNHISTPGWCCSKYDGNGFFGDQYFNPDLWINGLTKMATLFKDNPFVIGM  204



>gb|KEH20742.1| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=558

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T+SRWIVN+ G RVKLAC+NWV+HL+ VVAEGLSK+PVDVIS  I  MGFNCVRLTW
Sbjct  29   PLGTSSRWIVNQDGERVKLACLNWVSHLDAVVAEGLSKKPVDVISNGIKSMGFNCVRLTW  88

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P+ L TND+L+SLTVRQSF+NLGLL+S+A  Q+NNPSI+D+ LI A+QAVV SL    VM
Sbjct  89   PILLLTNDTLSSLTVRQSFQNLGLLQSVAAFQSNNPSIIDVSLIQAFQAVVKSLGDNDVM  148

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDNHI++PGWCCS+ DGNGFFGD YFDP LW+ GLTK+AT+FNG SNVVGM
Sbjct  149  VILDNHITQPGWCCSNSDGNGFFGDQYFDPNLWIQGLTKMATLFNGVSNVVGM  201



>ref|XP_010249431.1| PREDICTED: uncharacterized protein LOC104591975 [Nelumbo nucifera]
Length=541

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    A PL T+SRWIV+ESG+RVKLAC NWV+HL+ V+AEGL++QP+DVISK IV MGF
Sbjct  26   PAIATALPLYTDSRWIVDESGKRVKLACANWVSHLQPVLAEGLNRQPLDVISKWIVSMGF  85

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NC+RLTWPL++ TND+LASLTV+QSF++LGLLESI  ++ NNPS+++L +I A+QAVV +
Sbjct  86   NCIRLTWPLWVATNDTLASLTVQQSFESLGLLESIGAIRVNNPSMLNLTIIQAFQAVVSN  145

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L K  VM+I+DNHIS+PGWCC++ DGNGFFGDIYFDP LW+ GLT++AT+FNGTSNV+GM
Sbjct  146  LGKNGVMVIIDNHISQPGWCCANRDGNGFFGDIYFDPDLWIKGLTRMATLFNGTSNVIGM  205



>ref|XP_004309996.1| PREDICTED: uncharacterized protein LOC101307271 [Fragaria vesca 
subsp. vesca]
Length=550

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST+SRWIV+E+G+RVKLACVNWV+HL+ VVAEGLSKQP+D ISK+I  +GFNCVRLTW
Sbjct  25   PLSTSSRWIVDENGQRVKLACVNWVSHLDPVVAEGLSKQPLDSISKRITSLGFNCVRLTW  84

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            PL+L TNDSLA++TVRQSF++LGL ESIAG+Q+NNPS++DLPL+ A+Q VV +L    VM
Sbjct  85   PLYLATNDSLAAVTVRQSFQSLGLQESIAGVQSNNPSLIDLPLLKAFQEVVTNLGNNNVM  144

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDNH+SKPGWCCS+ D NGFFGD YF+P LW+ GLT++AT+F G SNVVGM
Sbjct  145  VILDNHVSKPGWCCSNNDDNGFFGDKYFNPDLWIKGLTQMATLFKGVSNVVGM  197



>ref|XP_008446127.1| PREDICTED: uncharacterized protein LOC103488945 [Cucumis melo]
Length=554

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            +A    V  PL T++RWIV+  G RVKL CVNWV+HLE VVAEGLSKQP++ IS +I  +
Sbjct  14   VAASAAVGLPLHTDTRWIVDGEGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIEGL  73

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TN+SL SLTVRQSF+ LGL E+IAG+QANNP I+DLPL+ A++AVV
Sbjct  74   GFNCVRLTWPLFLATNESLNSLTVRQSFQRLGLTEAIAGIQANNPFIIDLPLLKAFEAVV  133

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
            G L + K+M+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++ATMFNG ++VV
Sbjct  134  GKLGEGKLMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRMATMFNGVNHVV  193

Query  630  GM  635
             M
Sbjct  194  AM  195



>gb|KGN51727.1| hypothetical protein Csa_5G593400 [Cucumis sativus]
Length=550

 Score =   271 bits (692),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            +A    V  PL T++RWIV+ +G RVKL CVNWV+HLE VVAEGLSKQP++ IS +I  +
Sbjct  12   VAASAAVGLPLHTDTRWIVDGAGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIQWL  71

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TN+SL SLTVRQSF+ LGL E+IAG+QANNP I+DLPL+ A++AVV
Sbjct  72   GFNCVRLTWPLFLATNESLNSLTVRQSFQRLGLAEAIAGIQANNPFIIDLPLLKAFEAVV  131

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
            G L + K+M+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++ATMFNG ++VV
Sbjct  132  GKLGEGKLMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRIATMFNGVNHVV  191

Query  630  GM  635
             M
Sbjct  192  AM  193



>ref|XP_004135502.1| PREDICTED: uncharacterized protein LOC101217177 [Cucumis sativus]
Length=549

 Score =   270 bits (691),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            +A    V  PL T++RWIV+ +G RVKL CVNWV+HLE VVAEGLSKQP++ IS +I  +
Sbjct  11   VAASAAVGLPLHTDTRWIVDGAGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIQWL  70

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TN+SL SLTVRQSF+ LGL E+IAG+QANNP I+DLPL+ A++AVV
Sbjct  71   GFNCVRLTWPLFLATNESLNSLTVRQSFQRLGLAEAIAGIQANNPFIIDLPLLKAFEAVV  130

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
            G L + K+M+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++ATMFNG ++VV
Sbjct  131  GKLGEGKLMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRIATMFNGVNHVV  190

Query  630  GM  635
             M
Sbjct  191  AM  192



>ref|XP_010044528.1| PREDICTED: uncharacterized protein LOC104433472 [Eucalyptus grandis]
 gb|KCW86615.1| hypothetical protein EUGRSUZ_B03243 [Eucalyptus grandis]
Length=560

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              A PLST+SRWIV+ SGRRVKLAC NWV+HLE VVAEGLSKQP+  IS +I  +GFNCV
Sbjct  26   AAASPLSTSSRWIVDGSGRRVKLACANWVSHLEPVVAEGLSKQPLGAISARIASLGFNCV  85

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPLFL TNDSLASLTVRQSF+ LGL ++I+G+QANNP I+DL LI  +QAVV SL  
Sbjct  86   RLTWPLFLATNDSLASLTVRQSFQGLGLADAISGIQANNPDILDLSLIETFQAVVSSLGD  145

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC   DGNGFFGD YFDP LW+ GLT++AT+F G  NVVGM
Sbjct  146  NDVMVILDNHLTKPGWCCGYSDGNGFFGDQYFDPDLWIHGLTRMATLFRGVGNVVGM  202



>ref|XP_004504142.1| PREDICTED: uncharacterized protein LOC101503968 [Cicer arietinum]
Length=554

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 151/185 (82%), Gaps = 3/185 (2%)
 Frame = +3

Query  90   LAPPTVV---AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKI  260
            +A P V    A  L T+SRWIVN+ G RVKLACVNWV+HL+ VVAEGLSK+PVDVIS  I
Sbjct  18   VAEPVVAVSDALSLKTSSRWIVNQDGERVKLACVNWVSHLDAVVAEGLSKKPVDVISHGI  77

Query  261  VDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  440
              MGFNCVRLTWP+ L TN SL+SLTVRQSF+NLGLL++IAG Q+NNPSI+DL LI A+Q
Sbjct  78   KSMGFNCVRLTWPILLLTNQSLSSLTVRQSFQNLGLLDTIAGFQSNNPSIIDLSLIHAFQ  137

Query  441  AVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS  620
            AVV SL    VM+ILDNH+++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG  
Sbjct  138  AVVKSLGDNDVMVILDNHMTQPGWCCSNTDGNGFFGDQYFDPNLWILGLTKMATLFNGVP  197

Query  621  NVVGM  635
             VV M
Sbjct  198  TVVAM  202



>gb|KHN29014.1| Endoglucanase [Glycine soja]
Length=533

 Score =   267 bits (682),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            L T+SRWI+N+ G+RVKLACVNWV+HLEV VAEGLSK+PVD ISK I  MGFNCVRLTWP
Sbjct  7    LHTDSRWILNQDGQRVKLACVNWVSHLEVAVAEGLSKKPVDAISKGIKSMGFNCVRLTWP  66

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
              L TNDSLASL+VR+SF++LGLLES+AG+Q NNPSI+DLPLI A+QAVV SL    VM+
Sbjct  67   TLLATNDSLASLSVRRSFQSLGLLESVAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMV  126

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ILDNH++ PGWCC   DGNGFFGD +F+P  W+ GLTK+AT+FNG +NVVGM
Sbjct  127  ILDNHLTNPGWCCGYSDGNGFFGDKFFNPDQWIFGLTKMATLFNGVTNVVGM  178



>ref|XP_008389747.1| PREDICTED: uncharacterized protein LOC103452051 [Malus domestica]
Length=545

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PLST+ RWIV+E+GRRVKLACVNWV+HL+ V+AEGLSKQPV+ I K+I  +GFNCV
Sbjct  20   VSALPLSTHKRWIVDENGRRVKLACVNWVSHLDTVLAEGLSKQPVNAIIKRITSLGFNCV  79

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPLFL TN +LA +TVRQSF++LGLL SI+GLQ+NNP  +DL LI A+QAVV SL K
Sbjct  80   RLTWPLFLATNSTLAEVTVRQSFQSLGLLGSISGLQSNNPGFLDLSLIKAFQAVVSSLGK  139

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM++LDNH+SKPGWCCS+ DGNGFFGD YF+P  W++GLT++A +F+G  NVVGM
Sbjct  140  NNVMVVLDNHLSKPGWCCSNTDGNGFFGDEYFNPDNWIVGLTRMAALFHGVRNVVGM  196



>ref|XP_003532808.1| PREDICTED: uncharacterized protein LOC100818309 [Glycine max]
Length=574

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            L T+SRWI+N+ G+RVKLACVNWV+HLEV VAEGLSK+PVD ISK I  MGFNCVRLTWP
Sbjct  48   LHTDSRWILNQGGQRVKLACVNWVSHLEVAVAEGLSKKPVDAISKGIKSMGFNCVRLTWP  107

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
              L TNDSLASL+VR+SF++LGLLES+AG+Q NNPSI+DLPLI A+QAVV SL    VM+
Sbjct  108  TLLATNDSLASLSVRRSFQSLGLLESVAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMV  167

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ILDNH++ PGWCC   DGNGFFGD +F+P  W+ GLTK+AT+FNG +NVVGM
Sbjct  168  ILDNHLTNPGWCCGYSDGNGFFGDKFFNPDQWIFGLTKMATLFNGVTNVVGM  219



>ref|XP_009387346.1| PREDICTED: uncharacterized protein LOC103974285 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+ESG RVKLACVNWV+HLE VV EG+ KQP+D ISKKI  MGFNCVRLTWPLFL T
Sbjct  36   RWIVDESGLRVKLACVNWVSHLEPVVVEGMGKQPLDTISKKIAAMGFNCVRLTWPLFLVT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            NDSLA LTVRQSF+ LGL+ESIA +Q NNP +++L LI A++AVV +LA   VM+ILDNH
Sbjct  96   NDSLAGLTVRQSFQALGLMESIAAIQVNNPDLLNLTLIQAFKAVVSNLADNNVMVILDNH  155

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ISKPGWCCS++DGNGFFGD YFD + W+ GLTK+ATMFNG+ NVVGM
Sbjct  156  ISKPGWCCSNFDGNGFFGDKYFDAEEWIKGLTKMATMFNGSPNVVGM  202



>gb|KJB78033.1| hypothetical protein B456_012G173600 [Gossypium raimondii]
Length=579

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 156/184 (85%), Gaps = 3/184 (2%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            H+ P T +  PLSTNSRWIV+ ++ RRVKLACVNW +HLE V AEGLSK+ +D I+++IV
Sbjct  16   HVNPTTSL--PLSTNSRWIVDDQTDRRVKLACVNWPSHLEPVFAEGLSKRSMDSIAEQIV  73

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLTWPL+L TNDSL+SLTVR+SF+NLGL+E IAG+QANNPS++D+ LI A+QA
Sbjct  74   SMGFNCVRLTWPLYLVTNDSLSSLTVRRSFQNLGLMEPIAGIQANNPSVIDVSLIQAFQA  133

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL K  VM+ILDNH+SKPGWCC  +DG+GFF D YF+P LWV GLT++AT+FNG +N
Sbjct  134  VVSSLGKNNVMVILDNHLSKPGWCCGYFDGDGFFSDPYFNPDLWVTGLTRMATLFNGVTN  193

Query  624  VVGM  635
            VVGM
Sbjct  194  VVGM  197



>gb|KHN06534.1| Endoglucanase [Glycine soja]
Length=566

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            L T+SRWI+++ GRRVKLACVNWV+HLE VVAEGLSK+PVDVISK I  MGFNCVRLTWP
Sbjct  43   LHTDSRWILDQDGRRVKLACVNWVSHLEAVVAEGLSKKPVDVISKGIKSMGFNCVRLTWP  102

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
              L TNDSLASLTVR+SF++LGLLESIAG+Q NNPSI+DL LI A+QAVV SL    VM+
Sbjct  103  TLLVTNDSLASLTVRRSFQSLGLLESIAGVQTNNPSIIDLSLIQAFQAVVKSLGDNDVMV  162

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ILDNH+++PGWCC + DGNGFFGD +FDP  W++GLTK+AT+F G + VVG+
Sbjct  163  ILDNHVTQPGWCCGNTDGNGFFGDKFFDPNQWILGLTKMATLFKGVTAVVGI  214



>ref|XP_003524249.1| PREDICTED: uncharacterized protein LOC100789885 [Glycine max]
Length=571

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            L T+SRWI+++ GRRVKLACVNWV+HLE VVAEGLSK+PVDVISK I  MGFNCVRLTWP
Sbjct  45   LHTDSRWILDQDGRRVKLACVNWVSHLEAVVAEGLSKKPVDVISKGIKSMGFNCVRLTWP  104

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
              L TNDSLASLTVR+SF++LGLLESIAG+Q NNPSI+DL LI A+QAVV SL    VM+
Sbjct  105  TLLVTNDSLASLTVRRSFQSLGLLESIAGVQTNNPSIIDLSLIQAFQAVVKSLGDNDVMV  164

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ILDNH+++PGWCC + DGNGFFGD +FDP  W++GLTK+AT+F G + VVG+
Sbjct  165  ILDNHVTQPGWCCGNTDGNGFFGDKFFDPNQWILGLTKMATLFKGVTAVVGI  216



>ref|XP_010250982.1| PREDICTED: uncharacterized protein LOC104593037 isoform X2 [Nelumbo 
nucifera]
Length=531

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PL T+SRWIV+E+G+RVKL CVNW +HL+ ++AEGL+KQP+DVISK+IV MGFNCVR 
Sbjct  29   ALPLYTDSRWIVDETGKRVKLGCVNWASHLQPLLAEGLNKQPLDVISKQIVAMGFNCVRF  88

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWPL++ TND+L+S+TV+QSF++LGLLESI  ++ NNPS+++L ++ A+Q VV +L +  
Sbjct  89   TWPLWMATNDTLSSMTVQQSFESLGLLESIGAIRVNNPSMLNLTILQAFQTVVSNLGENG  148

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            VM+ILDNHISKPGWCCS+ DGNG+FGDIYFDP LW+ GLT++AT+FNGTSNV+GM
Sbjct  149  VMVILDNHISKPGWCCSNTDGNGYFGDIYFDPNLWIEGLTRMATLFNGTSNVIGM  203



>ref|XP_010250979.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010250981.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PL T+SRWIV+E+G+RVKL CVNW +HL+ ++AEGL+KQP+DVISK+IV MGFNCVR 
Sbjct  29   ALPLYTDSRWIVDETGKRVKLGCVNWASHLQPLLAEGLNKQPLDVISKQIVAMGFNCVRF  88

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWPL++ TND+L+S+TV+QSF++LGLLESI  ++ NNPS+++L ++ A+Q VV +L +  
Sbjct  89   TWPLWMATNDTLSSMTVQQSFESLGLLESIGAIRVNNPSMLNLTILQAFQTVVSNLGENG  148

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            VM+ILDNHISKPGWCCS+ DGNG+FGDIYFDP LW+ GLT++AT+FNGTSNV+GM
Sbjct  149  VMVILDNHISKPGWCCSNTDGNGYFGDIYFDPNLWIEGLTRMATLFNGTSNVIGM  203



>ref|XP_004504189.1| PREDICTED: uncharacterized protein LOC101490831 [Cicer arietinum]
Length=527

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T+SRWIVN++G RVKLACVNWV+HL+ VVAEGLSK+PVD IS  I  MGFNCVRLTW
Sbjct  28   PLKTSSRWIVNQNGVRVKLACVNWVSHLDAVVAEGLSKKPVDAISNIIKSMGFNCVRLTW  87

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P+ L TN SL+SLTVRQSF+N GLL++IAG Q+NNPSI+DL LI A+QAVV SL    VM
Sbjct  88   PIHLLTNQSLSSLTVRQSFQNHGLLDTIAGFQSNNPSIIDLSLIQAFQAVVKSLGDNNVM  147

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDNH+++PGWCC++ DGNGFFGD YFDP LW+ GLTK+AT+FNG   VV M
Sbjct  148  VILDNHVTQPGWCCTNTDGNGFFGDQYFDPSLWITGLTKMATLFNGVPTVVAM  200



>ref|XP_011086688.1| PREDICTED: uncharacterized protein LOC105168334 [Sesamum indicum]
Length=574

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            +A  TV AQPLST+SRWIV+E+G+RVKL+CVNW +HLEVVVAEGLSKQPVD IS++I  +
Sbjct  34   IAVSTVAAQPLSTDSRWIVDETGQRVKLSCVNWPSHLEVVVAEGLSKQPVDKISEEIRSL  93

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFLFTND+LA+LTVRQS  NLGL E++AG Q NNP I+DL L+ AYQAVV
Sbjct  94   GFNCVRLTWPLFLFTNDTLAALTVRQSLTNLGLFEAVAGFQTNNPDIIDLSLMDAYQAVV  153

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
            GSL K  VM++LDNH SKPGWCC   DGNGFFGD YF+P LWV GLT+VAT F  T +VV
Sbjct  154  GSLGKKNVMVVLDNHTSKPGWCCGDGDGNGFFGDEYFNPDLWVKGLTRVATTFKDTKHVV  213

Query  630  GM  635
            GM
Sbjct  214  GM  215



>ref|XP_010249430.1| PREDICTED: uncharacterized protein LOC104591974 [Nelumbo nucifera]
Length=538

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              A PL TNS+WIV+E+G+RVKLACVNW++HL+ ++AEGL++QP+D ISK IV MGFNCV
Sbjct  28   AAALPLYTNSQWIVDENGQRVKLACVNWISHLQPLLAEGLNRQPLDTISKTIVSMGFNCV  87

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            R TWPLF+ TN+SL SL VRQSF+NLGL ESI  +  NNPS+++L +I A++AVV +L  
Sbjct  88   RFTWPLFMATNESLYSLNVRQSFENLGLNESIGAILVNNPSMLNLTVIQAFKAVVDNLGD  147

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNHISKPGWCCS  DGNGFFGD YFDP+LW+ GLT++AT FNGT+NV+GM
Sbjct  148  NNVMVILDNHISKPGWCCSRTDGNGFFGDTYFDPELWIKGLTQMATWFNGTTNVIGM  204



>ref|XP_006292902.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
 gb|EOA25800.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
Length=511

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST SRWI++E+G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKIV+MGFNCVR
Sbjct  1    MAFPLSTKSRWIIDENGQRVKLACVNWPSHLQPVVAEGLSKQRVDDVAKKIVEMGFNCVR  60

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL++ I+G Q  NPS++DLPL+ AY+ VV  L  
Sbjct  61   LTWPLDLATNETLANNVTVRQSFQSLGLIDDISGFQTKNPSMIDLPLMEAYKTVVAKLGN  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC   DGNGFFGD YFDP  W+ GLTK+AT F GTSNVVGM
Sbjct  121  KNVMVILDNHVTKPGWCCGYDDGNGFFGDTYFDPATWIAGLTKIATTFKGTSNVVGM  177



>gb|KCW59703.1| hypothetical protein EUGRSUZ_H02464 [Eucalyptus grandis]
Length=470

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVAQ L  NSRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  27   VVAQKLYANSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  86

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL L  N++LAS TV QSF+NLGLLES+AG+++NNPS+++LP++ AY++V+ SL  
Sbjct  87   RLTWPLELPINETLASFTVTQSFQNLGLLESLAGIKSNNPSLINLPVMEAYKSVITSLRN  146

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GM
Sbjct  147  NQVMVILDNHITTPGWCCSEKDGNGFFGDTYFDPQVWMQGLHKMATMATGFSNVIGM  203



