BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF027M03

Length=656
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783189.1|  PREDICTED: uncharacterized protein LOC104231...    218   4e-63   Nicotiana sylvestris
ref|XP_002265546.1|  PREDICTED: uncharacterized protein LOC100241189    212   6e-61   Vitis vinifera
ref|XP_009631263.1|  PREDICTED: uncharacterized protein LOC104121...    210   2e-60   Nicotiana tomentosiformis
ref|XP_006358105.1|  PREDICTED: uncharacterized protein LOC102598...    210   2e-60   Solanum tuberosum [potatoes]
ref|XP_004233027.1|  PREDICTED: uncharacterized protein LOC101268...    209   4e-60   Solanum lycopersicum
emb|CDO96855.1|  unnamed protein product                                202   3e-58   Coffea canephora [robusta coffee]
ref|XP_002305056.2|  hypothetical protein POPTR_0004s05960g             203   1e-57   
ref|XP_010999785.1|  PREDICTED: uncharacterized protein LOC105107...    201   7e-57   Populus euphratica
emb|CAN69941.1|  hypothetical protein VITISV_006129                     189   1e-55   Vitis vinifera
gb|EYU28114.1|  hypothetical protein MIMGU_mgv1a0046271mg               187   5e-55   Erythranthe guttata [common monkey flower]
ref|XP_007214164.1|  hypothetical protein PRUPE_ppa018961mg             189   8e-53   
ref|XP_006467612.1|  PREDICTED: uncharacterized protein LOC102627312    189   1e-52   Citrus sinensis [apfelsine]
ref|XP_011101423.1|  PREDICTED: uncharacterized protein LOC105179...    187   9e-52   Sesamum indicum [beniseed]
ref|XP_011101425.1|  PREDICTED: uncharacterized protein LOC105179...    187   9e-52   Sesamum indicum [beniseed]
gb|KCW74152.1|  hypothetical protein EUGRSUZ_E02785                     185   1e-51   Eucalyptus grandis [rose gum]
ref|XP_002522251.1|  conserved hypothetical protein                     185   2e-51   
ref|XP_010057126.1|  PREDICTED: uncharacterized protein LOC104445...    184   7e-51   Eucalyptus grandis [rose gum]
ref|XP_008371503.1|  PREDICTED: uncharacterized protein LOC103434908    184   9e-51   
ref|XP_009351587.1|  PREDICTED: uncharacterized protein LOC103943107    182   4e-50   Pyrus x bretschneideri [bai li]
ref|XP_004147385.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    181   9e-50   
ref|XP_004161197.1|  PREDICTED: uncharacterized LOC101203416            181   2e-49   
ref|XP_010106609.1|  hypothetical protein L484_004838                   178   1e-48   
ref|XP_007159482.1|  hypothetical protein PHAVU_002G241100g             178   1e-48   Phaseolus vulgaris [French bean]
gb|AAM19355.1|AF369888_1  UOS1                                          178   2e-48   Pisum sativum [garden pea]
ref|XP_008443516.1|  PREDICTED: uncharacterized protein LOC103487085    177   4e-48   Cucumis melo [Oriental melon]
ref|XP_010242113.1|  PREDICTED: uncharacterized protein LOC104586544    177   5e-48   Nelumbo nucifera [Indian lotus]
ref|XP_006449545.1|  hypothetical protein CICLE_v10018335mg             176   9e-48   
ref|XP_004295588.1|  PREDICTED: uncharacterized protein LOC101314642    176   1e-47   Fragaria vesca subsp. vesca
ref|XP_004504280.1|  PREDICTED: uncharacterized protein LOC101492...    176   1e-47   Cicer arietinum [garbanzo]
gb|KHN48016.1|  hypothetical protein glysoja_015486                     173   4e-47   Glycine soja [wild soybean]
ref|XP_007025317.1|  NAD(P)-binding Rossmann-fold superfamily pro...    174   4e-47   
gb|KHN06420.1|  Putative complex I intermediate-associated protei...    174   5e-47   Glycine soja [wild soybean]
ref|XP_003524972.1|  PREDICTED: uncharacterized protein LOC100500578    174   5e-47   Glycine max [soybeans]
ref|XP_010686245.1|  PREDICTED: uncharacterized protein LOC104900...    174   6e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007025316.1|  NAD(P)-binding Rossmann-fold superfamily pro...    173   9e-47   