>emb|CDY40992.1| BnaA02g27820D [Brassica napus]
Length=418

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 146/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLSTNSRWI+NE G+RVKLACVNW  HL++VVAEGLSKQP+D +SKKI+ MGFNCVR
Sbjct  25   MAYPLSTNSRWIINEKGQRVKLACVNWPAHLQLVVAEGLSKQPLDAVSKKIMAMGFNCVR  84

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + IAG Q  NPS++DLPLI AY++VV +L  
Sbjct  85   LTWPLDLATNETLATNVTVRQSFQSLGLSDDIAGFQTKNPSMIDLPLIEAYKSVVTTLGN  144

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            + +M++LDNH++KPGWCC   D NGFFGD +F+P  W+ GLTK+AT+F   S VVGM
Sbjct  145  HNLMVVLDNHLTKPGWCCRFNDSNGFFGDTFFEPGSWIAGLTKIATLFKDASYVVGM  201



>ref|XP_003552802.1| PREDICTED: uncharacterized protein LOC100805196 [Glycine max]
Length=533

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            L    V A PL T +RWIV+ +  RVKLACVNWV+HLE +VAEGL ++P+D I+K+I  M
Sbjct  24   LQTKVVKAFPLYTQNRWIVDGNATRVKLACVNWVSHLEYMVAEGLGERPLDGIAKEIKSM  83

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWP++L TNDSLA+LTVRQSF NLGL ++I+ LQ NNPS++DLPLI AYQ VV
Sbjct  84   GFNCVRLTWPIYLITNDSLATLTVRQSFNNLGLPQAISALQVNNPSLIDLPLIKAYQDVV  143

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
              L    +M+ILDNH+SKP WCCS+ DGNGFFGD YFDP LW+ GLTK+AT+F G +NVV
Sbjct  144  KGLGDKGLMVILDNHVSKPQWCCSNDDGNGFFGDQYFDPDLWIKGLTKMATLFKGVTNVV  203

Query  630  GM  635
             M
Sbjct  204  AM  205



>ref|XP_009385963.1| PREDICTED: uncharacterized protein LOC103973176 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=556

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  93   APPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMG  272
            A P  +A PLST+SRW+V+  GRRVKLACVNW  HLE  VAEGLSKQP+D ISK +  MG
Sbjct  25   ASPAPIALPLSTSSRWVVDGEGRRVKLACVNWAAHLEPAVAEGLSKQPLDAISKSVAAMG  84

Query  273  FNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            FNCVRLTWPL+L T+ S  S+TVRQS + LGL ES AG++ NNP ++DL L+ A+QAVV 
Sbjct  85   FNCVRLTWPLYLLTDSSFGSVTVRQSLERLGLAESAAGVRVNNPGLLDLTLVQAFQAVVS  144

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +LA   +M+ILDN ISKPGWCCS YD NGFFGD YFDP  W+ GL  +ATMFN +++VVG
Sbjct  145  NLASNSLMVILDNQISKPGWCCSKYDDNGFFGDKYFDPDEWLRGLEMMATMFNSSTSVVG  204

Query  633  M  635
            M
Sbjct  205  M  205



>ref|XP_009385956.1| PREDICTED: uncharacterized protein LOC103973176 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  93   APPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMG  272
            A P  +A PLST+SRW+V+  GRRVKLACVNW  HLE  VAEGLSKQP+D ISK +  MG
Sbjct  25   ASPAPIALPLSTSSRWVVDGEGRRVKLACVNWAAHLEPAVAEGLSKQPLDAISKSVAAMG  84

Query  273  FNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            FNCVRLTWPL+L T+ S  S+TVRQS + LGL ES AG++ NNP ++DL L+ A+QAVV 
Sbjct  85   FNCVRLTWPLYLLTDSSFGSVTVRQSLERLGLAESAAGVRVNNPGLLDLTLVQAFQAVVS  144

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +LA   +M+ILDN ISKPGWCCS YD NGFFGD YFDP  W+ GL  +ATMFN +++VVG
Sbjct  145  NLASNSLMVILDNQISKPGWCCSKYDDNGFFGDKYFDPDEWLRGLEMMATMFNSSTSVVG  204

Query  633  M  635
            M
Sbjct  205  M  205



>gb|AAD31066.1|AC007357_15 F3F19.15 [Arabidopsis thaliana]
Length=522

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 146/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            ++ PLST+SRWIV+E+G RVKL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  1    MSYPLSTSSRWIVDENGLRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  60

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DLPLI AY+ VV +L  
Sbjct  61   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLPLIEAYKTVVTTLGN  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  FNG SNVVGM
Sbjct  121  NDVMVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNVVGM  177



>ref|XP_010514260.1| PREDICTED: uncharacterized protein LOC104790246 [Camelina sativa]
Length=511

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST S WI++E G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKI++MGFNCVR
Sbjct  49   MAFPLSTKSHWIIDEKGQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAKKILEMGFNCVR  108

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF+ LGL + I+G Q  NPS++DLPLI AY+ VV  L  
Sbjct  109  LTWPLDLATNETLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGD  168

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+AT F GTSNVVGM
Sbjct  169  KNVMVILDNHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGM  225



>ref|XP_010026599.1| PREDICTED: uncharacterized protein LOC104416971 [Eucalyptus grandis]
Length=419

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +3

Query  30   MENKYSFllclilcniiiSHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVV  209
            M  + S+L  + L  ++ S  A P      L T+SRWIV++ GRRVKLACVNW +HLE +
Sbjct  1    MRRRPSYLCFIALWALVASRHAEPAKAPWRLHTDSRWIVDKHGRRVKLACVNWASHLEPM  60

Query  210  VAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGL  389
            VAEGL K+PVD ISK+I  MGFNCVRLTWPLF+ TNDSL S++V QSF+NLGL++ I G+
Sbjct  61   VAEGLDKKPVDWISKQIASMGFNCVRLTWPLFMVTNDSLGSMSVAQSFRNLGLVDYIGGI  120

Query  390  QANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPK  569
            + NN S++D+ ++ A++AVV SL    VM+ILDNHISKPGWCCS+ D NGFFGD YFDP 
Sbjct  121  RQNNLSLLDVSVLAAFRAVVKSLGDNNVMVILDNHISKPGWCCSNRDSNGFFGDPYFDPN  180

Query  570  LWVIGLTKVATMFNGTSNVVGM  635
            LW+ GLT++AT+F+   NVVGM
Sbjct  181  LWIKGLTRMATLFHRVGNVVGM  202



>ref|NP_172772.2| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AAU05478.1| At1g13130 [Arabidopsis thaliana]
 gb|AEE28973.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=552

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 146/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            ++ PLST+SRWIV+E+G RVKL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MSYPLSTSSRWIVDENGLRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DLPLI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLPLIEAYKTVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  FNG SNVVGM
Sbjct  151  NDVMVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNVVGM  207



>gb|KCW59699.1| hypothetical protein EUGRSUZ_H02457, partial [Eucalyptus grandis]
Length=528

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            S  A P   +  L T SRWIV++ G RVKLACVNW +HLE +VAEGL K+PVD ISK+I 
Sbjct  19   SQHAEPAKASWRLHTESRWIVDKHGHRVKLACVNWASHLEPMVAEGLDKKPVDWISKQIA  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLTWPLF+ TNDSL S++V QSF++LGL++ I G++ NNPS++D+ ++ A++A
Sbjct  79   SMGFNCVRLTWPLFMVTNDSLGSMSVAQSFRDLGLVDYIGGIRQNNPSLLDVSVLAAFRA  138

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL    VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++ATM     N
Sbjct  139  VVTSLGDNSVMVILDNHISKPGWCCSNRDGNGFFGDQYFDPNLWIKGLTRMATMIRRIGN  198

Query  624  VVGM  635
            VVGM
Sbjct  199  VVGM  202



>ref|XP_010026595.1| PREDICTED: uncharacterized protein LOC104416964 [Eucalyptus grandis]
Length=535

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            S  A P   +  L T SRWIV++ G RVKLACVNW +HLE +VAEGL K+PVD ISK+I 
Sbjct  19   SQHAEPAKASWRLHTESRWIVDKHGHRVKLACVNWASHLEPMVAEGLDKKPVDWISKQIA  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLTWPLF+ TNDSL S++V QSF++LGL++ I G++ NNPS++D+ ++ A++A
Sbjct  79   SMGFNCVRLTWPLFMVTNDSLGSMSVAQSFRDLGLVDYIGGIRQNNPSLLDVSVLAAFRA  138

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL    VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++ATM     N
Sbjct  139  VVTSLGDNSVMVILDNHISKPGWCCSNRDGNGFFGDQYFDPNLWIKGLTRMATMIRRIGN  198

Query  624  VVGM  635
            VVGM
Sbjct  199  VVGM  202



>ref|XP_010425288.1| PREDICTED: uncharacterized protein LOC104710406 [Camelina sativa]
Length=555

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST SRWI++  G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKI++MGFNCVR
Sbjct  48   MAFPLSTKSRWIIDVKGQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAKKILEMGFNCVR  107

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TND+LA+ +TVRQSF+ LGL + I+G Q  NPS++DLPLI AY+ VV  L  
Sbjct  108  LTWPLDLATNDTLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGD  167

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+AT F GTSNVVGM
Sbjct  168  RNVMVILDNHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGM  224



>ref|XP_010458756.1| PREDICTED: uncharacterized protein LOC104739968 isoform X2 [Camelina 
sativa]
Length=516

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E G+R+KL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDEKGQRIKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNITVRQSFQSLGLYDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGM
Sbjct  151  NNVMVILDNHLTKPGWCCANNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGM  207



>ref|XP_007159684.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
 gb|ESW31678.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
Length=573

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            L T+SRWIV + GRRVKLACVNWV+HLEV V EGLSK+PVDVISK I  MGFNCVRLTWP
Sbjct  47   LHTDSRWIVGQDGRRVKLACVNWVSHLEVAVPEGLSKKPVDVISKGIKSMGFNCVRLTWP  106

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
              L TNDSLASL+VR SF+ LGLLE +AG+Q NNPSI+DLPLI A++A+V +L    VM+
Sbjct  107  TLLVTNDSLASLSVRSSFQKLGLLEPVAGVQTNNPSIIDLPLIQAFEAMVKNLGDNDVMV  166

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ILDNH+++PGWCC + DGNGFF D +F+P  W+ GLTK+AT+F G   VVGM
Sbjct  167  ILDNHLTQPGWCCGNTDGNGFFTDKFFNPDQWISGLTKMATLFKGVKTVVGM  218



>ref|XP_010691763.1| PREDICTED: uncharacterized protein LOC104905020 [Beta vulgaris 
subsp. vulgaris]
Length=530

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            T  A PLST+SRWIV+ESG+RVKLACVNW +H+E++V EGL++QPVD ISKKI DMGFNC
Sbjct  19   TSYALPLSTDSRWIVDESGQRVKLACVNWPSHVELMVTEGLNEQPVDAISKKIRDMGFNC  78

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLL-ESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            VRLT+P++L TND+LAS++VRQ+F N+GL   +IA  QA NPSI+DLP I A+QAVV SL
Sbjct  79   VRLTYPIYLATNDTLASISVRQTFLNVGLPNRTIAKFQAYNPSIIDLPRIDAFQAVVTSL  138

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             K KVM+ILDNH+SKP WCC   DGNGFFGD YF+P+LW+ GLT +AT F     VVGM
Sbjct  139  GKNKVMVILDNHVSKPQWCCKQTDGNGFFGDKYFNPELWIKGLTNMATRFRDNPYVVGM  197



>ref|XP_006307168.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
 gb|EOA40066.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
Length=552

 Score =   253 bits (645),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E G+RVKL CVNW +HL+ +VAEGLSKQPVD ++KKIVDMGFNCVR
Sbjct  31   MAHPLSTSSRWIVDEKGQRVKLVCVNWPSHLQPIVAEGLSKQPVDALAKKIVDMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC + DGNGFFGD +FDP +WV  L K+A  F+G SNVVGM
Sbjct  151  NDVMVILDNHLTKPGWCCDNNDGNGFFGDQFFDPTVWVAALKKMAGTFDGVSNVVGM  207



>ref|XP_009152076.1| PREDICTED: uncharacterized protein LOC103875318 [Brassica rapa]
Length=559

 Score =   253 bits (645),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 147/179 (82%), Gaps = 4/179 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I  KIV MGFNCV
Sbjct  25   AFPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIGAKIVSMGFNCV  84

Query  285  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL+L T++S +  +TVRQS + LGLLE+I+G QANNP I+DLPLI A+Q VV SL 
Sbjct  85   RLTWPLYLATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLG  144

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGM  635
            K+++M+ILDNHIS+PGWCC+  DGNGFFGD Y +P+LW+ GL ++ATMF N +SNVVGM
Sbjct  145  KHRLMVILDNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKRMATMFANVSSNVVGM  203



>ref|XP_006417151.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
 gb|ESQ35504.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
Length=561

 Score =   253 bits (645),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+DL LI A++ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDLSLIEAFKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +W   L+K+AT F+G +NVVGM
Sbjct  151  NDVMVILDNHLTKPGWCCANNDGNGFFGDRFFDPTVWTAALSKMATTFDGVTNVVGM  207



>emb|CDY13613.1| BnaA06g33100D [Brassica napus]
Length=559

 Score =   252 bits (644),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 147/179 (82%), Gaps = 4/179 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I  KIV MGFNCV
Sbjct  25   AFPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIGAKIVSMGFNCV  84

Query  285  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL+L T++S +  +TVRQS + LGLLE+I+G QANNP I+DLPLI A+Q VV SL 
Sbjct  85   RLTWPLYLATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLG  144

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGM  635
            K+++M+ILDNHIS+PGWCC+  DGNGFFGD Y +P+LW+ GL ++ATMF N +SNVVGM
Sbjct  145  KHRLMVILDNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKRMATMFANVSSNVVGM  203



>ref|XP_010495004.1| PREDICTED: uncharacterized protein LOC104772051 [Camelina sativa]
Length=550

 Score =   252 bits (643),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E G+RVKL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDEKGQRVKLTCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TND+LA+ +TVRQSF++LGL + I G Q NNPSI+D+ LI AY+ VV +L  
Sbjct  91   LTWPLELMTNDTLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDISLIEAYKTVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGM
Sbjct  151  NNVMVILDNHLTKPGWCCANNDGNGFFGDQFFDPTVWVAALKKMAGTFDGVSNVVGM  207



>ref|XP_010026600.1| PREDICTED: uncharacterized protein LOC104416972 [Eucalyptus grandis]
Length=647

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVAQ L  NSRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  139  VVAQKLYANSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  198

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL L  N++LAS TV QSF+NLGLLES+AG+++NNPS+++LP++ AY++V+ SL  
Sbjct  199  RLTWPLELPINETLASFTVTQSFQNLGLLESLAGIKSNNPSLINLPVMEAYKSVITSLRN  258

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GM
Sbjct  259  NQVMVILDNHITTPGWCCSEKDGNGFFGDTYFDPQVWMQGLHKMATMATGFSNVIGM  315



>ref|XP_002876948.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53207.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLSTNSRWI++E G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKIV MGFNCVR
Sbjct  1    MAYPLSTNSRWIIDEKGQRVKLACVNWPSHLQPVVAEGLSKQGVDDLAKKIVAMGFNCVR  60

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I+G +  NPS++DLPLI AY+ VV  L  
Sbjct  61   LTWPLDLATNETLANNVTVRQSFQSLGLNDDISGFETKNPSMIDLPLIEAYKKVVAKLGN  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GL K+AT F G SNVVGM
Sbjct  121  KNVMVILDNHVTKPGWCCGYNDGNGFFGDTFFDPATWISGLIKIATTFKGASNVVGM  177



>ref|XP_010458755.1| PREDICTED: uncharacterized protein LOC104739968 isoform X1 [Camelina 
sativa]
Length=550

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E G+R+KL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDEKGQRIKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNITVRQSFQSLGLYDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGM
Sbjct  151  NNVMVILDNHLTKPGWCCANNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGM  207



>emb|CDX83590.1| BnaC07g23300D [Brassica napus]
Length=557

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 143/178 (80%), Gaps = 3/178 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I  KIV MGFNCV
Sbjct  24   AFPLSTDSRWIVDDGNKGRRVKLTCVNWASHLETAVAEGLSKQPLDSIGAKIVSMGFNCV  83

Query  285  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL+L T++S +  +TVRQS + LGLLE+I+G QANNP I+DLPLI A+Q VV SL 
Sbjct  84   RLTWPLYLATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLG  143

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            K ++++ILDNHIS+PGWCC+  DGNGFFGD Y +P+LW+ GL  +ATMF   SNVVGM
Sbjct  144  KNRLLVILDNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKNMATMFANVSNVVGM  201



>ref|XP_010502524.1| PREDICTED: uncharacterized protein LOC104779826 [Camelina sativa]
Length=534

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST SRWI++  G+RVKLACVNW +HL+ VVAEGLSKQ VD +++KI++MGFNCVR
Sbjct  27   MAFPLSTKSRWIIDVKGQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAEKILEMGFNCVR  86

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF+ LGL + I+G Q  NPS++DLPLI AY+ VV  L  
Sbjct  87   LTWPLDLATNETLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGD  146

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+AT F GTSNVVGM
Sbjct  147  KNVMVILDNHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGM  203



>ref|XP_006395579.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32865.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=507

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST SRWI++E G+RVKLAC NW  HL+ VVAEGLSKQPVD ++K IV MGFNCVR
Sbjct  26   MAYPLSTKSRWIIDEKGQRVKLACANWPAHLQPVVAEGLSKQPVDAVAKMIVAMGFNCVR  85

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL   ++G Q NNPS++DLPLI AY+ +V +L  
Sbjct  86   LTWPLDLATNETLATNVTVRQSFQSLGLNADMSGFQTNNPSMIDLPLIEAYKRLVATLGN  145

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            + VM+ILDNH +KPGWCC + DGNGFFGD +FDP  W+ GLTK+AT+F   SNVVGM
Sbjct  146  HNVMVILDNHSTKPGWCCGNDDGNGFFGDTFFDPATWIAGLTKMATIFKDVSNVVGM  202



>ref|XP_010026597.1| PREDICTED: uncharacterized protein LOC104416968 [Eucalyptus grandis]
 gb|KCW59702.1| hypothetical protein EUGRSUZ_H02462 [Eucalyptus grandis]
Length=514

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVAQ L  +SRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  7    VVAQQLYADSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  66

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTW L L  N++LASLTV QSF+NLGL ES+AG+++NNPS+++LPL+ AY++V+ SL  
Sbjct  67   RLTWALELPMNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKSVMTSLRN  126

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GM
Sbjct  127  NQVMVILDNHITTPGWCCSGEDGNGFFGDKYFDPQVWIQGLHKMATMATGFSNVIGM  183



>ref|XP_006395580.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32866.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=534

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST SRWI++E G+RVKLAC NW  HL+ VVAEGLSKQPVD ++K IV MGFNCVR
Sbjct  26   MAYPLSTKSRWIIDEKGQRVKLACANWPAHLQPVVAEGLSKQPVDAVAKMIVAMGFNCVR  85

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL   ++G Q NNPS++DLPLI AY+ +V +L  
Sbjct  86   LTWPLDLATNETLATNVTVRQSFQSLGLNADMSGFQTNNPSMIDLPLIEAYKRLVATLGN  145

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            + VM+ILDNH +KPGWCC + DGNGFFGD +FDP  W+ GLTK+AT+F   SNVVGM
Sbjct  146  HNVMVILDNHSTKPGWCCGNDDGNGFFGDTFFDPATWIAGLTKMATIFKDVSNVVGM  202



>ref|XP_010026596.1| PREDICTED: uncharacterized protein LOC104416965 [Eucalyptus grandis]
Length=515

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVAQ L  +SRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  7    VVAQQLYADSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  66

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTW L L  N++LASLTV QSF+NLGL ES+AG+++NNPS+++LPL+ AY++V+ SL  
Sbjct  67   RLTWALELPMNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKSVMTSLRN  126

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GM
Sbjct  127  NQVMVILDNHITTPGWCCSGEDGNGFFGDKYFDPQVWMQGLHKMATMATGFSNVIGM  183



>ref|XP_010476303.1| PREDICTED: uncharacterized protein LOC104755594 [Camelina sativa]
Length=559

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E G+RVKL C NW +HL+ VVAEGLSKQPVD ++KKIVDMGFNCVR
Sbjct  43   MAYPLSTSSRWIVDEKGQRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVDMGFNCVR  102

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVR SF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  103  LTWPLDLMTNETLANNVTVRHSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  162

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC + DGNGFFGD +FDP +WV  L K+A  F+G SNVVGM
Sbjct  163  NNVMVILDNHLTKPGWCCDNNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGM  219



>ref|XP_002889989.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66248.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=552

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+RVKL C NW +HL+ VVAEGLSKQP D ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRVKLMCANWPSHLQPVVAEGLSKQPADAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGM
Sbjct  151  NDVMVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFDGVSNVVGM  207



>ref|NP_189245.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 dbj|BAB02434.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77125.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=508

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLSTNSRWI++E G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKI+ MGFNCVR
Sbjct  1    MAYPLSTNSRWIIDEKGQRVKLACVNWPSHLQPVVAEGLSKQSVDDLAKKIMAMGFNCVR  60

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
             TWPL L TN++LA+ +TVRQSF++LGL + I+G +  NPS++DLPLI AY+ VV  L  
Sbjct  61   FTWPLDLATNETLANNVTVRQSFQSLGLNDDISGFETKNPSMIDLPLIEAYKKVVAKLGN  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+A  F G +NVVGM
Sbjct  121  NNVMVILDNHVTKPGWCCGYNDGNGFFGDTFFDPTTWIAGLTKIAMTFKGATNVVGM  177



>gb|KFK43579.1| hypothetical protein AALP_AA1G144700 [Arabis alpina]
Length=646

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 146/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+R+KLAC NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRIKLACANWPSHLQPVVAEGLSKQPVDALAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+DL LI A++ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSFGLNDDIVGFQTNNPSIIDLSLIEAFKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCCS+ DGNGFFGD +FDP +W   L+K+A  F+G SNV+GM
Sbjct  151  NDVMVILDNHLTKPGWCCSNNDGNGFFGDRFFDPTVWTAALSKMAATFDGVSNVIGM  207



>ref|XP_009152075.1| PREDICTED: uncharacterized protein LOC103875317 [Brassica rapa]
Length=538

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A  LSTNSRWI++E G R KLACVNW  HL+  VAEGLSKQPVD +++KIV MGFNCVR
Sbjct  26   MAYLLSTNSRWIIDEKGERTKLACVNWPAHLQPAVAEGLSKQPVDAVAQKIVAMGFNCVR  85

Query  288  LTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN +LA S+TVR SF++LGL   I+G +  NPS++DLPLI AYQ+VV +L  
Sbjct  86   LTWPLDLATNVTLATSVTVRDSFQSLGLNTDISGFETKNPSMIDLPLIEAYQSVVTTLGN  145

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            Y VM+ILDNH++KPGWCC + DGNGFFGDI+FDP  W+ GLT +AT F  TSNVVGM
Sbjct  146  YNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSNVVGM  202



>ref|XP_010556350.1| PREDICTED: uncharacterized protein LOC104825676 [Tarenaya hassleriana]
Length=560

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PLST+SRWIV+E+G+RVKLAC NW +HL+ VVAEGLSK+PV+ I++KIV MGFNCVRL
Sbjct  29   AYPLSTSSRWIVDETGQRVKLACANWPSHLQPVVAEGLSKKPVEEIAEKIVGMGFNCVRL  88

Query  291  TWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            TWPL L TN +LA ++TVRQSF++LGL + I G Q +NPSI+DLPLI A++ VV +L   
Sbjct  89   TWPLDLATNFTLAHNVTVRQSFQSLGLNDDIVGFQTHNPSIIDLPLIDAFKTVVEALGNK  148

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             VM++LDNHI+KPGWCCS+ DGNGFFGD +FDP +W+ GLT +A++FNG SNVVGM
Sbjct  149  GVMVVLDNHITKPGWCCSNDDGNGFFGDRFFDPAVWISGLTNMASIFNGVSNVVGM  204



>emb|CDY16066.1| BnaC08g40570D [Brassica napus]
Length=553

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 147/185 (79%), Gaps = 3/185 (2%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            +H  P   +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD ++KKIV
Sbjct  24   AHTVPN--MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIV  81

Query  264  DMGFNCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  440
            +MGFNCVRLTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+D  LI A +
Sbjct  82   EMGFNCVRLTWPLDLMTNETLANNVTVRQSFQSLGLTDDIVGFQTNNPSIIDFSLIEALK  141

Query  441  AVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS  620
             VV  L  + VM ILDNH++K GWCC++ DGNGFFGD +FDP +W   L+K+A  FNG S
Sbjct  142  MVVTKLGNHNVMAILDNHLTKSGWCCANNDGNGFFGDNFFDPTVWTAALSKMAATFNGVS  201

Query  621  NVVGM  635
            NVVGM
Sbjct  202  NVVGM  206



>emb|CDY19395.1| BnaC05g09040D [Brassica napus]
Length=527

 Score =   246 bits (629),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  1    MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  60

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTW L L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+D+ LI A++ VV +L  
Sbjct  61   LTWALDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGN  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP  W   L+K+A  F+G SNVVGM
Sbjct  121  NDVMVILDNHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGM  177



>dbj|BAK05121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 142/183 (78%), Gaps = 2/183 (1%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H AP   V   LST SRW+V+E G RVKLACVNW +HLE ++AEGL K+PV  I+  +  
Sbjct  28   HHAPAAAVT--LSTASRWVVDEDGDRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAA  85

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWP FL TN S +SLTV QSF+ L L ES+AG++ANNP++VDL LI A++AV
Sbjct  86   MGFNCVRLTWPTFLVTNASYSSLTVEQSFQRLNLTESLAGIRANNPAVVDLKLIDAFKAV  145

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL +  VM+ILDNH+SKPGWCC + DGNGFFGD YF+P +WV GLTK+ATMF G  +V
Sbjct  146  VSSLGENNVMVILDNHVSKPGWCCDNADGNGFFGDGYFEPDVWVDGLTKMATMFAGVPHV  205

Query  627  VGM  635
            VGM
Sbjct  206  VGM  208



>ref|XP_010528075.1| PREDICTED: uncharacterized protein LOC104805267 [Tarenaya hassleriana]
Length=575

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST+SRWIV  +GRRVKLAC+ W +HL+  VAEGLSK+P+D I++KI+ MGFNCVR TW
Sbjct  26   PLSTDSRWIVGLTGRRVKLACIVWPSHLDAAVAEGLSKRPMDAIAEKILSMGFNCVRFTW  85

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            PL+L T+DS AS+TVRQS + LGL E+I+G+QANNPSI+DLPLI A+Q +V  L K ++M
Sbjct  86   PLYLATDDSFASMTVRQSLRRLGLFEAISGVQANNPSIIDLPLIRAFQEMVSCLGKNRLM  145

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDN+ S+PGWCCS  DGNGFF D +F+P LW+  L K+A+MF   SNVVGM
Sbjct  146  VILDNYTSQPGWCCSDNDGNGFFWDRHFNPDLWINSLKKMASMFANVSNVVGM  198



>ref|XP_006395581.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
 gb|ESQ32867.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
Length=557

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 145/179 (81%), Gaps = 4/179 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGFNCV
Sbjct  26   AFPLSTDSRWIVDDGIKGRRVKLTCVNWPSHLETAVAEGLSKQPIDSIAEKIVLMGFNCV  85

Query  285  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL+L T++S +  +TVRQS +  GL E+++G QANNPSI+DLPLI A+Q VV  L 
Sbjct  86   RLTWPLYLATDESFSGIMTVRQSLRKFGLFEAVSGFQANNPSILDLPLIKAFQEVVTCLG  145

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGM  635
             +++M++LDNHIS+PGWCCS  DGNGFFGD + +P LW+ GL K+A+MF N +SNVVGM
Sbjct  146  NHRLMVVLDNHISQPGWCCSDNDGNGFFGDRHLNPNLWIKGLMKLASMFANVSSNVVGM  204



>ref|XP_009148543.1| PREDICTED: uncharacterized protein LOC103871957 [Brassica rapa]
Length=574

 Score =   245 bits (626),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD +++KIV+MGFNCVR
Sbjct  48   MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDDVARKIVEMGFNCVR  107

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTW L L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+D+ LI A++ VV +L  
Sbjct  108  LTWALDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGN  167

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP  W   L+K+A  F+G SNVVGM
Sbjct  168  NDVMVILDNHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGM  224



>ref|XP_006290844.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
 gb|EOA23742.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
Length=554

 Score =   244 bits (624),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 146/183 (80%), Gaps = 5/183 (3%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            T  A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGF
Sbjct  18   TTFALPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPMDSIAEKIVSMGF  77

Query  276  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL+L T++S +  +TVRQS    GL E+++G Q +NP+++DLPLI A+Q VV 
Sbjct  78   NCVRLTWPLYLATDESFSDIMTVRQSLLKFGLFEAVSGFQVHNPTVLDLPLIKAFQEVVA  137

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF--NGTSNV  626
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF  N +SNV
Sbjct  138  CLGKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFASNVSSNV  197

Query  627  VGM  635
            VGM
Sbjct  198  VGM  200



>ref|XP_002284888.2| PREDICTED: uncharacterized protein LOC100258876 [Vitis vinifera]
Length=518

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 142/177 (80%), Gaps = 5/177 (3%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVA PL TNSRWIV+E G RVKLACVNW++H E  VAEGLS  PVD+ISK+I  +GFNCV
Sbjct  32   VVALPLHTNSRWIVDEDGARVKLACVNWLSHQEAAVAEGLSNHPVDLISKRIASLGFNCV  91

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLT PLFL  + SLASLTVRQSF+ LGLLES+AG QANNPS++DLPL +AYQAVV +LA 
Sbjct  92   RLTLPLFLAIDQSLASLTVRQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNLAD  151

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              +M+ILD+H S+P     S+ GNG FGD +F+P LWV GLT++ATMF+G  NVVGM
Sbjct  152  NNMMVILDSHFSEP-----SFHGNGVFGDQHFNPDLWVKGLTRIATMFSGVPNVVGM  203



>emb|CDX98009.1| BnaA06g07600D [Brassica napus]
Length=557

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD +++KI++MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDDVARKILEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTW L L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+D+ LI A++ VV +L  
Sbjct  91   LTWALDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP  W   L+K+A  F+G SNVVGM
Sbjct  151  NDVMVILDNHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGM  207



>ref|XP_002876947.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53206.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            T  A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQ +D I++KIV MGF
Sbjct  17   TTFAFPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQSLDSIAEKIVSMGF  76

Query  276  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL+L T++S +  +TVRQS +   LLE+++G Q +NP+I+DLPLI A+Q VV 
Sbjct  77   NCVRLTWPLYLATDESFSDIMTVRQSLRKFRLLEAVSGFQTHNPTILDLPLIKAFQEVVS  136

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVV  629
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF N +SNVV
Sbjct  137  CLGKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVV  196

Query  630  GM  635
            GM
Sbjct  197  GM  198



>ref|XP_010556349.1| PREDICTED: uncharacterized protein LOC104825675 [Tarenaya hassleriana]
Length=555

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PLST+SRWIV+E+ +RVKL+C NW +HL+ VVAEGLSK+PV+ I+ KIV MGFNCVRL
Sbjct  29   AYPLSTSSRWIVDETSQRVKLSCANWPSHLQPVVAEGLSKKPVEEIADKIVGMGFNCVRL  88

Query  291  TWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            TWPL L TN +LA ++TVRQSF++LGL +   G Q +NPSI+DLPLI A++ VV +L   
Sbjct  89   TWPLDLATNFTLAHNVTVRQSFQSLGLYDDFVGFQTHNPSIIDLPLIDAFKTVVETLGNE  148

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             VM++LDNH++KPGWCCS  DGNGFFGD +FDP +W+ GLT +A++FNG SNVVGM
Sbjct  149  GVMVVLDNHVTKPGWCCSDDDGNGFFGDRFFDPTVWISGLTNMASIFNGVSNVVGM  204



>ref|NP_001130915.1| hydrolase, hydrolyzing O-glycosyl compound precursor [Zea mays]
 gb|ACF85192.1| unknown [Zea mays]
 gb|ACG23910.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
 gb|ACN27949.1| unknown [Zea mays]
 gb|ACN28477.1| unknown [Zea mays]
 gb|ACN34624.1| unknown [Zea mays]
 gb|ACN34788.1| unknown [Zea mays]
 tpg|DAA37297.1| TPA: hydrolase, hydrolyzing O-glycosyl compound [Zea mays]
Length=576

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
             A  LST SRW+++ESG RVKLACVNW +HLE V+AEGL K+PV  I+  +  MGFNCVR
Sbjct  32   AAATLSTASRWVLDESGSRVKLACVNWPSHLEPVLAEGLGKRPVGAIAADVAAMGFNCVR  91

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
             TWP FL T+ S + LTV QSF+ L L ES+AG++ NNP +VDL LI A++AVV SL ++
Sbjct  92   FTWPTFLVTDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAVVSSLGEH  151

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             +M+ILDNH+SKPGWCCS+ DG+GFFGD YFDP +WV GLTK+ATMF G  NVVGM
Sbjct  152  NLMVILDNHLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNVVGM  207



>gb|ACF79301.1| unknown [Zea mays]
Length=576

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
             A  LST SRW+++ESG RVKLACVNW +HLE V+AEGL K+PV  I+  +  MGFNCVR
Sbjct  32   AAATLSTASRWVLDESGSRVKLACVNWPSHLEPVLAEGLGKRPVGAIAADVAAMGFNCVR  91

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
             TWP FL T+ S + LTV QSF+ L L ES+AG++ NNP +VDL LI A++AVV SL ++
Sbjct  92   FTWPTFLVTDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAVVSSLGEH  151

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             +M+ILDNH+SKPGWCCS+ DG+GFFGD YFDP +WV GLTK+ATMF G  NVVGM
Sbjct  152  NLMVILDNHLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNVVGM  207



>ref|XP_006648806.1| PREDICTED: uncharacterized protein LOC102721430 [Oryza brachyantha]
Length=340

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVA  LST+SRWIV+E+GRRVKLACVNW +HLE VVAEGL +QPVD ISKK+  +GFNCV
Sbjct  35   VVAVTLSTSSRWIVDEAGRRVKLACVNWPSHLEPVVAEGLGRQPVDAISKKVASLGFNCV  94

Query  285  RLTWPLFLFTNDSLASLTVRQ-SFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLT+P+ L TN SL+SLTVRQ S    GL E++AG+  NNP  +DL LI +++AVV SL 
Sbjct  95   RLTYPIALATNASLSSLTVRQGSLLAHGLAETVAGVGENNPGFLDLTLIESFRAVVDSLG  154

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  VM+ILDNH+S+PGWCC+  DGNGFFGD YFD  +WV GL  +A +F G  NVVGM
Sbjct  155  ENDVMVILDNHVSQPGWCCADDDGNGFFGDRYFDSDVWVQGLANMAALFAGVPNVVGM  212



>ref|NP_189244.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AEE77124.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=551

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            T  A P ST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGF
Sbjct  17   TTFAFPPSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDAIAEKIVSMGF  76

Query  276  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL+L T++S ++ +TVRQS +   L E+++G Q +NP+I+DLPLI A+Q VV 
Sbjct  77   NCVRLTWPLYLATDESFSAFMTVRQSLRKFRLFEAVSGFQTHNPTILDLPLIKAFQEVVY  136

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVV  629
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF N +SNVV
Sbjct  137  CLEKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVV  196

Query  630  GM  635
            GM
Sbjct  197  GM  198



>dbj|BAB02432.1| unnamed protein product [Arabidopsis thaliana]
Length=561

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            T  A P ST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGF
Sbjct  25   TTFAFPPSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDAIAEKIVSMGF  84

Query  276  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL+L T++S ++ +TVRQS +   L E+++G Q +NP+I+DLPLI A+Q VV 
Sbjct  85   NCVRLTWPLYLATDESFSAFMTVRQSLRKFRLFEAVSGFQTHNPTILDLPLIKAFQEVVY  144

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVV  629
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF N +SNVV
Sbjct  145  CLEKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVV  204

Query  630  GM  635
            GM
Sbjct  205  GM  206



>gb|ACU18247.1| unknown [Glycine max]
Length=195

 Score =   231 bits (588),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  198  LEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLES  377
            LE VVAEGLSK+PVDVIS  I  MGFNCVRLTWP+ L TNDSLASLTVR SF+NL LLES
Sbjct  21   LEAVVAEGLSKKPVDVISNGIKSMGFNCVRLTWPIVLVTNDSLASLTVRSSFQNLALLES  80

Query  378  IAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIY  557
            IAG+Q NNPSI+DLPLI A+QAVV SL    VM+ILDNHI++PGWCCS+ DGNGFFGD +
Sbjct  81   IAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKF  140

Query  558  FDPKLWVIGLTKVATMFNGTSNVVGM  635
            FDP  W++GLTK+A++FNG +NVVGM
Sbjct  141  FDPNQWILGLTKMASLFNGVTNVVGM  166



>ref|XP_010535458.1| PREDICTED: uncharacterized protein LOC104810759 [Tarenaya hassleriana]
Length=394

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
             +A PLSTNSRWIVNE G+RVKLACVNW +HL+ VVAEGLS+QPV  I+ +IV M FNCV
Sbjct  26   TMAYPLSTNSRWIVNEGGQRVKLACVNWPSHLQPVVAEGLSQQPVTEIANRIVAMKFNCV  85

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L  ND+LA S+TVRQSF++LGL + I G+Q  NP+ +DLPLI A + VV  L 
Sbjct  86   RLTWPLELAINDTLANSVTVRQSFQSLGLNDDIDGIQRKNPNFIDLPLIEALKTVVNVLG  145

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  VM+ILDNH++ PGWCCS+ DGNGFFGD +FDP  W+ G  K+A +FNG SNV+GM
Sbjct  146  QKGVMVILDNHLTVPGWCCSAGDGNGFFGDRFFDPTAWINGWKKMAGIFNGVSNVIGM  203



>ref|XP_002446675.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
 gb|EES11003.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
Length=586

 Score =   240 bits (613),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            LST SRW+V+ESG RVKLACVNW +HLE ++AEGL K+PV  I+  +  MGFNCVR TWP
Sbjct  38   LSTASRWVVDESGSRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAAMGFNCVRFTWP  97

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
             FL TN S + LTV QSF  L L ES+AG++ NNP  VDL LI A++AVV SL ++ VM+
Sbjct  98   TFLVTNASYSGLTVAQSFLRLNLTESLAGIRVNNPGFVDLKLIDAFKAVVSSLGEHDVMV  157

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ILDNH+SKPGWCCS+ DGNGFFGD  FDP +WV GLTK+ATMF G  NVVGM
Sbjct  158  ILDNHLSKPGWCCSNTDGNGFFGDALFDPDVWVDGLTKMATMFAGVPNVVGM  209



>ref|XP_004975985.1| PREDICTED: uncharacterized protein LOC101760765 [Setaria italica]
Length=566

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            LST SRW+V+E G RVKLACVNW +HLE ++AEGLSK+PV  I+  +  MGFNCVRLTWP
Sbjct  33   LSTASRWVVDEGGSRVKLACVNWPSHLEPMLAEGLSKRPVGAIAAAVAAMGFNCVRLTWP  92

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
             FL T+ S   LTV QSF+ L L ES+AG++ANNP  VDL LI A +AVV SL K+ VM+
Sbjct  93   TFLATDASYGELTVAQSFQRLNLTESLAGIRANNPDFVDLKLIDALKAVVSSLGKHDVMV  152

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ILDNH+SKPGWCCS+ DGNGFFGD YFDP +WV GL K+A MF G  NVVGM
Sbjct  153  ILDNHLSKPGWCCSNTDGNGFFGDTYFDPDVWVAGLKKMAAMFAGVDNVVGM  204



>ref|XP_010514258.1| PREDICTED: uncharacterized protein LOC104790245 [Camelina sativa]
Length=562

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 146/185 (79%), Gaps = 7/185 (4%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNE----SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            T  A PLST+SRWIV++     GRRVK+ CVNW +HLE  VAEGLSKQP+D I++KIV M
Sbjct  20   TTFALPLSTDSRWIVDDDGSNKGRRVKVTCVNWPSHLETAVAEGLSKQPLDSIAEKIVSM  79

Query  270  GFNCVRLTWPLFLFTNDSLASLT-VRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            GFNCVRLTWPL+L T++S + +T VRQS   L L ++++G Q +NP+I+DLPLI A+Q V
Sbjct  80   GFNCVRLTWPLYLATDESFSDITTVRQSLLKLRLFQAVSGFQVHNPTILDLPLIKAFQEV  139

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF--NGTS  620
            V  L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF  N +S
Sbjct  140  VSCLGKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANNVSS  199

Query  621  NVVGM  635
            NVVGM
Sbjct  200  NVVGM  204



>ref|XP_002284895.1| PREDICTED: uncharacterized protein LOC100253729 [Vitis vinifera]
Length=512

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 140/177 (79%), Gaps = 5/177 (3%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVA PL TNSRWIV+E G RVKLACVNW +H E  VAEGLS  PVD+ISK+I  +GFNCV
Sbjct  26   VVALPLYTNSRWIVDEDGARVKLACVNWPSHQEAAVAEGLSNHPVDLISKRIASLGFNCV  85

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLT PLFL T+ SLASLTV QSF+ LGLLES+AG QANNPS++DLPL +AYQAVV +LA 
Sbjct  86   RLTLPLFLATDQSLASLTVIQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNLAD  145