ref|XP_007025318.1|  NAD(P)-binding Rossmann-fold superfamily pro...    173   9e-47   
ref|XP_010686246.1|  PREDICTED: uncharacterized protein LOC104900...    173   1e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004147418.1|  PREDICTED: uncharacterized protein LOC101211769    173   1e-46   
ref|XP_008790013.1|  PREDICTED: uncharacterized protein LOC103707...    172   2e-46   Phoenix dactylifera
ref|XP_008790015.1|  PREDICTED: uncharacterized protein LOC103707...    172   3e-46   Phoenix dactylifera
ref|XP_008790014.1|  PREDICTED: uncharacterized protein LOC103707...    172   3e-46   Phoenix dactylifera
ref|XP_009381202.1|  PREDICTED: uncharacterized protein LOC103969413    171   9e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010529212.1|  PREDICTED: uncharacterized protein LOC104806...    170   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_010915482.1|  PREDICTED: uncharacterized protein LOC105040...    170   1e-45   
gb|EPS64358.1|  hypothetical protein M569_10423                         169   1e-45   Genlisea aurea
ref|XP_010915481.1|  PREDICTED: uncharacterized protein LOC105040...    170   1e-45   
gb|KFK28552.1|  hypothetical protein AALP_AA7G011200                    170   1e-45   Arabis alpina [alpine rockcress]
ref|NP_001242339.1|  uncharacterized protein LOC100815475               169   4e-45   
dbj|BAJ33613.1|  unnamed protein product                                163   9e-45   Eutrema halophilum
ref|XP_002867974.1|  transcriptional repressor                          166   4e-44   
ref|XP_010434493.1|  PREDICTED: uncharacterized protein LOC104718...    166   5e-44   
ref|XP_010434492.1|  PREDICTED: uncharacterized protein LOC104718...    165   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_003629826.1|  UOS1                                               165   7e-44   
gb|AET04302.2|  NAD(P)-binding rossmann-fold protein                    165   9e-44   Medicago truncatula
ref|XP_010449465.1|  PREDICTED: uncharacterized protein LOC104731...    164   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010449466.1|  PREDICTED: uncharacterized protein LOC104731...    164   1e-43   
ref|XP_010439809.1|  PREDICTED: uncharacterized protein LOC104723...    164   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010439808.1|  PREDICTED: uncharacterized protein LOC104723...    164   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010449464.1|  PREDICTED: uncharacterized protein LOC104731...    164   2e-43   Camelina sativa [gold-of-pleasure]
emb|CAB37466.1|  putative protein                                       164   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686247.1|  PREDICTED: uncharacterized protein LOC104900...    164   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_193616.2|  NAD(P)-binding Rossmann-fold superfamily protein      164   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190764.1|  NAD(P)-binding Rossmann-fold superfamily pro...    164   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KJB66861.1|  hypothetical protein B456_010G161400                    163   3e-43   Gossypium raimondii
gb|KJB66858.1|  hypothetical protein B456_010G161400                    163   4e-43   Gossypium raimondii
ref|XP_006414054.1|  hypothetical protein EUTSA_v10024714mg             161   1e-42   Eutrema salsugineum [saltwater cress]
ref|XP_006414053.1|  hypothetical protein EUTSA_v10024714mg             161   2e-42   Eutrema salsugineum [saltwater cress]
ref|XP_006830227.1|  hypothetical protein AMTR_s00130p00051210          161   2e-42   Amborella trichopoda
emb|CDX99422.1|  BnaC01g11300D                                          161   2e-42   
ref|XP_004161206.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    160   3e-42   
emb|CDX78897.1|  BnaA01g09640D                                          159   9e-42   