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              +M+ILD+H S+P     S+  NG FGD +F+P LWV GLT++ATMF+G  NVVGM
Sbjct  146  NNMMVILDSHFSEP-----SFHDNGVFGDQHFNPDLWVKGLTRIATMFSGVPNVVGM  197



>gb|KFK33555.1| hypothetical protein AALP_AA5G028800 [Arabis alpina]
Length=552

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 142/177 (80%), Gaps = 4/177 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            PLSTNSRWIV++S  GRRVKL C+NW +HLE  VAEGLSKQP+D I+ KI  MGFNCVRL
Sbjct  24   PLSTNSRWIVDDSNHGRRVKLTCINWPSHLETAVAEGLSKQPLDSIADKIFSMGFNCVRL  83

Query  291  TWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            TWPL+L T++S +  +TVRQS +   L E+++G Q NNPSI+DLPLI A+Q VV  L  +
Sbjct  84   TWPLYLATDESFSGVMTVRQSLRKFRLFEAVSGFQVNNPSILDLPLIKAFQEVVTCLGNH  143

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGM  635
             +M+ILDNHIS+PGWCC++ DGNGFFGD + +P++W+ GL K+A+MF N +SNVVGM
Sbjct  144  GLMVILDNHISQPGWCCNANDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVVGM  200



>ref|XP_010502521.1| PREDICTED: uncharacterized protein LOC104779823 [Camelina sativa]
Length=558

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 144/181 (80%), Gaps = 6/181 (3%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE---SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            A PLST+SRWIV++    GRRVKL CVNW +HLE  VAEGLSKQP+D I++ IV MGFNC
Sbjct  23   ALPLSTDSRWIVDDGINKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIAEMIVSMGFNC  82

Query  282  VRLTWPLFLFTNDSLASLT-VRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            VRLTWPL+L T++S + +T VRQS   L L ++++G Q +NP+I+DLPLI A+Q VV  L
Sbjct  83   VRLTWPLYLATDESFSDITTVRQSLLKLRLFQAVSGFQVHNPTILDLPLIKAFQEVVSCL  142

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF--NGTSNVVG  632
             K+KVM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF  N +SNVVG
Sbjct  143  GKHKVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANNVSSNVVG  202

Query  633  M  635
            M
Sbjct  203  M  203



>ref|XP_002284881.1| PREDICTED: uncharacterized protein LOC100264047 [Vitis vinifera]
Length=509

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 138/177 (78%), Gaps = 5/177 (3%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVA PL T SRWIV+E G RVKLACVNW +H E  VAEGLS  PVD+ISK+I  +GFNCV
Sbjct  23   VVALPLHTTSRWIVDEDGARVKLACVNWPSHREAPVAEGLSNHPVDLISKRIASLGFNCV  82

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RL  PLFL T+ SLASLTVRQSF+ LGLLES+AG QANNPS++DLPL +AYQAVV ++A 
Sbjct  83   RLALPLFLATDQSLASLTVRQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNIAD  142

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              +MIILD+H SKP     S+  N  FGD YF+P LWV GLT++AT+F+G  NVVGM
Sbjct  143  NNMMIILDSHFSKP-----SFHSNDIFGDQYFNPDLWVKGLTRMATVFSGVPNVVGM  194



>gb|AIZ06017.1| hypothetical protein [Zea nicaraguensis]
Length=555

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PLST SRWIV   GRRVKLAC NW +HLE   AEGL+++PV  I+ ++  MGFNCVRL
Sbjct  26   ALPLSTASRWIVGVDGRRVKLACANWASHLEPAAAEGLARRPVSDIAARVAAMGFNCVRL  85

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWP +L TN +LASL +R S + LG+LES+AG++ NNP+++DLPLI  ++ VV SLA+  
Sbjct  86   TWPTYLVTNATLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLIDVFREVVSSLARKG  145

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +M+ILDN ++ PGWCCS  DGNGFFGD+YFDP  W+ GL+ +ATMFN T  VVGM
Sbjct  146  IMVILDNQMTTPGWCCSRTDGNGFFGDVYFDPNEWLKGLSAMATMFNNTKYVVGM  200



>ref|XP_010492589.1| PREDICTED: uncharacterized protein LOC104769956 isoform X2 [Camelina 
sativa]
Length=487

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F G +NVVGM
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKGATNVVGM  198



>ref|XP_010240029.1| PREDICTED: uncharacterized protein LOC100839976 [Brachypodium 
distachyon]
Length=562

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            LST SRWIV+E+G RVKLACVNW +HLE ++AEGLSK+PV  I+  +  MGFNCVRLTWP
Sbjct  32   LSTASRWIVDEAGDRVKLACVNWPSHLEPMLAEGLSKRPVGSIAGDVAAMGFNCVRLTWP  91

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
             F+ TN S  SLTV QSF+ L L E +AG++ANNP++VDL LI A++AVV SL +  +M+
Sbjct  92   TFMVTNASYTSLTVAQSFQRLNLTEPLAGIRANNPALVDLRLIDAFKAVVSSLGENNLMV  151

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ILDNH+S P WCCS+ DGNGFFGD YF P +WV GLTK+AT F    NVVGM
Sbjct  152  ILDNHVSMPKWCCSNTDGNGFFGDAYFQPDVWVDGLTKMATTFAAVPNVVGM  203



>ref|XP_006400290.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
 gb|ESQ41743.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
Length=528

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRWIVNESG RVKLAC NW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNESGHRVKLACANWPSHLQPVVAEGLSSQPMDSISKKIREMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV++PLI A+QAVV SL +  V
Sbjct  88   PLELMINDTLAYNVTVKQSFERYGLDHELQGIHNHNPSIVNIPLINAFQAVVHSLGRNDV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH + PGWCCS+ D + FFGD  FDP LW++GL K+AT+F   +NVVGM
Sbjct  148  MVILDNHKTVPGWCCSNGDPDAFFGDPKFDPDLWMLGLKKMATIFMNVNNVVGM  201



>ref|XP_010492588.1| PREDICTED: uncharacterized protein LOC104769956 isoform X1 [Camelina 
sativa]
Length=523

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F G +NVVGM
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKGATNVVGM  198



>gb|EEE61202.1| hypothetical protein OsJ_15212 [Oryza sativa Japonica Group]
Length=571

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +V MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMVT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N S +SLTV QSF+ L L ES+A ++ NNPS+VDL LI A++AVV SL +  VM+ILDNH
Sbjct  96   NASYSSLTVAQSFQRLNLTESLAAIRVNNPSLVDLKLIDAFKAVVSSLGENGVMVILDNH  155

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV M
Sbjct  156  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAM  202



>ref|NP_001047320.1| Os02g0596200 [Oryza sativa Japonica Group]
 dbj|BAD16839.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAD21617.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF09234.1| Os02g0596200 [Oryza sativa Japonica Group]
Length=449

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            L    V A  LST+SRWIV++   GRRVKLACVNW +HLE VV EGL  QPVD ISKK+ 
Sbjct  17   LHAAAVEAVTLSTSSRWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVA  76

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             +GFNCVRLT+P+ L TN SL+SLTVR+S    GL  ++AG++ANNP ++DL LI +++A
Sbjct  77   SLGFNCVRLTYPIALATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRA  136

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL +  VM+ILDNH+S+PGWCC+  DGNGFFGD +FDP  WV GL  +A +F G  N
Sbjct  137  VVDSLGESGVMVILDNHVSRPGWCCADDDGNGFFGDRHFDPDAWVRGLGAMAALFAGVPN  196

Query  624  VVGM  635
            VVGM
Sbjct  197  VVGM  200



>ref|XP_010453833.1| PREDICTED: uncharacterized protein LOC104735704 [Camelina sativa]
Length=486

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  20   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  79

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  80   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVRGIQTHNPKILNLPLLNAFQEVVSNLG  139

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVGM
Sbjct  140  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGM  197



>ref|XP_010248705.1| PREDICTED: uncharacterized protein LOC104591538 isoform X1 [Nelumbo 
nucifera]
Length=540

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 143/177 (81%), Gaps = 5/177 (3%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PL TNSRWIV+  G RVKLACVNW  HLE +V +GLS++ +D+ISK+I+ +GFNCV
Sbjct  27   VMALPLYTNSRWIVDGDGHRVKLACVNWGAHLEAMVPDGLSRRSLDMISKEIISLGFNCV  86

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            +LTWP F+  ++SLAS+TVRQSFKNLGLLESI G+Q NNPS++DLPL++AYQAVV +LA+
Sbjct  87   QLTWPQFMVNDESLASVTVRQSFKNLGLLESIVGIQVNNPSLLDLPLVSAYQAVVDNLAE  146

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              +M+ILDN ISKPGW  S+++     GD YFD  LW+ GLT+ AT+FN T NVVGM
Sbjct  147  KNLMVILDNRISKPGWHHSNFN-----GDKYFDTDLWIRGLTRTATIFNHTINVVGM  198



>ref|XP_010248706.1| PREDICTED: uncharacterized protein LOC104591538 isoform X2 [Nelumbo 
nucifera]
Length=538

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 143/177 (81%), Gaps = 5/177 (3%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PL TNSRWIV+  G RVKLACVNW  HLE +V +GLS++ +D+ISK+I+ +GFNCV
Sbjct  27   VMALPLYTNSRWIVDGDGHRVKLACVNWGAHLEAMVPDGLSRRSLDMISKEIISLGFNCV  86

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            +LTWP F+  ++SLAS+TVRQSFKNLGLLESI G+Q NNPS++DLPL++AYQAVV +LA+
Sbjct  87   QLTWPQFMVNDESLASVTVRQSFKNLGLLESIVGIQVNNPSLLDLPLVSAYQAVVDNLAE  146

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              +M+ILDN ISKPGW  S+++     GD YFD  LW+ GLT+ AT+FN T NVVGM
Sbjct  147  KNLMVILDNRISKPGWHHSNFN-----GDKYFDTDLWIRGLTRTATIFNHTINVVGM  198



>ref|XP_010437048.1| PREDICTED: uncharacterized protein LOC104720845 isoform X2 [Camelina 
sativa]
 ref|XP_010437061.1| PREDICTED: uncharacterized protein LOC104720858 isoform X2 [Camelina 
sativa]
Length=487

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   ITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVG+
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGV  198



>ref|XP_010437042.1| PREDICTED: uncharacterized protein LOC104720845 isoform X1 [Camelina 
sativa]
 ref|XP_010437060.1| PREDICTED: uncharacterized protein LOC104720858 isoform X1 [Camelina 
sativa]
Length=523

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   ITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVG+
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGV  198



>gb|EEC77495.1| hypothetical protein OsI_16343 [Oryza sativa Indica Group]
Length=571

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +V MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMVT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N S +SLTV QSF+ L L ES+A ++ NNPS+VDL LI A++AVV +L +  VM+ILD+H
Sbjct  96   NASYSSLTVAQSFQRLNLTESLAAIRVNNPSLVDLKLIDAFKAVVSTLGENGVMVILDDH  155

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV M
Sbjct  156  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAM  202



>ref|XP_009126336.1| PREDICTED: uncharacterized protein LOC103851244 [Brassica rapa]
Length=246

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLALKITVKQSFESLKLFDDALGIQTHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GM
Sbjct  145  MVILDNHLTYPGWCCSYNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGM  198



>gb|EMT10461.1| Endoglucanase E1 [Aegilops tauschii]
Length=498

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 135/183 (74%), Gaps = 12/183 (7%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H AP   V   LST SRW+V+E+G RVKLACVNW +HLE ++AEGL K+PV  I+  +  
Sbjct  28   HHAPAAAVT--LSTASRWVVDEAGDRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAA  85

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWP FL TN S +SLTV QSF+ L L ES+AG++ANNP++          AV
Sbjct  86   MGFNCVRLTWPTFLVTNASYSSLTVEQSFQRLNLTESLAGIRANNPAV----------AV  135

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL +  VM+ILDNH+SKPGWCC + DGNGFFGD YF+P +WV GLTK+ATMF G  +V
Sbjct  136  VSSLGENNVMVILDNHVSKPGWCCDNTDGNGFFGDGYFEPDVWVDGLTKMATMFAGVPHV  195

Query  627  VGM  635
            VGM
Sbjct  196  VGM  198



>ref|XP_002446674.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
 gb|EES11002.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
Length=556

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PLST SRWIV   GRRVKLAC  W +HLE   AEGL+++ V  I+ ++  MGFNCVRL
Sbjct  27   ALPLSTASRWIVGADGRRVKLACATWASHLEPAAAEGLARRGVSDIAARVAAMGFNCVRL  86

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWP +L TN +LASL +R S + LG+LES+AG++ NNP+++DLPL+  ++ VV SLA   
Sbjct  87   TWPTYLATNVTLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLVDVFREVVSSLASKG  146

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +M+ILDN ++ PGWCCS  DGNGFFGD+YFDP  W+ GL+ +ATMFN T NVVGM
Sbjct  147  IMVILDNQMTTPGWCCSRIDGNGFFGDVYFDPDEWLKGLSAMATMFNNTKNVVGM  201



>gb|EAZ23667.1| hypothetical protein OsJ_07369 [Oryza sativa Japonica Group]
Length=583

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
             V A  LST+SRWIV++   GRRVKLACVNW +HLE VV EGL  QPVD ISKK+  +GF
Sbjct  21   AVEAVTLSTSSRWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVASLGF  80

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVRLT+P+ L TN SL+SLTVR+S    GL  ++AG++ANNP ++DL LI +++AVV S
Sbjct  81   NCVRLTYPIALATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRAVVDS  140

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L +  VM+ILDNH+S+PGWCC+  DGNGFFGD +FDP  WV GL  +A +F G  NVVGM
Sbjct  141  LGESGVMVILDNHVSRPGWCCADDDGNGFFGDRHFDPDAWVRGLGAMAALFAGVPNVVGM  200



>ref|XP_002871770.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48029.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=527

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T SRWIVN+ G RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  28   PLFTKSRWIVNKKGHRVKLACANWPSHLKPVVAEGLSSQPMDSISKKIKDMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV++PLI A+QAVV SL ++ V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNIPLINAFQAVVYSLGRHDV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NVVGM
Sbjct  148  MVILDNHKTVPGWCCSNNDPDAFFGDPKFNPDLWMLGLKKMATIFMNVNNVVGM  201



>ref|NP_001132121.1| hypothetical protein precursor [Zea mays]
 gb|ACF80825.1| unknown [Zea mays]
 gb|AFW58604.1| hypothetical protein ZEAMMB73_652830 [Zea mays]
Length=555

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 0/170 (0%)
 Frame = +3

Query  126  TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            T SRWIV   GRRVKLAC NW +HLE   AEGL+++PV  I+ ++  MGFNCVRLTWP +
Sbjct  31   TASRWIVGVDGRRVKLACANWASHLEPAAAEGLARRPVSDIAARVAAMGFNCVRLTWPTY  90

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            L TN +LASL +R S + LG+LES+AG++ NNP+++DLPLI  ++ VV SLA+  +M+IL
Sbjct  91   LVTNATLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLIDVFREVVSSLARKGIMVIL  150

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            DN ++ PGWCCS  DGNGFFGD+YFDP  W+ GL+ +ATMFN T  VVGM
Sbjct  151  DNQMTTPGWCCSRTDGNGFFGDVYFDPNEWLKGLSAMATMFNNTKYVVGM  200



>ref|XP_010492706.1| PREDICTED: uncharacterized protein LOC104770057 [Camelina sativa]
Length=528

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T SRWIVN+ G RVKLAC NW +HLE VVAEGLS QP+D I+KKI DMGFNCVRLTW
Sbjct  28   PLYTKSRWIVNKKGHRVKLACTNWPSHLEPVVAEGLSSQPMDCITKKIKDMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSI+++PLI  +QAVV SL ++ V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIINIPLINVFQAVVHSLGRHDV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NVVGM
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFLNVNNVVGM  201



>gb|AFW62836.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=396

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 134/184 (73%), Gaps = 1/184 (1%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G++ NNPS +DL LI + +A
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGVEVNNPSFLDLTLIESLKA  138

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  139  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  198

Query  624  VVGM  635
            VVGM
Sbjct  199  VVGM  202



>ref|XP_006289374.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
 gb|EOA22272.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
Length=527

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRWIVN  G+RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  28   PLSTKSRWIVNNKGQRVKLACTNWPSHLKPVVAEGLSSQPIDYISKKIKDMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+ A+NPSIV++PLI  +QAVV SL ++ +
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYAHNPSIVNIPLINVFQAVVYSLGRHDL  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH + PGWCCS+ D + FF D  F+P LW++GL K+AT+F   +NVVGM
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFNDPKFNPDLWMLGLKKMATIFLNVNNVVGM  201



>ref|XP_010420476.1| PREDICTED: uncharacterized protein LOC104706046 [Camelina sativa]
Length=527

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T SRWIVN+ G RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  28   PLYTKSRWIVNKKGHRVKLACTNWPSHLKPVVAEGLSSQPMDFISKKIKDMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSI+++PLI  +QAVV SL ++ V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIINIPLINVFQAVVHSLGRHDV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NVVGM
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFLNVNNVVGM  201



>emb|CDX94333.1| BnaC01g18510D [Brassica napus]
Length=335

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GM
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGM  198



>ref|XP_009121460.1| PREDICTED: uncharacterized protein LOC103846306 [Brassica rapa]
Length=524

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 138/181 (76%), Gaps = 1/181 (1%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P  + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGL+KQP+D ISKKIV MGF
Sbjct  19   PKLITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLNKQPLDSISKKIVSMGF  78

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA ++TV+QSF+ L LL+ + G+Q +NP I++LP+  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLARNVTVKQSFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVS  138

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPVIWTKGLSKMASLFRNVTNVVG  198

Query  633  M  635
            M
Sbjct  199  M  199



>ref|XP_009107523.1| PREDICTED: uncharacterized protein LOC103833179 [Brassica rapa]
Length=527

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRWIVN+SG RVKLACVNW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNKSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV+ PLI  +QAVV SL +  V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLINVFQAVVYSLGRNDV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NV+GM
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGM  201



>emb|CDX69429.1| BnaA10g17780D [Brassica napus]
Length=524

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 138/181 (76%), Gaps = 1/181 (1%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P  + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGL+KQP+D ISKKIV MGF
Sbjct  19   PKLITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLNKQPLDSISKKIVSMGF  78

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA ++TV+QSF+ L LL+ + G+Q +NP I++LP+  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLARNVTVKQSFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVS  138

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPVIWTKGLSKMASLFRNVTNVVG  198

Query  633  M  635
            M
Sbjct  199  M  199



>ref|XP_009121461.1| PREDICTED: uncharacterized protein LOC103846308 [Brassica rapa]
Length=489

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 136/181 (75%), Gaps = 1/181 (1%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    + PLST SRWIV+E G+RVKLACVNW  HL+  VAEG+SKQP+D ISKKIV MGF
Sbjct  19   PKLTTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGVSKQPLDSISKKIVSMGF  78

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA ++TV+QSF+ L L + + G+Q +NP I++LP+  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLARNVTVKQSFERLNLFDDVLGIQTHNPKILNLPIFNAFQEVVS  138

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPAVWAKGLSKMASLFRNVTNVVG  198

Query  633  M  635
            M
Sbjct  199  M  199



>gb|KFK25904.1| hypothetical protein AALP_AA8G177600 [Arabis alpina]
Length=523

 Score =   225 bits (574),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 135/178 (76%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWI++E G+RVKLACVNW  HL   VAEGLSKQP+D ISKKIV M FNCV
Sbjct  21   TTSYPLSTKSRWILDEKGQRVKLACVNWPAHLLPAVAEGLSKQPLDSISKKIVSMRFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA ++TV+QSF++L L E +AG+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALNVTVKQSFESLKLFEDVAGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  +M+ILDNH++ PGWCCS  D + FFG   FDP  W  GL K+AT+F   +NVVGM
Sbjct  141  QNGLMVILDNHLTTPGWCCSDNDLDAFFGYPNFDPAEWATGLKKMATLFRNATNVVGM  198



>ref|XP_003579979.1| PREDICTED: uncharacterized protein LOC100845861 [Brachypodium 
distachyon]
Length=558

 Score =   226 bits (576),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            ++ A PLST SRW+V   GRRVKLAC +W +HLE V AEGLS++ V  I+ ++  MGFNC
Sbjct  27   SLPALPLSTASRWVVGADGRRVKLACASWASHLEPVAAEGLSRRDVGGIAARVAAMGFNC  86

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            VRLTWP +L TN +L+SL +R S + LGL ES+AG++ NNP ++DLPLI  ++ VV +LA
Sbjct  87   VRLTWPTYLATNTTLSSLPLRWSLERLGLRESVAGVRVNNPDLLDLPLIDVFREVVSALA  146

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
               +M+ILDN ++ PGWCCS  DGNGFFGD YFDP+ W+ GL+ +ATMF  T NVVGM
Sbjct  147  SSNIMVILDNQMTTPGWCCSRSDGNGFFGDKYFDPEEWLKGLSAMATMFRYTKNVVGM  204



>gb|EAY86525.1| hypothetical protein OsI_07905 [Oryza sativa Indica Group]
Length=582

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 137/184 (74%), Gaps = 2/184 (1%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            L    V A  LST+SRWIV++   GRRVKLACVNW +HLE VV EGL  QPVD ISKK+ 
Sbjct  17   LHAAAVEAVTLSTSSRWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVA  76

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             +GFNCVRLT+P+ L TN SL+SLTVR+S    GL  ++AG++ANNP ++DL LI +++A
Sbjct  77   SLGFNCVRLTYPIALATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRA  136

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL +  VM+ILDNH+S+PGWCC+  DGNGFFGD +F P  WV GL  +A +F G  N
Sbjct  137  VVDSLGESGVMVILDNHVSRPGWCCADDDGNGFFGDRHFVPDAWVRGLGAMAALFAGVPN  196

Query  624  VVGM  635
            VVGM
Sbjct  197  VVGM  200



>ref|XP_006400209.1| hypothetical protein EUTSA_v10015466mg [Eutrema salsugineum]
 gb|ESQ41662.1| hypothetical protein EUTSA_v10015466mg [Eutrema salsugineum]
Length=488

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 135/181 (75%), Gaps = 1/181 (1%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGF
Sbjct  19   PKLTTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGF  78

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA ++TV+QSF+ L L E + G+Q +NP I++L +  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLAHNVTVKQSFEGLKLFEDVLGIQTHNPKILNLSIFRAFQEVVS  138

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  VM+ILDNH++ PGWCCS  D + FFG   FDP +W  GL+K+A +F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFGYPNFDPLVWAKGLSKMAFLFRNATNVVG  198

Query  633  M  635
            M
Sbjct  199  M  199



>ref|XP_010420372.1| PREDICTED: uncharacterized protein LOC104705962 [Camelina sativa]
Length=484

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 135/178 (76%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQ +D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQTLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TN++LA  +TV+QSF++  L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNNTLALKVTVKQSFESFKLFEDVRGIQTHNPKIINLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVG+
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGV  198



>ref|NP_197172.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 emb|CAC01834.1| putative protein [Arabidopsis thaliana]
 gb|AED92327.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=488

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 134/178 (75%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP ++ LPL  A+Q VV +L 
Sbjct  81   RLTWPLDLVTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKLLHLPLFNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +  VM+ILDNH++ PGWCC   D + FFG  +FDP +W  GL K+AT+F   ++V+GM
Sbjct  141  ENGVMVILDNHLTTPGWCCGDNDLDAFFGYPHFDPLVWAKGLRKMATLFRNFTHVIGM  198



>ref|NP_001053105.1| Os04g0480900 [Oryza sativa Japonica Group]
 emb|CAD41088.2| OSJNBb0011N17.5 [Oryza sativa Japonica Group]
 dbj|BAF15019.1| Os04g0480900 [Oryza sativa Japonica Group]
 dbj|BAG98948.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61201.1| hypothetical protein OsJ_15210 [Oryza sativa Japonica Group]
Length=554

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 130/173 (75%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRW+V   GRRVKLAC NW +HLE V AEGLS++ +  I+ ++  MG NCVRLTW
Sbjct  29   PLSTASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTW  88

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P +L TN +LA+L +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LAK  +M
Sbjct  89   PTYLATNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIM  148

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDN ++ PGWCCS  DGNGFFGD YF P+ W+ GL+ +ATMF  T NVVGM
Sbjct  149  VILDNQMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGM  201



>emb|CAH67676.1| H0510A06.1 [Oryza sativa Indica Group]
 emb|CAH66881.1| OSIGBa0158F13.12 [Oryza sativa Indica Group]
Length=553

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 129/170 (76%), Gaps = 0/170 (0%)
 Frame = +3

Query  126  TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            T SRW+V   GRRVKLAC NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLTWP +
Sbjct  34   TASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTY  93

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            L TN +LASL +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LA+  +M+IL
Sbjct  94   LATNATLASLPLRWSLERLGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVIL  153

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            DN ++ PGWCCS+ DGNGFFGD YFDP+ W+ GL  +ATMF  T NVVGM
Sbjct  154  DNQMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGM  203



>ref|XP_002871731.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47990.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            LST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTWP
Sbjct  26   LSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCVRLTWP  85

Query  300  LFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            L L TND+LA ++TV+QSF++L L E + G+Q +NP I+ LPL  A+Q VV +L +  VM
Sbjct  86   LDLMTNDTLALNVTVKQSFESLKLFEDVLGIQTHNPKILHLPLFNAFQEVVSNLGQNGVM  145

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDNH++ PGWCC   D + FFG   FDP +W  GL K+AT+F   +NV+GM
Sbjct  146  VILDNHLTTPGWCCGENDLDAFFGYPKFDPTVWAKGLGKMATLFRNFTNVIGM  198



>ref|XP_008678767.1| PREDICTED: uncharacterized protein LOC100501654 isoform X1 [Zea 
mays]
Length=564

 Score =   224 bits (570),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 134/184 (73%), Gaps = 1/184 (1%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G++ NNPS +DL LI + +A
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGVEVNNPSFLDLTLIESLKA  138

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  139  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  198

Query  624  VVGM  635
            VVGM
Sbjct  199  VVGM  202



>gb|EEC77494.1| hypothetical protein OsI_16340 [Oryza sativa Indica Group]
Length=554

 Score =   223 bits (569),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 130/173 (75%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRW+V   GRRVKLAC NW +HLE V AEGLS++ +  I+ ++  MG NCVRLTW
Sbjct  29   PLSTASRWLVGADGRRVKLACANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTW  88

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P +L TN +LA+L +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LAK  +M
Sbjct  89   PTYLATNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIM  148

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDN ++ PGWCCS  DGNGFFGD YF P+ W+ GL+ +ATMF  T NVVGM
Sbjct  149  VILDNQMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGM  201



>dbj|BAK00694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=561

 Score =   223 bits (569),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 128/173 (74%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRW+V   GRRVKL C NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLTW
Sbjct  33   PLSTASRWVVGADGRRVKLVCANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTW  92

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P +L TN +L+SL +R S + LGL ES AG++ NNP ++DLPLI  ++ VV +LA   +M
Sbjct  93   PTYLATNSTLSSLPLRWSLERLGLRESAAGVRVNNPDLLDLPLIDVFREVVSALASNSIM  152

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDN ++ PGWCCS  DGNGFFGD YFDP+ W+ GL+ +ATMF    NVVGM
Sbjct  153  VILDNQMTTPGWCCSRTDGNGFFGDKYFDPEEWLKGLSAMATMFRHAKNVVGM  205



>ref|XP_009126137.1| PREDICTED: uncharacterized protein LOC103851062 [Brassica rapa]
Length=487

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 132/174 (76%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN+RWIV+E G+R KLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTNTRWIVDEKGQRAKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I +LP+  A+Q VV +L +  +
Sbjct  85   PLDLTTNDTLALKITVKQSFESLNLFDDALGIQTHNPKIFNLPIFNAFQEVVSNLGQNGL  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GM
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGM  198



>ref|NP_197252.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
 emb|CAC01894.1| putative protein [Arabidopsis thaliana]
 gb|AED92434.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 131/174 (75%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T SRWIVN  G RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  27   PLFTKSRWIVNNKGHRVKLACANWPSHLKPVVAEGLSSQPMDSISKKIKDMGFNCVRLTW  86

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NP IV+ PLI  +QAVV SL ++ V
Sbjct  87   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPYIVNTPLINVFQAVVYSLGRHDV  146

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F    NVVGM
Sbjct  147  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMNVKNVVGM  200



>ref|XP_009142284.1| PREDICTED: uncharacterized protein LOC103866155 [Brassica rapa]
Length=487

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GM
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGM  198



>ref|XP_009142293.1| PREDICTED: uncharacterized protein LOC103866164 [Brassica rapa]
Length=487

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GM
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGM  198



>emb|CDY38091.1| BnaC02g06820D [Brassica napus]
Length=523

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 135/181 (75%), Gaps = 1/181 (1%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    + PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISK IV MGF
Sbjct  18   PTPSTSFPLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKNIVSMGF  77

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA  +TV+QSF++L L + + G+Q +NP I++LP+  A+Q VV 
Sbjct  78   NCVRLTWPLDLMTNDTLALKITVKQSFESLNLFDDVLGIQTHNPKILNLPIFNAFQEVVS  137

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  +M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+G
Sbjct  138  NLGQNGLMVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIG  197

Query  633  M  635
            M
Sbjct  198  M  198



>emb|CAD41089.2| OSJNBb0011N17.6 [Oryza sativa Japonica Group]
 gb|EAZ31113.1| hypothetical protein OsJ_15211 [Oryza sativa Japonica Group]
Length=550

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 128/170 (75%), Gaps = 0/170 (0%)
 Frame = +3

Query  126  TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            T SRW+V   GRRVKLAC NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLTWP +
Sbjct  31   TASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTY  90

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            L TN +LASL +R S +  G+ ES+AG++ NNP ++DLPLI  +Q VV +LA+  +M+IL
Sbjct  91   LATNATLASLPLRWSLERFGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVIL  150

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            DN ++ PGWCCS+ DGNGFFGD YFDP+ W+ GL  +ATMF  T NVVGM
Sbjct  151  DNQMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGM  200



>emb|CAH66880.1| OSIGBa0158F13.11 [Oryza sativa Indica Group]
Length=554

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 129/173 (75%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRW+V   GRRVKL C NW +HLE V AEGLS++ +  I+ ++  MG NCVRLTW
Sbjct  29   PLSTASRWVVGADGRRVKLTCANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTW  88

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P +L TN +LA+L +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LAK  +M
Sbjct  89   PTYLATNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIM  148

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDN ++ PGWCCS  DGNGFFGD YF P+ W+ GL+ +ATMF  T NVVGM
Sbjct  149  VILDNQMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGM  201



>ref|XP_010549752.1| PREDICTED: uncharacterized protein LOC104820833 [Tarenaya hassleriana]
Length=531

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            +V +  LST SRWIV+E G RVKLAC NW +HL+ VVAEGL KQP+D IS++I  MGFNC
Sbjct  25   SVFSDGLSTRSRWIVDERGHRVKLACANWPSHLQPVVAEGLHKQPMDSISERIRFMGFNC  84

Query  282  VRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            VR TWPL L TND+LA  +TV QSF+   L + + G++ +NPSI+ LPL  A++AVV S+
Sbjct  85   VRFTWPLELMTNDTLAFHVTVTQSFQRYRLFQELDGIRRHNPSILHLPLFNAFEAVVSSM  144

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             +Y VM+ILDNH + PGWCC ++D + FFGD  FDP LW++GL K+A  F    NV+GM
Sbjct  145  GRYGVMVILDNHKTVPGWCCGNHDPDAFFGDPEFDPNLWILGLKKMAASFRNVKNVIGM  203



>emb|CDX89335.1| BnaA01g15580D [Brassica napus]
Length=523

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GM
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGM  198



>gb|KHG22500.1| Endoglucanase E1 [Gossypium arboreum]
Length=524

 Score =   220 bits (561),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            H+ P T +  PLSTNSRWIV+ ++ RRVKLACVNW +HLE V AEGLSK+ +D I+++IV
Sbjct  16   HVNPTTSL--PLSTNSRWIVDDQTHRRVKLACVNWPSHLEPVFAEGLSKRSMDSIAEQIV  73

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLTWPL+L TNDSL+SLTVR+SF+NLGL+E IAG+QANNPS++D+ LI A+QA
Sbjct  74   SMGFNCVRLTWPLYLATNDSLSSLTVRRSFQNLGLMEPIAGIQANNPSVIDVSLIQAFQA  133

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVI  581
            VV SL K  VM+ILDNH+SKPGWCC  YDG+G       +P L +I
Sbjct  134  VVSSLGKNNVMVILDNHLSKPGWCCGYYDGDGAEAVHAANPNLLII  179



>ref|XP_002452393.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
 gb|EES05369.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
Length=570

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 133/183 (73%), Gaps = 2/183 (1%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H  P   V   LST+SRWIV+ +G RVKLACVNW +HL+ VV EGL +QPV  I+  IV 
Sbjct  23   HGEPAAAVT--LSTSSRWIVDPAGHRVKLACVNWPSHLDPVVTEGLGRQPVGAITGMIVS  80

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLT+P+ L TN SL++LTVRQS    GL E++ G++ NNPS +DL LI + +AV
Sbjct  81   MGFNCVRLTYPIALATNASLSALTVRQSLLAHGLSETVGGVEVNNPSFLDLTLIDSLKAV  140

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V +L +  VM+ILDNHIS PGWCCS+ DGNGFFGD  FDP +WV GL  +AT F    NV
Sbjct  141  VNALGEKNVMVILDNHISTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATTFADVPNV  200

Query  627  VGM  635
            VGM
Sbjct  201  VGM  203



>ref|XP_004975980.1| PREDICTED: uncharacterized protein LOC101758857 [Setaria italica]
Length=557

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 126/170 (74%), Gaps = 0/170 (0%)
 Frame = +3

Query  126  TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            T SRW+V   GRRVKLAC NW +HLE   AEGLS++ V+ I+ ++  MGFNCVRLTWP +
Sbjct  33   TASRWLVGADGRRVKLACANWASHLEPAAAEGLSRRGVEGIAGRVAAMGFNCVRLTWPTY  92

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            L TN +LASL  R S + LG+ ES+AG++ NNP+++DLPLI  ++ VV +L    +M+IL
Sbjct  93   LATNATLASLPFRWSLERLGMRESVAGVRVNNPALLDLPLIDVFREVVSALGSKSIMVIL  152

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            DN ++ PGWCCS  DGNGFFGD YFDP  W+ GL  +AT+FN T NVVGM
Sbjct  153  DNQMTTPGWCCSRTDGNGFFGDKYFDPDEWLKGLNAMATIFNDTKNVVGM  202



>ref|XP_006652422.1| PREDICTED: uncharacterized protein LOC102702088, partial [Oryza 
brachyantha]
Length=529

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 129/174 (74%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST SRW+V  + GRRVKLAC NW +HLE   AEGLS++ V  I+ ++  MGFNCVRLT
Sbjct  2    PLSTASRWVVGGADGRRVKLACANWASHLEPAAAEGLSRRGVGDIAARVAAMGFNCVRLT  61

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            WP +L TN +LA+L +R S + LG+ ES AG++ NNP ++DLPLI  ++ VV +L +  +
Sbjct  62   WPTYLATNATLANLPLRWSLELLGMRESAAGVRVNNPQLLDLPLIDVFKEVVSALGRNNI  121

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDN ++ PGWCCS  DGNGFFGD YFDP  W+ GL+ +ATMF  T NVVGM
Sbjct  122  MVILDNQMTTPGWCCSQRDGNGFFGDTYFDPDEWLSGLSTMATMFRNTKNVVGM  175



>emb|CDY38435.1| BnaA10g17230D [Brassica napus]
Length=524

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRWIVN+SG RVKLACVNW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNKSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV+ PLI    AVV SL +  V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLI---NAVVYSLGRNDV  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NV+GM
Sbjct  145  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGM  198



>emb|CDY16914.1| BnaC09g40410D [Brassica napus]
Length=524

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRWIVN+SG RVKLACVNW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNKSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV+ PLI    AVV SL +  V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLI---NAVVYSLGRNDV  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NV+GM
Sbjct  145  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGM  198



>gb|EAY94563.1| hypothetical protein OsI_16341 [Oryza sativa Indica Group]
Length=552

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 127/170 (75%), Gaps = 0/170 (0%)
 Frame = +3

Query  126  TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            T SRW+V   GRRVKLAC NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLT P +
Sbjct  31   TASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTCPTY  90

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            L TN +LASL +R S +  G+ ES+AG++ NNP ++DLPLI  +Q VV +LA+  +M+IL
Sbjct  91   LATNATLASLPLRWSLERFGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVIL  150

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            DN ++ PGWCCS+ DGNGFFGD YFDP+ W+ GL  +ATMF  T NVVGM
Sbjct  151  DNQMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGM  200



>ref|XP_004955049.1| PREDICTED: uncharacterized protein LOC101776534 [Setaria italica]
Length=556

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 130/177 (73%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              A  LST+SRWIV+++G RVKLACVNW +HLE VV EGL +QPV  I+  +V +GFNCV
Sbjct  25   AAALTLSTSSRWIVDQAGHRVKLACVNWPSHLEPVVTEGLGRQPVGAIAGMVVSLGFNCV  84

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLT+P+ L TN SL+SLTVRQS    GL E+  G++ NNP  +DL L+ + +AVV +L +
Sbjct  85   RLTYPIALATNASLSSLTVRQSLLAHGLAETAGGVEVNNPGFLDLTLMESLKAVVNTLGE  144

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
              VM+ILDNH+SKPGWCC   DGNGFFGD  FDP +WV GL  +AT+F    +V+GM
Sbjct  145  KDVMVILDNHVSKPGWCCGDDDGNGFFGDRDFDPDVWVDGLASMATIFADVPSVIGM  201



>ref|XP_004975262.1| PREDICTED: uncharacterized protein LOC101779133 [Setaria italica]
Length=595

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 128/185 (69%), Gaps = 2/185 (1%)
 Frame = +3

Query  87   HLAPPTVVAQP--LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKI  260
            H A     A P  LST+SRW+V+E GRRVKLACVNW +HLE ++AEGL   P+  I+  +
Sbjct  39   HEAAGGAAALPKSLSTSSRWVVDERGRRVKLACVNWASHLEPMLAEGLGHLPLGAIAAGV  98

Query  261  VDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  440
              MGFNCVRLTWP FL T+ + +SLTV  S + L L  ++AG+ ANNP  + L L  A+ 
Sbjct  99   AAMGFNCVRLTWPTFLVTDAASSSLTVADSLRRLNLTAALAGVGANNPGFLGLSLADAFG  158

Query  441  AVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS  620
            AVV  L    VM+ILDNH+S+PGWCC + DGNGFFGD  FDP +WV GL ++A MF G  
Sbjct  159  AVVRGLGDSGVMVILDNHVSRPGWCCRAGDGNGFFGDADFDPDVWVEGLRRMAAMFAGEE  218

Query  621  NVVGM  635
            NVVGM
Sbjct  219  NVVGM  223



>ref|XP_008793758.1| PREDICTED: uncharacterized protein LOC103709981 [Phoenix dactylifera]
Length=549

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+ +GRRVKLACVNW  HLE   AEGL KQP+D IS+++V +GFNCVRLTWPL+L T
Sbjct  36   RWIVDGNGRRVKLACVNWAAHLEAAAAEGLGKQPLDTISRRVVALGFNCVRLTWPLYLLT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N SL SL +R S   LGLLES A +  NNP+++DLPL+ A+QAVV +LA   +M+ILDN 
Sbjct  96   NASLGSLPLRASLAGLGLLESAAAVAVNNPALLDLPLLQAFQAVVSNLASNNIMVILDNQ  155

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ISKPGWCCS +D NGFFGD YFDP  W+ GLT +ATMFN ++NVVGM
Sbjct  156  ISKPGWCCSKFDENGFFGDKYFDPDEWLRGLTMMATMFNSSANVVGM  202



>gb|EYU23408.1| hypothetical protein MIMGU_mgv1a020519mg [Erythranthe guttata]
Length=538

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTNSRWIV++ +G+RVKL C NWV+HL+ +VAEGL K+P+  I+KKI + GFNCVR T
Sbjct  28   PLSTNSRWIVDQATGKRVKLTCANWVSHLQPMVAEGLEKKPLSYIAKKISETGFNCVRFT  87

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            WP F+FT     +LTV +S     L  + +G+  NNP  +++ +   ++AVV  L K KV
Sbjct  88   WPTFMFTRPDYYNLTVSESLDKFKLTAAKSGIAKNNPGFLNMKVAEVHKAVVNELGKNKV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNHIS+PGWCC+  DGNGFFGD  FDP  W+ GLT VAT + G S V+GM
Sbjct  148  MVVLDNHISQPGWCCADNDGNGFFGDALFDPTEWLKGLTAVATAYKGNSAVIGM  201



>gb|KHN43979.1| Endoglucanase E1 [Glycine soja]
Length=471

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  207  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  386
            +VAEGL ++P+D I+K+I  MGFNCVRLTWP++L TNDSLA+LTVRQSF NLGL ++I+ 
Sbjct  1    MVAEGLGERPLDGIAKEIKSMGFNCVRLTWPIYLITNDSLATLTVRQSFNNLGLPQAISA  60

Query  387  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  566
            +Q NNPS++DLPLI AYQ VV  L    +M+ILDNH+SKP WCCS+ DGNGFFGD YFDP
Sbjct  61   VQVNNPSLIDLPLIKAYQDVVKGLGDKGLMVILDNHVSKPQWCCSNDDGNGFFGDQYFDP  120