ref|NP_001288965.1|  uncharacterized LOC103856855                       159   9e-42   Brassica rapa
gb|KHG02784.1|  hypothetical protein F383_26204                         158   2e-41   Gossypium arboreum [tree cotton]
ref|XP_006648484.1|  PREDICTED: uncharacterized protein LOC102714621    154   7e-40   
gb|EEC72794.1|  hypothetical protein OsI_06478                          149   4e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001046381.1|  Os02g0234500                                       149   4e-38   
ref|XP_002451838.1|  hypothetical protein SORBIDRAFT_04g008450          146   4e-37   Sorghum bicolor [broomcorn]
ref|XP_003571881.1|  PREDICTED: uncharacterized protein LOC100826457    144   2e-36   Brachypodium distachyon [annual false brome]
gb|EMT20673.1|  hypothetical protein F775_52263                         142   8e-36   
ref|XP_004951358.1|  PREDICTED: uncharacterized protein LOC101762...    142   1e-35   Setaria italica
ref|XP_004951356.1|  PREDICTED: uncharacterized protein LOC101762...    142   1e-35   
gb|EMS56081.1|  putative complex I intermediate-associated protei...    142   5e-35   Triticum urartu
gb|AFW65986.1|  hypothetical protein ZEAMMB73_939804                    138   1e-34   
gb|AFW65985.1|  hypothetical protein ZEAMMB73_939804                    138   2e-34   
ref|XP_008679815.1|  PREDICTED: uncharacterized protein LOC103654777    137   4e-34   Zea mays [maize]
gb|AFW65984.1|  hypothetical protein ZEAMMB73_939804                    137   4e-34   
gb|ABR17731.1|  unknown                                                 136   1e-33   Picea sitchensis
gb|ACN39869.1|  unknown                                                 136   1e-33   Picea sitchensis
ref|XP_006283353.1|  hypothetical protein CARUB_v10004397mg             134   1e-32   
ref|XP_009783190.1|  PREDICTED: uncharacterized protein LOC104231...    131   5e-32   Nicotiana sylvestris
ref|XP_009631270.1|  PREDICTED: uncharacterized protein LOC104121...    125   8e-30   Nicotiana tomentosiformis
gb|EYU28115.1|  hypothetical protein MIMGU_mgv1a0046271mg               117   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_010316841.1|  PREDICTED: uncharacterized protein LOC101268...    121   2e-28   Solanum lycopersicum
ref|XP_006358109.1|  PREDICTED: uncharacterized protein LOC102598...    120   4e-28   Solanum tuberosum [potatoes]
ref|XP_010999786.1|  PREDICTED: uncharacterized protein LOC105107...    117   7e-27   Populus euphratica
ref|XP_010316842.1|  PREDICTED: uncharacterized protein LOC101268...    113   8e-26   Solanum lycopersicum
ref|XP_001752746.1|  predicted protein                                  114   1e-25   
ref|XP_011101430.1|  PREDICTED: uncharacterized protein LOC105179...    114   1e-25   Sesamum indicum [beniseed]
ref|XP_011101427.1|  PREDICTED: uncharacterized protein LOC105179...    114   2e-25   Sesamum indicum [beniseed]
ref|XP_011101428.1|  PREDICTED: uncharacterized protein LOC105179...    113   2e-25   
ref|XP_011101426.1|  PREDICTED: uncharacterized protein LOC105179...    113   2e-25   
ref|XP_011101429.1|  PREDICTED: uncharacterized protein LOC105179...    113   2e-25   Sesamum indicum [beniseed]
ref|XP_011101431.1|  PREDICTED: uncharacterized protein LOC105179...    113   2e-25   Sesamum indicum [beniseed]
ref|XP_011101432.1|  PREDICTED: uncharacterized protein LOC105179...    110   7e-25   
ref|XP_002976078.1|  hypothetical protein SELMODRAFT_175261             111   1e-24   Selaginella moellendorffii
gb|KDP21131.1|  hypothetical protein JCGZ_21602                         108   3e-24   Jatropha curcas
ref|XP_008225254.1|  PREDICTED: uncharacterized protein LOC103324919    106   9e-24   Prunus mume [ume]
ref|XP_010529213.1|  PREDICTED: uncharacterized protein LOC104806...    106   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_003606736.1|  UOS1                                               104   6e-23   