Query  567  KLWVIGLTKVATMFNGTSNVVGM  635
             LW+ GLTK+AT+F G +NVV M
Sbjct  121  DLWIKGLTKMATLFKGVTNVVAM  143



>gb|EMT27118.1| hypothetical protein F775_19072 [Aegilops tauschii]
Length=571

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 131/189 (69%), Gaps = 11/189 (6%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            ++ A PLST SRW+V+  GRRVKL C N  +HLE V AEGLS++ V  I+ ++  MGFNC
Sbjct  27   SLPALPLSTASRWLVDADGRRVKLVCANGASHLEPVAAEGLSRRGVGDIAARVAAMGFNC  86

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAY--------  437
            VRLTWP +L TN +L+SL +R S + LGL ES AG++ NNP ++DLPLI  +        
Sbjct  87   VRLTWPTYLATNATLSSLPLRWSLERLGLRESAAGVRVNNPDLLDLPLIDVFRVSSWVWG  146

Query  438  ---QAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF  608
               + VV +LA   +M+ILDN ++ PGWCCS  DGNGFFGD YFDP+ W+ GL+ +A +F
Sbjct  147  SPEEEVVSALASNSIMVILDNQMTTPGWCCSRTDGNGFFGDKYFDPEEWLRGLSAMAAVF  206

Query  609  NGTSNVVGM  635
              T NVVGM
Sbjct  207  RDTKNVVGM  215



>ref|XP_002272534.1| PREDICTED: uncharacterized protein LOC100257079 [Vitis vinifera]
Length=545

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RW+V++ SG+RVKLACVNW++HL+ +V EGL K+P+  I+  I  MGFNCVRLT
Sbjct  26   PLSTRGRWVVDDASGQRVKLACVNWISHLQAMVVEGLHKRPLREIAGGITAMGFNCVRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT  S  + +V +S   LGL E+  G+  NNP +++L L+ AY+AVV  L ++ V
Sbjct  86   WATYMFTRPSYGNRSVAESLGELGLSEAKEGVARNNPELLNLSLVEAYEAVVDELGRHGV  145

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNH+SKP WCC+  DGNGFFGD YF PK W+ GLTKVA  F   S VV M
Sbjct  146  MVVLDNHVSKPKWCCAEDDGNGFFGDKYFHPKEWLQGLTKVAHRFKDKSQVVAM  199



>emb|CBI34404.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RW+V++ SG+RVKLACVNW++HL+ +V EGL K+P+  I+  I  MGFNCVRLT
Sbjct  42   PLSTRGRWVVDDASGQRVKLACVNWISHLQAMVVEGLHKRPLREIAGGITAMGFNCVRLT  101

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT  S  + +V +S   LGL E+  G+  NNP +++L L+ AY+AVV  L ++ V
Sbjct  102  WATYMFTRPSYGNRSVAESLGELGLSEAKEGVARNNPELLNLSLVEAYEAVVDELGRHGV  161

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNH+SKP WCC+  DGNGFFGD YF PK W+ GLTKVA  F   S VV M
Sbjct  162  MVVLDNHVSKPKWCCAEDDGNGFFGDKYFHPKEWLQGLTKVAHRFKDKSQVVAM  215



>gb|EYU23411.1| hypothetical protein MIMGU_mgv1a004205mg [Erythranthe guttata]
Length=539

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 121/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTNSRWI++ E+G+RVKL C NWV+HL+ +VAEGL K+P+  I+KK+ + GFNCVR T
Sbjct  26   PLSTNSRWIIDQETGKRVKLTCANWVSHLQPMVAEGLEKKPLSYIAKKVPETGFNCVRFT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            WP F+FT     +LTV +S     L  + +G+  NNP  + + +   + AVV  L K KV
Sbjct  86   WPTFMFTRPDYYNLTVSESLDKYNLTAAKSGIAENNPGFLSMKVAEVHMAVVNELGKNKV  145

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNH+S+PGWCC   DGNGFFGD  FDP  W+ GLT VA  + G S VVGM
Sbjct  146  MVVLDNHVSQPGWCCGDNDGNGFFGDANFDPAEWLQGLTAVARAYKGNSAVVGM  199



>ref|XP_011080895.1| PREDICTED: uncharacterized protein LOC105164045 [Sesamum indicum]
Length=535

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 126/176 (72%), Gaps = 1/176 (1%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            ++ LSTNSRWIV++ SG+RVKLACVNWV+HL+ ++ EGL K+PV  I+++IV  GFNCVR
Sbjct  23   SRTLSTNSRWIVDQASGKRVKLACVNWVSHLQPMIVEGLEKKPVSCIARQIVATGFNCVR  82

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
             TW  F+FT    + LTV +S    GL ++ AG+  NNP  +++ ++  ++AVV  L K 
Sbjct  83   FTWATFMFTRTDYSKLTVSESLDKYGLKDAKAGIMKNNPQFLNMNVVEVHKAVVNELGKN  142

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            KVM++LDNH+S+P WCCS  DGNGFFGD  FDP  W+ GL  VA  + G S V+GM
Sbjct  143  KVMVVLDNHVSQPKWCCSGADGNGFFGDAEFDPTEWLQGLAAVAGTYKGNSVVIGM  198



>ref|XP_010904544.1| PREDICTED: uncharacterized protein LOC105031943 [Elaeis guineensis]
Length=554

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+ +GRRVKLACVNW  HLE   AEGL KQP+D IS  +V +GFNCVRLTWPL+L T
Sbjct  41   RWIVDGNGRRVKLACVNWAAHLEAAAAEGLGKQPLDTISGGVVALGFNCVRLTWPLYLLT  100

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N SL SL +R S   LGLLES A +  NNP+++DL L+ A+QAVV +LA   +M+ILDN 
Sbjct  101  NVSLGSLPLRASLAGLGLLESAAAVAVNNPALLDLSLLQAFQAVVSNLASNNIMVILDNQ  160

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ISK GWCCS +D NGFFGD YFDP  W+ GLT +ATMFN T+NVVGM
Sbjct  161  ISKAGWCCSKFDDNGFFGDKYFDPDEWLQGLTMMATMFNSTTNVVGM  207



>gb|KCW59700.1| hypothetical protein EUGRSUZ_H02458, partial [Eucalyptus grandis]
Length=516

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 130/178 (73%), Gaps = 8/178 (4%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVAQ L  +SRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  27   VVAQQLYADSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  86

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ-AVVGSLA  461
            RLTW L L  N++LASLTV QSF+NLGL ES+AG+++NNPS+++LPL+ AY+   +   A
Sbjct  87   RLTWALELPMNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKDKRIAQFA  146

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             Y   I   N +   G      DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GM
Sbjct  147  SYGYEIF--NMMRDDG-----EDGNGFFGDKYFDPQVWMQGLHKMATMATGFSNVIGM  197



>ref|XP_011080894.1| PREDICTED: uncharacterized protein LOC105164044 [Sesamum indicum]
Length=409

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 130/181 (72%), Gaps = 3/181 (2%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMG  272
            P    + PLST SRWI++E +G RVKL C+NW  HLE ++AEGL+KQP   I++ + +MG
Sbjct  14   PILCCSLPLSTRSRWIIDEATGARVKLICINWAAHLEPMLAEGLNKQPAGRIARLVAEMG  73

Query  273  FNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            FNCVRLTW  ++FT    A+LTV QS   LGL++++ G+  NNP  +++ ++ A +AVV 
Sbjct  74   FNCVRLTWATYMFTR--FANLTVAQSLTRLGLVDAMEGIAVNNPGFLNVTVVDAQRAVVE  131

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  VM++LDNH+S+P WCC  +DGNGFFGD YFD K W+ GL+ VA ++  TS VVG
Sbjct  132  ALVRQGVMVVLDNHVSQPMWCCGEHDGNGFFGDKYFDAKEWLQGLSIVAKLYKDTSMVVG  191

Query  633  M  635
            +
Sbjct  192  I  192



>ref|XP_010053198.1| PREDICTED: uncharacterized protein LOC104441706 [Eucalyptus grandis]
 gb|KCW77462.1| hypothetical protein EUGRSUZ_D01800 [Eucalyptus grandis]
Length=538

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV+  +GRR+KLACVNW +HLE ++AEGL K+P+ VI  +I  + FNCVRLT
Sbjct  29   PLSTNGRWIVDSATGRRMKLACVNWASHLEPMLAEGLDKKPLGVIVAEIRRLRFNCVRLT  88

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT        V ++  +LGL E+  G+  NNP ++++  + AY AVV  L K  V
Sbjct  89   WATYMFTQPGHGDQPVEETLDSLGLAEAKGGVARNNPLVLNMTHVEAYAAVVDELGKQGV  148

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNH+SKP WCC+  DGNGFFGD YFDP+ W+ GL  VA  FNG S VVGM
Sbjct  149  MVVLDNHVSKPKWCCAYDDGNGFFGDEYFDPEEWLRGLVAVAEHFNGKSQVVGM  202



>emb|CAH67677.1| H0510A06.2 [Oryza sativa Indica Group]
 emb|CAH66882.1| OSIGBa0158F13.13 [Oryza sativa Indica Group]
Length=555

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 118/167 (71%), Gaps = 16/167 (10%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +V MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMVT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N S +SLTV QSF+ L L ES+A                A +AVV SL +  VM+ILDNH
Sbjct  96   NASYSSLTVAQSFQRLNLTESLA----------------AIRAVVSSLGENGVMVILDNH  139

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV M
Sbjct  140  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAM  186



>gb|EPS62091.1| hypothetical protein M569_12701, partial [Genlisea aurea]
Length=514

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 116/173 (67%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST+SRWIV+ +GRRVKL CVNW++H E +VAEGL K+P+  I+K I   GFNCVR TW
Sbjct  17   PLSTSSRWIVDRAGRRVKLTCVNWISHNEPMVAEGLEKKPLAYIAKAIASAGFNCVRFTW  76

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P F+FT      LTV QS    GL  + AG+  NNP ++ + ++  + AVV  L +  +M
Sbjct  77   PTFMFTRPDYGKLTVGQSLDRYGLTAAKAGISKNNPQLMGMSVVEVHGAVVDELGRSGLM  136

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ++LDNH+S P WCC S DGNGFFGD  FDP  W+ GLT VA  +     VVGM
Sbjct  137  VVLDNHVSHPQWCCGSDDGNGFFGDYNFDPDEWIRGLTAVARAYKSRPGVVGM  189



>gb|AFW62835.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=380

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 123/184 (67%), Gaps = 17/184 (9%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G+                +A
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGV----------------EA  122

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  123  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  182

Query  624  VVGM  635
            VVGM
Sbjct  183  VVGM  186



>emb|CAD41090.2| OSJNBb0011N17.7 [Oryza sativa Japonica Group]
Length=555

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 117/167 (70%), Gaps = 16/167 (10%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +  MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVDAMGFNCVRLTWATFMVT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N S +SLTV QSF+ L L ES+A                A +AVV SL +  VM+ILDNH
Sbjct  96   NASYSSLTVAQSFQRLNLTESLA----------------AIRAVVSSLGENGVMVILDNH  139

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV M
Sbjct  140  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAM  186



>gb|KHN19917.1| hypothetical protein glysoja_032397 [Glycine soja]
Length=464

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWPLFL TNDS+ASLT+R SF+NLGL++S+ G+QA NPSI+DLPLI AYQAV
Sbjct  1    MGFNCVRLTWPLFLVTNDSIASLTLRNSFQNLGLIQSLNGVQAINPSIIDLPLIKAYQAV  60

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL +  VM+ILDNH+S+PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+F G +NV
Sbjct  61   VKSLGENDVMVILDNHVSQPGWCCSNLDGNGFFGDQYFDPDLWIMGLTKMATIFKGVTNV  120

Query  627  VGM  635
            V M
Sbjct  121  VAM  123



>gb|KHN06535.1| Endoglucanase [Glycine soja]
Length=474

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWP+ L TNDSLASLTVR SF+NL LLESIAG+Q NNPSI+DLPLI A+QAV
Sbjct  1    MGFNCVRLTWPIVLVTNDSLASLTVRSSFQNLALLESIAGVQTNNPSIIDLPLIQAFQAV  60

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL    VM+ILDNHI++PGWCCS+ DGNGFFGD +FDP  W++GLTK+A++FNG +NV
Sbjct  61   VKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKFFDPNQWILGLTKMASLFNGVTNV  120

Query  627  VGM  635
            VGM
Sbjct  121  VGM  123



>gb|ABR17494.1| unknown [Picea sitchensis]
Length=543

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 124/173 (72%), Gaps = 1/173 (1%)
 Frame = +3

Query  120  LSTNSRWIVNESG-RRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            L+  SRWIV+E+G  RVKLACVNWV+HL+ +V EGLS+QP+  I+  IV  GFNCVRLTW
Sbjct  26   LAVKSRWIVDETGGTRVKLACVNWVSHLQPMVTEGLSRQPLKYITSTIVSQGFNCVRLTW  85

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
              F+ TN +  +LTV+ S  +L L ++ A +  +NP  +DL L+ +Y+ VV  L +  +M
Sbjct  86   ATFMVTNPANRNLTVQDSLNSLNLSDAAAAMAVSNPEFLDLTLMDSYKRVVAGLGEAGLM  145

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDNHIS+P WCC   DGNGFFGD  FDP +W+ GL+ +AT F GT+ VVGM
Sbjct  146  VILDNHISRPQWCCGYNDGNGFFGDADFDPGVWIQGLSAMATAFKGTAAVVGM  198



>ref|XP_002272491.1| PREDICTED: uncharacterized protein LOC100262188 [Vitis vinifera]
Length=541

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV++ +GRRVKL CVNW++H E ++ EGL  QP+  I+ KI +MGFNCVRLT
Sbjct  30   PLSTKGRWIVDDVTGRRVKLKCVNWISHTESMITEGLHSQPIGDIADKISEMGFNCVRLT  89

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +P FL+T     + TV +S  +L   E+ A +   NP  + LPL  +Y+ VVG L +  +
Sbjct  90   YPTFLWTRVDYYNKTVAESLDSLNATEAKAMIAVQNPRFLSLPLRESYERVVGELGRRGL  149

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH+SKP WCC   DGNGFFGD +FDP+ W+ GL++VA  F   S+V+GM
Sbjct  150  MLILDNHVSKPMWCCEREDGNGFFGDKFFDPEEWIEGLSQVANRFKDESHVIGM  203



>ref|XP_002272422.2| PREDICTED: uncharacterized protein LOC100245045 [Vitis vinifera]
Length=530

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 119/174 (68%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV+ E+G RVKL C+NWV H E +V EGL  QP+  I+ K+  MGFNC+RLT
Sbjct  23   PLSTRGRWIVDSETGHRVKLTCLNWVAHTETMVTEGLHTQPIKDIAAKVTSMGFNCIRLT  82

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +  F++T    ++ TV QS  +  L ++  G+  NNP +++L L  AY+AVV  L    +
Sbjct  83   YATFMWTRSDYSNKTVAQSLDSFNLTQAREGIARNNPQLLNLSLQEAYEAVVDELGANGL  142

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNH+SKP WCC+  DGNGFFGD++FDPK W+ GLT+VA  F G   VV M
Sbjct  143  MLVLDNHVSKPMWCCAREDGNGFFGDMFFDPKEWIEGLTQVAKRFKGKPQVVAM  196



>ref|XP_010658499.1| PREDICTED: uncharacterized protein LOC100267356 isoform X2 [Vitis 
vinifera]
Length=502

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIV-NESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV N +G RVK+ACVNWV+HLE +V EG+  QPV+ I++ +  MGFNC+RLT
Sbjct  64   PLSTRGRWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLT  123

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +  F++T     + TV QS  +  L ++  G+  NNP +++L +I AY+AVV  L  + +
Sbjct  124  YATFMWTRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGL  183

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNH+SKP WCC+  DGNGFFGD+YFDPK W+ GLT V+T F     VV +
Sbjct  184  MLVLDNHVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVAL  237



>ref|XP_006439449.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
 gb|ESR52689.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
Length=538

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 120/174 (69%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWI+N S G+RVKLACVNW  HL+ ++AEGL K+P+  I   +V M FNCVRLT
Sbjct  22   PLSTNKRWIINASTGQRVKLACVNWPAHLQPMLAEGLDKKPLGEIVAAVVKMHFNCVRLT  81

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  F+FT  +   ++V Q+  +L L E+  G+  NNP I+++  I AY+AVVG L    +
Sbjct  82   WSTFMFTRPNYGHISVSQTLDSLDLKEAKQGISKNNPFILNMTHIQAYEAVVGELGAQGI  141

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNHISKP WCCS+ DGNGFFGD YFDP  W+ GL+ VA  F     VV +
Sbjct  142  MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAI  195



>ref|XP_008678768.1| PREDICTED: uncharacterized protein LOC100501654 isoform X2 [Zea 
mays]
 gb|AFW62834.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=548

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 123/184 (67%), Gaps = 17/184 (9%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G+                +A
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGV----------------EA  122

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  123  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  182

Query  624  VVGM  635
            VVGM
Sbjct  183  VVGM  186



>ref|XP_002272454.2| PREDICTED: uncharacterized protein LOC100267356 isoform X1 [Vitis 
vinifera]
Length=575

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIV-NESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV N +G RVK+ACVNWV+HLE +V EG+  QPV+ I++ +  MGFNC+RLT
Sbjct  64   PLSTRGRWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLT  123

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +  F++T     + TV QS  +  L ++  G+  NNP +++L +I AY+AVV  L  + +
Sbjct  124  YATFMWTRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGL  183

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNH+SKP WCC+  DGNGFFGD+YFDPK W+ GLT V+T F     VV +
Sbjct  184  MLVLDNHVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVAL  237



>emb|CBI34405.3| unnamed protein product [Vitis vinifera]
Length=970

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV++ +GRRVKL CVNW++H E ++ EGL  QP+  I+ KI +MGFNCVRLT
Sbjct  459  PLSTKGRWIVDDVTGRRVKLKCVNWISHTESMITEGLHSQPIGDIADKISEMGFNCVRLT  518

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +P FL+T     + TV +S  +L   E+ A +   NP  + LPL  +Y+ VVG L +  +
Sbjct  519  YPTFLWTRVDYYNKTVAESLDSLNATEAKAMIAVQNPRFLSLPLRESYERVVGELGRRGL  578

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH+SKP WCC   DGNGFFGD +FDP+ W+ GL++VA  F   S+V+GM
Sbjct  579  MLILDNHVSKPMWCCEREDGNGFFGDKFFDPEEWIEGLSQVANRFKDESHVIGM  632


 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIV-NESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV N +G RVK+ACVNWV+HLE +V EG+  QPV+ I++ +  MGFNC+RLT
Sbjct  26   PLSTRGRWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +  F++T     + TV QS  +  L ++  G+  NNP +++L +I AY+AVV  L  + +
Sbjct  86   YATFMWTRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGL  145

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNH+SKP WCC+  DGNGFFGD+YFDPK W+ GLT V+T F     VV +
Sbjct  146  MLVLDNHVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVAL  199



>ref|XP_002272386.2| PREDICTED: uncharacterized protein LOC100250178 [Vitis vinifera]
Length=536

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 121/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV+ E+G RVKL C+NW  H++ +V EGL  QP+  I  K+  MGFNC+RLT
Sbjct  29   PLSTRGRWIVDSETGSRVKLTCLNWAAHIDTMVTEGLHTQPIKDIVAKVTLMGFNCIRLT  88

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +  F++T     + TV QS  ++ L ++  G+  NNP +++L L  AY+AVV ++    +
Sbjct  89   YATFMWTRPDYGNKTVAQSLDSMNLTQAREGIARNNPQLLNLSLQDAYEAVVDAIGANGL  148

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++LDNH+SKP WCC+S DGNGFFGD++FDPK W+ GLT+VA+ F G   VV M
Sbjct  149  MLVLDNHVSKPMWCCASEDGNGFFGDMFFDPKEWIEGLTQVASRFKGKPQVVAM  202



>gb|KGN57439.1| hypothetical protein Csa_3G186170 [Cucumis sativus]
Length=203

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 119/159 (75%), Gaps = 3/159 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV  + G+RVKL CVNW  H++ +VAEGL  +P+D I+  +V + FNCVRLT
Sbjct  26   PLSTNGRWIVEATTGQRVKLICVNWPGHMQAMVAEGLHLKPLDDIAAMVVKLRFNCVRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LTV+QSF+N  L E+I G+  NNP+I+++ ++ AY+AVV SL  + V
Sbjct  86   YSIHMFTR--YANLTVKQSFENFDLKEAIVGIAQNNPTILNMKVVEAYEAVVDSLGAHGV  143

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLT  590
            M++ DNHIS+P WCCS+ DGNGFFGD YF+ + W+ GL+
Sbjct  144  MVVSDNHISQPRWCCSNDDGNGFFGDRYFNSQEWLQGLS  182



>gb|AFK46453.1| unknown [Lotus japonicus]
Length=158

 Score =   181 bits (459),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V   PL+TNSRWIVN+ G RVKLACVNWV+HL+ VVAEGLSKQPVDVISK I  MGFNCV
Sbjct  37   VAGVPLNTNSRWIVNQDGLRVKLACVNWVSHLDAVVAEGLSKQPVDVISKGIKSMGFNCV  96

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  440
            RLTWP+ L TNDSL+SLTVRQSF+NLGLL+S+AG+QANNPSI+DL LI A+Q
Sbjct  97   RLTWPILLVTNDSLSSLTVRQSFQNLGLLDSVAGVQANNPSIIDLTLIQAFQ  148



>ref|XP_008467257.1| PREDICTED: uncharacterized protein LOC103504654 [Cucumis melo]
Length=539

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 124/174 (71%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWI++ + GRRVKL CVNW  H++ ++ EGL ++P+D I+  +  + FNCVRLT
Sbjct  28   PLSTNGRWIIDATTGRRVKLMCVNWAGHMQGMLVEGLHRRPLDDIAALVAKLRFNCVRLT  87

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LTV+QSF+N  + +++AG+  NNPSI++L L+ AY AVV SL  + +
Sbjct  88   YSIHMFTRH--ANLTVKQSFENFDMKDAMAGIAQNNPSILNLTLVEAYGAVVDSLVAHGI  145

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++ DNHIS+P WCC + DGNGFFGD YFDP+ W+ G++  A      + VV M
Sbjct  146  MVVSDNHISQPRWCCDNNDGNGFFGDRYFDPQEWLQGISLAAQSLKSKAQVVAM  199



>gb|KGN50395.1| hypothetical protein Csa_5G171770 [Cucumis sativus]
Length=538

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV+ + G+RVKL CVNW  H++ ++AEGL ++P+D I   +  + FNCVRLT
Sbjct  27   PLSTNGRWIVDATTGQRVKLMCVNWPGHMQGMLAEGLHRRPLDDIISLVAKLRFNCVRLT  86

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LTV+QSF+N  + +++AG+  NNPS+V+L L+ AY AVV SLA + V
Sbjct  87   YSIHMFTRH--ANLTVQQSFENFDMKDAMAGIAQNNPSLVNLTLVEAYGAVVDSLAAHGV  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++ DNHIS+P WCC++ DGNGFFGD YFDP+ W+ G++  A      + VV M
Sbjct  145  MVVSDNHISQPRWCCNNDDGNGFFGDRYFDPEEWLQGISLAAQSLKSKAEVVAM  198



>gb|KGN50394.1| hypothetical protein Csa_5G171760 [Cucumis sativus]
Length=538

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 126/174 (72%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV+ + G RVKL CVNW  H++ ++AEGL  +P+D I+  +V   FNCVRLT
Sbjct  27   PLSTNGRWIVDATTGNRVKLMCVNWAGHMQGMLAEGLHLRPLDDIAALVVKSRFNCVRLT  86

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LTV+QSF+N  + +++AG+  NNPSI+++ ++ AY AV+ SLA ++V
Sbjct  87   YSIHMFTRH--ANLTVQQSFENFDMKDALAGIAQNNPSILNMTVVQAYGAVIDSLAAHRV  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++ DNHIS+P WCC++ DGNGFFGD YFDP+ W+ G++  A      S VV M
Sbjct  145  MVVSDNHISQPRWCCNNDDGNGFFGDRYFDPQEWLQGISLAAQNLKSKSQVVAM  198



>ref|XP_009381699.1| PREDICTED: uncharacterized protein LOC103969775 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +3

Query  207  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  386
            ++AEGLSKQP+  I+  I  MGFNCVRLT+P FL T++SLASLTVRQSF+  GL  +I  
Sbjct  1    MLAEGLSKQPLASITWNIHLMGFNCVRLTYPTFLLTDESLASLTVRQSFERAGLDATIPL  60

Query  387  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  566
            +  +NP+ VDL L+ AY+AVV  L    +M+ILDNHISKPGWCCS+ DGNGFFGD YFDP
Sbjct  61   IALHNPTFVDLNLLQAYKAVVAKLGATNIMVILDNHISKPGWCCSNSDGNGFFGDTYFDP  120

Query  567  KLWVIGLTKVATMFNGTSNVVGM  635
             +W  GL K+ATMF GT NVVGM
Sbjct  121  NVWYQGLIKMATMFKGTPNVVGM  143



>ref|XP_008459280.1| PREDICTED: uncharacterized protein LOC103498458 [Cucumis melo]
Length=719

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 125/180 (69%), Gaps = 3/180 (2%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P   + PLSTN RWI++ + GRRVKL CVNW  H++ ++ EGL ++P+D I+  +  + F
Sbjct  193  PEAYSLPLSTNGRWIIDATTGRRVKLMCVNWAGHMQGMLVEGLHRRPLDDIAALVAKLRF  252

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVRLT+ + +FT    A++TV+QSF+N  + +++ G+  NNPSI++L L+ AY AVV S
Sbjct  253  NCVRLTYSIHMFTRH--ANVTVKQSFENFDMKDALVGIAQNNPSILNLTLVEAYGAVVDS  310

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            LA + +M++ DNHIS+P WCC + DGNGFFGD YFDP+ W  G++  A      + VV M
Sbjct  311  LAAHGIMVVSDNHISQPRWCCDNDDGNGFFGDRYFDPQEWFQGISLAAQSLKSKAQVVAM  370



>ref|XP_008810943.1| PREDICTED: uncharacterized protein LOC103722247 [Phoenix dactylifera]
Length=554

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 124/179 (69%), Gaps = 2/179 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            V A PLST+ RW+V+  SG+RVKL CVNW  H+  V+AEGL +QP+D I+  I  +GFNC
Sbjct  27   VHALPLSTSGRWVVDSASGQRVKLHCVNWAAHMPAVLAEGLDRQPLDGIAAGIAGLGFNC  86

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            VRLTW   LFT +S  +LTV +S  +LGL ++  G++ NN  +V + +  A+ AVV ++ 
Sbjct  87   VRLTWATHLFTKESYENLTVSESLSSLGLGDAFDGVRRNNGWMVGITVREAFDAVVKAIG  146

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS-NVVGM  635
            +  +M++LDNH+S+P WCC   DGNGFFGD YFDP+ W+ GL  VAT +   +  VVGM
Sbjct  147  EAGLMVVLDNHVSRPQWCCGDDDGNGFFGDTYFDPEEWLRGLEFVATRYRSDNPQVVGM  205



>ref|XP_004168760.1| PREDICTED: uncharacterized protein LOC101223816 [Cucumis sativus]
Length=535

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 122/174 (70%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV  + G+RVKL CVNW  H++ +VAEGL  +P+D I+  +V + FNCVRLT
Sbjct  26   PLSTNGRWIVEATTGQRVKLICVNWPGHMQAMVAEGLHLKPLDDIAAMVVKLRFNCVRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LTV+QSF+N  L E+I G+  NNP+I+++ ++ AY+AVV SL  + V
Sbjct  86   YSIHMFT--RYANLTVKQSFENFDLKEAIVGIAQNNPTILNMKVVEAYEAVVDSLGAHGV  143

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M++ DNHIS+P WCCS+ DGNGFFGD YF+ + W+ GL+           VV M
Sbjct  144  MVVSDNHISQPRWCCSNDDGNGFFGDRYFNSQEWLQGLSLATQSLKTKPQVVAM  197



>ref|XP_009605826.1| PREDICTED: uncharacterized protein LOC104100317 [Nicotiana tomentosiformis]
Length=526

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 121/174 (70%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+SRWIV+E +G+RVKL C NW  HL+ ++ EGL +QPV  I++ I  MGFNCVRLT
Sbjct  22   PLSTSSRWIVDEETGQRVKLVCGNWAAHLQTMLPEGLDQQPVSQIARHISLMGFNCVRLT  81

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT  S  +LTV QSF N GL  +++GL  NNP ++ L ++ A +AV+  L ++ V
Sbjct  82   WATYMFTRHS--NLTVAQSFINNGLNNAMSGLGQNNPQLLGLTVVEAQKAVIEELGRHGV  139

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M +LDN + +P WCC S DGNGF+GD YF+PK W+ GL  VA  +     V+G+
Sbjct  140  MSVLDNQVGEPMWCCGSNDGNGFWGDKYFEPKEWLKGLDIVANRYKDIPMVIGI  193



>gb|EYU23409.1| hypothetical protein MIMGU_mgv1a004243mg [Erythranthe guttata]
Length=538

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 112/173 (65%), Gaps = 1/173 (1%)
 Frame = +3

Query  120  LSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            LST+SRWIVN+ +G RVKL C NW  HL+ +V EGL K+PV  I+ +I  +GFNCVRLTW
Sbjct  30   LSTSSRWIVNQGTGNRVKLTCANWAGHLQAMVPEGLEKKPVSYIASQIAKLGFNCVRLTW  89

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
              F+FT    ++L V  +     L  + +G+  NNP  +++ +I   +AVVG L K  +M
Sbjct  90   ATFMFTRPEYSNLKVSAALDKYNLAAAKSGIGKNNPQFLEMSVIDVQKAVVGELGKNNLM  149

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ++LDNH+S PGWCC   DGNGFFGD  FD   W+ GLT VA  + G   VV M
Sbjct  150  VVLDNHVSLPGWCCGDDDGNGFFGDANFDTNEWLQGLTAVARSYKGNPAVVAM  202



>ref|XP_009773950.1| PREDICTED: uncharacterized protein LOC104224082 [Nicotiana sylvestris]
Length=526

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 122/174 (70%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+SRWI++ E+G+RVKL C NW  HL+ ++ EGL +QPV  I++ I  MGFNCVRLT
Sbjct  22   PLSTSSRWIIDDETGQRVKLVCGNWAAHLQTMLPEGLDQQPVSHIARHISLMGFNCVRLT  81

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT  S  +LTV QSF N GL ++++GL  NNP ++ L ++ A +AV+  L ++ V
Sbjct  82   WATYMFTRHS--NLTVAQSFINNGLNDAMSGLGQNNPQLLGLTVVEAQKAVIEELGRHGV  139

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M +LDN + +P WCC S DGNGF+GD YF+PK W+ GL  VA  +     V+G+
Sbjct  140  MSVLDNQVGEPMWCCGSDDGNGFWGDKYFEPKEWLKGLDIVARTYKDIPLVIGI  193



>ref|XP_002893942.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70201.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=420

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 124/195 (64%), Gaps = 30/195 (15%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKL-ACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+SRWIV+E+G+R KL +C    T          +KQPVD ++KKIV+M FNCVRLT
Sbjct  4    PLSTSSRWIVDENGQRAKLMSCGGERTKQ--------AKQPVDAVAKKIVEMSFNCVRLT  55

Query  294  WPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            WP  L TN++LA ++TVRQSF++ GL + I G + NNPSI+DL LI A+  V      ++
Sbjct  56   WPSDLMTNETLAYNVTVRQSFQSFGLNDDIVGFKTNNPSIIDLSLIEAFICVTEVNVTFR  115

Query  471  --------------------VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLT  590
                                VM+ILDNH++KPGWCC+  DGN F GD +FDP +W   L+
Sbjct  116  THNTRDLCLAFFLFCSKSNDVMVILDNHLTKPGWCCADNDGNDFSGDKFFDPTVWAAALS  175

Query  591  KVATMFNGTSNVVGM  635
            K+   F+G SNVVGM
Sbjct  176  KMTATFDGVSNVVGM  190



>gb|EMS46776.1| hypothetical protein TRIUR3_23304 [Triticum urartu]
Length=290

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWP FL TN S +SLTV QSF+ L L ES+AG++ANNP++VDL LI A++A 
Sbjct  1    MGFNCVRLTWPTFLVTNASYSSLTVEQSFQRLNLTESLAGIRANNPTVVDLKLIDAFKA-  59

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
              SL +  VM+ILDNH+SKPGWCC + DGNGFFGD YF+P +WV GLTK+ATMF G  +V
Sbjct  60   -SSLGENNVMVILDNHVSKPGWCCDNADGNGFFGDGYFEPDVWVDGLTKMATMFAGVPHV  118

Query  627  VGM  635
            VGM
Sbjct  119  VGM  121



>ref|XP_010325669.1| PREDICTED: uncharacterized protein LOC101257885 [Solanum lycopersicum]
Length=503

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 121/174 (70%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+SRWI+++ +G+RVKLACVNW  HL+ ++ EGL +QP+  I K I  MGFNCVRLT
Sbjct  28   PLSTSSRWIIDDKNGQRVKLACVNWAAHLQTMIPEGLDQQPISKIVKHISLMGFNCVRLT  87

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT  S  +LTV QSF N GL +++  +   NP ++ L +  A +AVV  + ++ +
Sbjct  88   WATYMFTRYS--NLTVAQSFANNGLHDALTRIAQKNPQLLGLSVFEAQRAVVEEMGRHGI  145

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M ILDNH+S+P WCC ++DGNGF+GD  F PK W+ GL  VA  +  +  V+G+
Sbjct  146  MSILDNHLSRPMWCCGNHDGNGFWGDEDFQPKEWLKGLDIVAKKYKDSPMVMGI  199



>gb|ACF85134.1| unknown [Zea mays]
Length=492

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVR TWP FL T+ S + LTV QSF+ L L ES+AG++ NNP +VDL LI A++AV
Sbjct  1    MGFNCVRFTWPTFLVTDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAV  60

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL ++ +M+ILDNH+SKPGWCCS+ DG+GFFGD YFDP +WV GLTK+ATMF G  NV
Sbjct  61   VSSLGEHNLMVILDNHLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNV  120

Query  627  VGM  635
            VGM
Sbjct  121  VGM  123



>emb|CDX83591.1| BnaC07g23310D [Brassica napus]
Length=460

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
            MGFNCVRLTWPL L TN +LA+ +TVR SF++LGL   I+G + NNPS++DLPLI AYQ+
Sbjct  1    MGFNCVRLTWPLDLATNVTLATNVTVRDSFQSLGLNTDISGFETNNPSMIDLPLIEAYQS  60

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L KY VM+ILDNH++KPGWCC + DGNGFFGDI+FDP  W+ GLT +AT F  TSN
Sbjct  61   VVTTLGKYNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSN  120

Query  624  VVGM  635
            VVGM
Sbjct  121  VVGM  124



>ref|XP_001769398.1| predicted protein [Physcomitrella patens]
 gb|EDQ65767.1| predicted protein, partial [Physcomitrella patens]
Length=359

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 113/172 (66%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            LSTNSRW+V+  G RVKL+CVNWV HLE  + EGL+K     I+  +   GFNCVRLT  
Sbjct  1    LSTNSRWVVDRFGVRVKLSCVNWVGHLEPGIPEGLNKNTARGIAILVRATGFNCVRLTSS  60

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
             +L+TNDS   LTV QSF NL +  S   L+A NP +  L L   +  V+  L    +M+
Sbjct  61   TWLWTNDSYGGLTVAQSFSNLNITSSSIALRAINPELYPLTLREVHHQVINILTAQGLMV  120

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ILDNH+SKP WCC+S DGNGF+GD +FD + W++GLT VA+ F+    VV M
Sbjct  121  ILDNHVSKPQWCCASNDGNGFWGDEFFDAETWLMGLTTVASEFSNNPFVVAM  172



>ref|XP_001767510.1| predicted protein [Physcomitrella patens]
 gb|EDQ67645.1| predicted protein, partial [Physcomitrella patens]
Length=359

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRW+V+  G RVK +CVNW  HLE  + EGLS+     I+  I   GFNCVRLT+
Sbjct  1    PLSTFSRWVVDRFGVRVKFSCVNWAGHLEAGIPEGLSRNTARGIATLIRVNGFNCVRLTY  60

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
              +L+TNDS   LTV Q+F NL L  +   + A NP +  L L   ++ +V  L  + +M
Sbjct  61   STWLWTNDSYGELTVAQNFNNLNLTSTGLAIAALNPDLYLLTLRQVHRRMVNILTAHDLM  120

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +ILDNH+SKP WCCS  DGNGF+GD YFD + W++GLT VAT F+    VV M
Sbjct  121  VILDNHVSKPKWCCSDTDGNGFWGDEYFDVETWMLGLTTVATTFSSNPFVVAM  173



>emb|CDY13614.1| BnaA06g33090D [Brassica napus]
Length=460

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
            MGFNCVRLTWPL L TN +LA S+TVR SF++LGL   I+G +  NPS++DLPLI AYQ+
Sbjct  1    MGFNCVRLTWPLDLATNVTLATSVTVRDSFQSLGLNTDISGFETKNPSMIDLPLIEAYQS  60

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L  Y VM+ILDNH++KPGWCC + DGNGFFGDI+FDP  W+ GLT +AT F  TSN
Sbjct  61   VVTTLGNYNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSN  120

Query  624  VVGM  635
            VVGM
Sbjct  121  VVGM  124



>gb|EYU23410.1| hypothetical protein MIMGU_mgv1a004297mg [Erythranthe guttata]
Length=534

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 111/173 (64%), Gaps = 1/173 (1%)
 Frame = +3

Query  120  LSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            LSTNSRWI+++ +G+RVKL C NW  H+E ++ EGL K+PV  I+ +I  +GFNCVRLTW
Sbjct  25   LSTNSRWIIDQGTGKRVKLTCANWAAHMEPMLPEGLEKKPVSYIASQIAKLGFNCVRLTW  84

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
              ++FT     +L V +S     L  + AG+  NN   +++ +I   +AVVG L K  +M
Sbjct  85   ATYMFTRPEYVNLKVSESLDRYSLAAAKAGIGKNNAQFLEMSVIDVQKAVVGELGKNNLM  144

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ++LDN +S P WCCS  DGNGF+GD YF    W+ GLT VA  + G   VV M
Sbjct  145  VVLDNTVSMPTWCCSDDDGNGFWGDKYFAVDEWLQGLTAVARAYKGNPAVVAM  197



>gb|KDP25366.1| hypothetical protein JCGZ_20522 [Jatropha curcas]
Length=554

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 117/180 (65%), Gaps = 3/180 (2%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P     PLST  +WIV+ ++G RVKLACVNW +HLE ++AEGL+ +P+  I  +IV   +
Sbjct  17   PCCFCLPLSTKGKWIVDSKTGERVKLACVNWPSHLEPMLAEGLADKPLKQIVFQIVRGNY  76

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVR TW  F+FT    A+LTVR+SF  L L E++A ++  N  I++  L  A++ V+  
Sbjct  77   NCVRFTWATFMFTR--YANLTVRESFNTLNLTETVAEIRRQNGFILEKTLPQAFETVIDE  134

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L +  VM+ILD  +SKP WCC   DGN FFGD YFD + W+ GLT  A +  G  NV+G+
Sbjct  135  LGRQGVMVILDCQVSKPTWCCGEKDGNAFFGDEYFDVEEWLQGLTTAAELAKGKPNVIGI  194



>ref|XP_002509879.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51266.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=542

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 115/170 (68%), Gaps = 3/170 (2%)
 Frame = +3

Query  129  NSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            N RWI++ +SG RVKLACVNW +HL+ ++AEGL K+P+  ++ K+    FNCVR T    
Sbjct  30   NKRWIIDAKSGERVKLACVNWASHLQPMLAEGLDKKPLSYLASKLARYHFNCVRFTCATH  89

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            +FT      LTV QSF +L L ++ AG+  +N  +++L ++ AY+AVV  L  + +M++L
Sbjct  90   MFTR--YGKLTVAQSFDSLNLTKAKAGIARHNSFLLNLTVVQAYEAVVNELGAHGLMVLL  147

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            DNH+S+P WCC   D NGFFGDI+F PK W+ GL  VA +F G S VV M
Sbjct  148  DNHVSQPKWCCPQDDENGFFGDIHFHPKEWLRGLAIVAKIFQGKSQVVAM  197



>emb|CDP12092.1| unnamed protein product [Coffea canephora]
Length=938

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 121/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+SRWI+++ +G RVKL CVNWV HLE +V EGL K+P+  I   +  MGFNCVRLT
Sbjct  407  PLSTSSRWILDDKTGSRVKLTCVNWVGHLEPLVVEGLQKKPLPYIVDNVALMGFNCVRLT  466

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  F+FT ++  +LTVR+S   L L  S+AG+  NNP ++D  ++   +AVV  L +  +
Sbjct  467  WATFMFTRENYGNLTVRESLNQLSLDGSVAGIAMNNPQLLDATVVEVQKAVVYELGRKNI  526

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+ILDNH+SKP WCC   DGNGFFGD +FDPK W+ GL  VA ++    NVV M
Sbjct  527  MVILDNHVSKPQWCCGGDDGNGFFGDEFFDPKEWLQGLAAVANLYKDAPNVVAM  580


 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 97/143 (68%), Gaps = 2/143 (1%)
 Frame = +3

Query  207  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  386
            ++ EGLSK P+D IS+ I  +GFNC+RLTW ++++T    A +TV Q  ++L L +++AG
Sbjct  1    MLPEGLSKSPLDDISRHISLLGFNCIRLTWAVYMYTRH--AHVTVAQHLQDLNLTDALAG  58

Query  387  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  566
            +Q +NP +  L L+ A +AV+ S+A + VM++LD  +SKP WCC+  DGNGF+GD YFDP
Sbjct  59   IQRHNPHLASLTLVDAQKAVIESVASHGVMVLLDCQVSKPMWCCNDNDGNGFWGDAYFDP  118

Query  567  KLWVIGLTKVATMFNGTSNVVGM  635
              W+  L+ VA  +     V+ M
Sbjct  119  HEWLRALSTVAKRYKDMHMVMAM  141



>gb|KDP25365.1| hypothetical protein JCGZ_20521 [Jatropha curcas]
Length=935

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN +WIV+ ++G+RVKLACVNW  HLE +VAEG  +Q +  I ++IV   +NCVRLT
Sbjct  27   PLSTNGKWIVDSKTGQRVKLACVNWPAHLEPMVAEGFREQSLKRIVEQIVKQKYNCVRLT  86

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  F+FT    A++TV+QSF+ L L E+  G++ +N  +  + L+ A++AV+  L    V
Sbjct  87   WATFMFTR--YANITVKQSFQTLKLTETTGGIKKHNLFLYSMTLVQAFEAVIDELGNQGV  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M +LD  +SKP WCC   DGN FFGD  FD + W+ GLTKVA +     +VVG+
Sbjct  145  MAVLDCQVSKPSWCCGERDGNAFFGDTSFDVQEWIQGLTKVAELVKSKPHVVGI  198



>gb|KGN45940.1| hypothetical protein Csa_6G028440 [Cucumis sativus]
Length=539

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+ RWI++ +SG+RVKL CVNW +H + ++ EGL+ +P+  ++ + + + FNCVRLT
Sbjct  26   PLSTHGRWIIDSQSGKRVKLVCVNWPSHTQSMLIEGLNHRPLKELADEAIKLRFNCVRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +   +FT    A+ TV ++F  L L ++ AGL   NP +++  +  AY+AVV  L    +
Sbjct  86   YATHMFTR--YANRTVEENFDLLDLEQAKAGLAQYNPFVLNKTIAEAYEAVVDVLGASGL  143

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+I DNH+S+P WCCS  DGNGFFG+ YFDP+ W+ GL+ VA  FN  S VVGM
Sbjct  144  MVIADNHMSQPRWCCSLDDGNGFFGNRYFDPQEWLQGLSLVAQRFNNKSTVVGM  197



>ref|XP_002509878.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51265.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=521

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = +3

Query  111  AQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            + PLST  RWI++ ++G+RVKLACVNW +H+E ++AEGL +QP+  I   +    FNCVR
Sbjct  27   SMPLSTKGRWIIDTKTGQRVKLACVNWPSHMETMLAEGLHEQPLKRIVALLAKQKFNCVR  86

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+  +++T    ++ TV +SF  L   E+  G+  NNP ++   L  AY+ VV  LA  
Sbjct  87   LTYATYMWTR--YSNRTVSESFNFLP--EAKEGIAKNNPDLLSKTLPQAYETVVDELAAQ  142

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             VM +LDNH+SKP WCCS  DGN FFGD YFD K W+ GLT VAT F G   V+ +
Sbjct  143  GVMTLLDNHVSKPTWCCSETDGNTFFGDTYFDVKEWIQGLTTVATRFRGKPKVMAI  198



>emb|CDY16991.1| BnaC09g41180D [Brassica napus]
Length=495

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 112/180 (62%), Gaps = 29/180 (16%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P  + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKI     
Sbjct  19   PKLITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKI-----  73

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
                                    SF+ L LL+ + G+Q +NP I++LP+  A+Q VV +
Sbjct  74   ------------------------SFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVSN  109

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVGM
Sbjct  110  LGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPIIWTKGLSKMASLFRNVTNVVGM  169



>emb|CDX69431.1| BnaA10g17800D [Brassica napus]
Length=418

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 110/180 (61%), Gaps = 29/180 (16%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKI     
Sbjct  19   PKLTTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKI-----  73

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
                                    SF+ L L + + G+Q +NP I++LP+  A+Q VV +
Sbjct  74   ------------------------SFERLNLFDDVLGIQTHNPKILNLPIFNAFQEVVSN  109

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVGM
Sbjct  110  LGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPAVWAKGLSKMASLFRNVTNVVGM  169



>ref|XP_003621386.1| Endoglucanase E1 [Medicago truncatula]
Length=416

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 113/173 (65%), Gaps = 2/173 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN+RWI++E+G+RVKL CVNW +HL  +VAEGL  +P+  +  ++ ++GF+CVR TW
Sbjct  25   PLSTNNRWIIDETGKRVKLHCVNWSSHLNAMVAEGLEIKPLKDLIAQLKELGFDCVRYTW  84

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
               +FT    ++  V ++   L L  S  G+   NPS+ ++ ++ A+  V+    K  +M
Sbjct  85   ATHMFT--RYSNYKVGENLDKLNLTSSRLGIGNFNPSLENITVVEAFDFVIDEFGKQGMM  142

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +++DNH+S P WCC + DGNGFFGD Y DPK W+ GL+ VA    G S VV +
Sbjct  143  VLVDNHVSDPKWCCHNKDGNGFFGDQYSDPKEWLQGLSNVANRVKGKSQVVAV  195



>ref|XP_004170746.1| PREDICTED: endoglucanase E1-like [Cucumis sativus]
Length=539

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+ RWI++ +SG+RVKL CVNW +H + ++ EGL+ +P+  ++ + + + FNCVRLT
Sbjct  26   PLSTHGRWIIDSQSGKRVKLVCVNWPSHTQSMLIEGLNHRPLKELADEAIKLRFNCVRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +   +FT    A+ TV ++F  L L ++ AGL   N  +++  +  AY+AVV  L    +
Sbjct  86   YATHMFTR--YANRTVEENFDLLDLEQAKAGLAQYNAFVLNKTIAEAYEAVVDVLGASGL  143

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            M+I DNH+S+P WCCS  DGNGFFG+ YFDP+ W+ GL+ VA  FN  S VVGM
Sbjct  144  MVIADNHMSQPRWCCSLDDGNGFFGNRYFDPQEWLQGLSLVAQRFNNKSTVVGM  197



>gb|AES77604.2| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 113/173 (65%), Gaps = 2/173 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN+RWI++E+G+RVKL CVNW +HL  +VAEGL  +P+  +  ++ ++GF+CVR TW
Sbjct  25   PLSTNNRWIIDETGKRVKLHCVNWSSHLNAMVAEGLEIKPLKDLIAQLKELGFDCVRYTW  84

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
               +FT    ++  V ++   L L  S  G+   NPS+ ++ ++ A+  V+    K  +M
Sbjct  85   ATHMFT--RYSNYKVGENLDKLNLTSSRLGIGNFNPSLENITVVEAFDFVIDEFGKQGMM  142

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +++DNH+S P WCC + DGNGFFGD Y DPK W+ GL+ VA    G S VV +
Sbjct  143  VLVDNHVSDPKWCCHNKDGNGFFGDQYSDPKEWLQGLSNVANRVKGKSQVVAV  195



>ref|XP_007159232.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
 gb|ESW31226.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
Length=529

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 117/176 (66%), Gaps = 3/176 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            + PLS   RWI+++ +G RVKL C +WV H + ++AEGL K P++VI+  +   GFNCVR
Sbjct  21   SMPLSVQKRWIIDDATGERVKLHCTHWVVHAQPMLAEGLDKSPLNVIAANVAKAGFNCVR  80

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            L++  ++FT    A+ TVR +F +  + E +  +Q +NPS++++  + AY+AVV +L  +
Sbjct  81   LSYATYMFTRH--ANNTVRDTFHSYDVPEMVTAIQKHNPSVLNMTHLQAYEAVVDALGAH  138

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             VM+++DNH+S P WCC++ D NGFFGD +F+   W+ GL  VA  F G  NV  M
Sbjct  139  GVMVLIDNHLSLPDWCCANDDQNGFFGDRHFNTSEWIQGLAIVAHHFKGKPNVFAM  194



>ref|XP_010916958.1| PREDICTED: uncharacterized protein LOC105041671 [Elaeis guineensis]
Length=485

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 104/146 (71%), Gaps = 0/146 (0%)
 Frame = +3

Query  198  LEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLES  377
            +  V+AEGL KQPVD I+ +I  +GFNCVRLTW  +LFTN+S  +LTV  S  +LGL ++
Sbjct  1    MPAVLAEGLDKQPVDGIAARIAGLGFNCVRLTWATYLFTNESYENLTVSDSLSSLGLGDA  60

Query  378  IAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIY  557
            +AG++ NN  +V + +  AY AVV ++ +  +M++LDNH+S+P WCC + DGNGFFGD+Y
Sbjct  61   LAGVRRNNGRMVGMTVREAYDAVVKAIGEAGLMVVLDNHVSRPQWCCGNADGNGFFGDLY  120

Query  558  FDPKLWVIGLTKVATMFNGTSNVVGM  635
            FDP+ W+ GL  VA  +     VVGM
Sbjct  121  FDPEEWLRGLELVARRYRDIHQVVGM  146



>gb|AES77610.2| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=535

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 111/173 (64%), Gaps = 2/173 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN+RWIV+E+G+RVKL CVNW +H+  +VAEGL   P+  I  ++  +GF+CVR TW
Sbjct  26   PLSTNNRWIVDETGKRVKLHCVNWSSHMNAMVAEGLETIPLKDIITQLKGLGFDCVRYTW  85

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
               +FT    ++  V ++   L L  S  G++  NPS  ++ ++ A+  V+    +  +M
Sbjct  86   ATKMFT--RYSNYKVGENLDKLNLTSSRLGIRFYNPSFENITVVEAFDNVIDEFGRQGMM  143

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ++ DNH+S P WCC + DGNGFFGD YF+P+ W+ GL+ V+    G S VV +
Sbjct  144  VLADNHVSDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVSNRVKGKSQVVAI  196



>ref|XP_003621392.1| Endoglucanase E1 [Medicago truncatula]
Length=534

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 111/173 (64%), Gaps = 2/173 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN+RWIV+E+G+RVKL CVNW +H+  +VAEGL   P+  I  ++  +GF+CVR TW
Sbjct  25   PLSTNNRWIVDETGKRVKLHCVNWSSHMNAMVAEGLETIPLKDIITQLKGLGFDCVRYTW  84

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
               +FT    ++  V ++   L L  S  G++  NPS  ++ ++ A+  V+    +  +M
Sbjct  85   ATKMFT--RYSNYKVGENLDKLNLTSSRLGIRFYNPSFENITVVEAFDNVIDEFGRQGMM  142

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            ++ DNH+S P WCC + DGNGFFGD YF+P+ W+ GL+ V+    G S VV +
Sbjct  143  VLADNHVSDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVSNRVKGKSQVVAI  195



>gb|AFK48266.1| unknown [Lotus japonicus]
Length=197

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 105/167 (63%), Gaps = 3/167 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            A PLST  RWI++ES G+R KL C NW  HL+ ++ EGL ++P+  I  ++V   FNCVR
Sbjct  25   AYPLSTQGRWIIDESTGQRAKLVCANWAGHLQPMIPEGLDRRPLKEIVSELVKHKFNCVR  84

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+ ++++T        V  +F  L + E +AG+  NNPS++ +  I  ++AVV  L   
Sbjct  85   LTYAIYMWTR--YGGHIVSGTFDGLDVPEVVAGIAKNNPSVLKMTHIQVFEAVVHELGAQ  142

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF  608
             V  +LDNH+S+P WCC+  D NGFF D +FDP+ WV GLT  A  F
Sbjct  143  NVKALLDNHVSEPKWCCNDDDENGFFHDRHFDPQEWVQGLTLAAKHF  189



>ref|XP_004158142.1| PREDICTED: uncharacterized LOC101213113 [Cucumis sativus]
Length=400

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 112/171 (65%), Gaps = 3/171 (2%)
 Frame = +3

Query  126  TNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPL  302
            TN RWIV+  +GRRVKL CVNW +H + ++ EGL ++P+  ++ ++V + FNCVRLT+  
Sbjct  29   TNGRWIVDSATGRRVKLVCVNWPSHTQSMLIEGLDRRPLKDLANEVVRLRFNCVRLTYAT  88

Query  303  FLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMII  482
             +FT    A+ TV ++F  L L  +  GL  +NP ++++ +  AY+AVV  L    +M+I
Sbjct  89   HMFT--RYANRTVEENFDLLDLRAAKVGLALHNPFVLNMTIFEAYEAVVDVLGTSGLMVI  146

Query  483  LDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             DNHIS+P WCCS  DGNGFFGD YFD + W+ GL  VA  F   S VV M
Sbjct  147  ADNHISQPRWCCSLEDGNGFFGDRYFDTEEWLEGLRLVARRFYNKSAVVAM  197



>ref|XP_004510834.1| PREDICTED: uncharacterized protein LOC101496378 [Cicer arietinum]
Length=540

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 113/176 (64%), Gaps = 3/176 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            A PLST SRWI+++S   RVKL C NW  HL+ ++ EGL ++P+  +  ++V   FNCVR
Sbjct  27   AYPLSTKSRWIIDDSTSERVKLVCGNWAGHLQPMIPEGLDRRPLKELVGELVQKKFNCVR  86

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+ ++++T        V ++F +L   E++ G+   NP ++ +  I A+ AVV  LA  
Sbjct  87   LTYAIYMWTRH--GHDIVNETFSDLDAPEAVDGIAKYNPFVLKMTHIEAFDAVVNELAAQ  144

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             V ++LDNH+S+P WCC+  DGNGFF D +FDP+ W+ GLT  A  FNG  +VV M
Sbjct  145  NVKVLLDNHVSEPKWCCNDDDGNGFFYDRHFDPQEWIHGLTLAAKHFNGHHHVVAM  200



>ref|XP_002509877.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51264.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=547

 Score =   164 bits (415),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 112/174 (64%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV+ ++G+RVKL C NW +H+E ++AEGL K+P+D I  ++    FNCVR T
Sbjct  22   PLSTNGRWIVDAKTGQRVKLTCANWPSHVESMLAEGLDKKPLDYIIHQLSRNHFNCVRFT  81

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +   ++T    A+ TV ++F +L L ++ AG+   NPS + +  + A+ AVV       V
Sbjct  82   YATHMYTR--YANRTVSETFDSLNLTDAKAGIAKYNPSFLSMTHVQAFDAVVDQFGAQGV  139

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            +++LDN +S+P WCC   DGNGFFGD  FD + W+  L  VA  F G S V+G+
Sbjct  140  LVVLDNQVSRPTWCCGYDDGNGFFGDKDFDAEEWLQALATVADRFKGKSQVIGI  193



>gb|KFK38059.1| hypothetical protein AALP_AA3G064700 [Arabis alpina]
Length=449

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
            MGFNCVR TWPL L TND+LA ++TVRQSF+  GL + + G+  +NPSIVD+PL+ A+QA
Sbjct  1    MGFNCVRFTWPLELMTNDTLAFNVTVRQSFERYGLNQDLNGIHTHNPSIVDIPLVNAFQA  60

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL ++ VM+ILDNH + PGWCCS  D + FFGD  FDP  W++GL K+AT+F    N
Sbjct  61   VVYSLGRHSVMVILDNHKTVPGWCCSKNDPDAFFGDAKFDPDQWILGLRKMATIFRNVKN  120

Query  624  VVGM  635
            V+GM
Sbjct  121  VIGM  124



>ref|XP_004143723.1| PREDICTED: uncharacterized protein LOC101213113 [Cucumis sativus]
Length=539

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 112/171 (65%), Gaps = 3/171 (2%)
 Frame = +3

Query  126  TNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPL  302
            TN RWIV+  +GRRVKL CVNW +H + ++ EGL ++P+  ++ ++V + FNCVRLT+  
Sbjct  29   TNGRWIVDSATGRRVKLVCVNWPSHTQSMLIEGLDRRPLKDLANEVVRLRFNCVRLTYAT  88

Query  303  FLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMII  482
             +FT    A+ TV ++F  L L  +  GL  +NP ++++ +  AY+AVV  L    +M+I
Sbjct  89   HMFT--RYANRTVEENFDLLDLRAAKVGLAFHNPFVLNMTIFEAYEAVVDVLGTSGLMVI  146

Query  483  LDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             DNHIS+P WCCS  DGNGFFGD YFD + W+ GL  VA  F   S VV M
Sbjct  147  ADNHISQPRWCCSLEDGNGFFGDRYFDTEEWLEGLRLVARRFYNKSAVVAM  197



>gb|KEH18775.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=538

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            A PLST+SRWI++++ G RVKL C NW  HL+ ++ EGL ++P+  +  ++V   FNCVR
Sbjct  26   AYPLSTHSRWIIDDTTGERVKLVCGNWAGHLQPMIPEGLDRRPLKELVGELVKNNFNCVR  85

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+ ++++T     +  V  +F +L + E + G+  NNPS++ +  I A+ AVV  L   
Sbjct  86   LTYAIYMWT--RYQNGIVNDTFNDLDVPEIVEGIANNNPSVLKMTHIEAFDAVVKELGDQ  143

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             V ++LDNH+S+P WCC   D NGFF D +FDP+ W+ GLT  A  F G   VV M
Sbjct  144  NVRVLLDNHVSEPKWCCHDDDENGFFHDRHFDPQEWIHGLTLAAKHFEGHHPVVAM  199



>ref|XP_002298005.2| hypothetical protein POPTR_0001s10020g [Populus trichocarpa]
 gb|EEE82810.2| hypothetical protein POPTR_0001s10020g [Populus trichocarpa]
Length=535

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 113/174 (65%), Gaps = 3/174 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PL T  RW+V+E +G RVKL C NW  H+  ++AEGL KQP+  I+ +IV   +NC+R T
Sbjct  27   PLKTQGRWLVDERTGERVKLHCANWPAHVFPMLAEGLDKQPLPFIASEIVKNNYNCIRFT  86

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LT+ +SF  L L ++ AG+  +NP ++ + +  AY+AVV  L  Y +
Sbjct  87   FSIHMFT--RYANLTIEESFDRLNLKKAKAGVIKHNPFVLKMTVPQAYEAVVDVLGSYGI  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            MI  DNHIS+P WCCS+ D NGF  D +FDP+ W+ GL  VA  F G S ++ +
Sbjct  145  MIDADNHISEPIWCCSNDDENGFPNDPHFDPEEWIEGLKLVAQRFKGKSQLISI  198



>ref|XP_007135020.1| hypothetical protein PHAVU_010G095100g [Phaseolus vulgaris]
 gb|ESW07014.1| hypothetical protein PHAVU_010G095100g [Phaseolus vulgaris]
Length=512

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            A PLST +RWI++E +G+R KL C NW  HL+ ++ EGL K+P+  +  ++V   FNCVR
Sbjct  22   AYPLSTQNRWIIDEATGQRAKLVCANWAGHLKPMIPEGLDKRPLKELVGELVKHNFNCVR  81

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+ ++++T  S  +++   SF +L   E + G+  NNPS++ +  + A+ AVV  L   
Sbjct  82   LTYAIYMWTRYSHENVSA--SFASLDAPEVVQGISKNNPSVLSMTHVQAFHAVVHELGVQ  139

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             V ++LDNH+S+P WCC   D NGFF D +F+P+ WV GLT  A  F G   VV M
Sbjct  140  NVKVLLDNHVSEPMWCCDDDDENGFFHDRHFNPQEWVRGLTLAAKHFTGNHAVVAM  195



>ref|XP_008467306.1| PREDICTED: uncharacterized protein LOC103504686 [Cucumis melo]
Length=539

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 111/171 (65%), Gaps = 3/171 (2%)
 Frame = +3

Query  126  TNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPL  302
            TN RWIV+  +G RVKL CVNW +H + ++ EGL ++P+  ++ +++ + FNCVRLT+  
Sbjct  29   TNGRWIVDSATGHRVKLVCVNWPSHTQSMLIEGLDRRPLKDLANEVMRLKFNCVRLTYAT  88

Query  303  FLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMII  482
             +FT    A+ TV ++F  L L  S  GL  +NP ++++ +  AY+AVV  L    +M+I
Sbjct  89   HMFT--RYANRTVEENFDLLDLRASKVGLALHNPFVLNMTIFEAYEAVVDVLGTSGLMVI  146

Query  483  LDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
             DNHIS+P WCCS  DGNGFFGD YFD + W+ GL  VA  F   S VV M
Sbjct  147  ADNHISQPRWCCSLEDGNGFFGDRYFDSEEWLEGLRLVARRFYNKSAVVAM  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125