ref|XP_003629827.1|  UOS1                                               104   1e-22   Medicago truncatula
ref|XP_004504281.1|  PREDICTED: uncharacterized protein LOC101492...    103   4e-22   Cicer arietinum [garbanzo]
ref|XP_004951357.1|  PREDICTED: uncharacterized protein LOC101762...  99.0    3e-20   
gb|KJB66859.1|  hypothetical protein B456_010G161400                  94.4    8e-19   Gossypium raimondii
ref|XP_002968299.1|  hypothetical protein SELMODRAFT_170011           84.3    2e-15   
gb|AFW65982.1|  hypothetical protein ZEAMMB73_939804                  78.2    1e-14   
ref|XP_001700919.1|  protein with predicted nucleoside-diphosphat...  81.6    2e-14   Chlamydomonas reinhardtii
ref|XP_002949080.1|  hypothetical protein VOLCADRAFT_89408            80.1    9e-14   Volvox carteri f. nagariensis
ref|WP_035150436.1|  NADH:ubiquinone oxidoreductase                   77.4    5e-13   Calothrix sp. 336/3
ref|WP_011319070.1|  hypothetical protein                             74.3    6e-12   Trichormus variabilis
ref|WP_010999152.1|  hypothetical protein                             73.2    1e-11   Nostocaceae
ref|WP_037224336.1|  NADH:ubiquinone oxidoreductase                   72.8    2e-11   
ref|WP_015131038.1|  NADH:ubiquinone oxidoreductase complex I int...  71.6    4e-11   Calothrix sp. PCC 7507
ref|WP_016878104.1|  NADH:ubiquinone oxidoreductase complex I int...  70.9    6e-11   Chlorogloeopsis fritschii
ref|WP_015141536.1|  NmrA-like family protein                         70.1    1e-10   Nostoc sp. PCC 7524
ref|WP_017323313.1|  NADH:ubiquinone oxidoreductase complex I int...  70.1    1e-10   cyanobacterium PCC 7702
ref|WP_017651686.1|  NADH:ubiquinone oxidoreductase complex I int...  69.7    2e-10   Fortiea contorta
ref|WP_039716664.1|  NADH:ubiquinone oxidoreductase                   68.9    3e-10   
gb|KIE07000.1|  NADH:ubiquinone oxidoreductase                        68.6    4e-10   Tolypothrix bouteillei VB521301
ref|WP_015113169.1|  NADH:ubiquinone oxidoreductase complex I int...  68.2    5e-10   Nostoc sp. PCC 7107
ref|WP_015200706.1|  NADH:ubiquinone oxidoreductase complex I int...  68.2    6e-10   Calothrix parietina
ref|WP_006196301.1|  hypothetical protein                             67.4    9e-10   Nodularia spumigena
ref|WP_027845680.1|  NADH:ubiquinone oxidoreductase                   67.4    1e-09   Mastigocoleus testarum
ref|WP_017747824.1|  NADH:ubiquinone oxidoreductase complex I int...  67.0    1e-09   Scytonema hofmannii
ref|WP_041032572.1|  NADH:ubiquinone oxidoreductase                   67.0    1e-09   Tolypothrix campylonemoides
ref|WP_026735574.1|  NADH:ubiquinone oxidoreductase                   67.0    1e-09   Fischerella sp. PCC 9605
ref|WP_008274624.1|  hypothetical protein                             67.0    1e-09   Cyanothece sp. CCY0110
ref|WP_007304974.1|  similar to nucleoside-diphosphate-sugar epim...  66.6    2e-09   Crocosphaera watsonii
ref|WP_009633206.1|  NmrA-like family protein                         66.6    2e-09   Synechocystis sp. PCC 7509
ref|WP_021832890.1|  similar to nucleoside-diphosphate-sugar epim...  66.6    2e-09   Crocosphaera watsonii
ref|WP_007309137.1|  hypothetical Transposase-like protein, IS200...  66.2    2e-09   Crocosphaera watsonii
ref|XP_010057127.1|  PREDICTED: uncharacterized protein LOC104445...  66.2    2e-09   Eucalyptus grandis [rose gum]
ref|WP_015154354.1|  NADH:ubiquinone oxidoreductase complex I int...  66.2    3e-09   Chroococcidiopsis thermalis
ref|WP_015078922.1|  hypothetical protein                             66.2    3e-09   Anabaena sp. 90
ref|WP_012412749.1|  NADH:ubiquinone oxidoreductase complex I int...  65.5    4e-09   Nostoc punctiforme
ref|XP_006283354.1|  hypothetical protein CARUB_v10004397mg           65.1    5e-09   
ref|WP_015205483.1|  NADH:ubiquinone oxidoreductase complex I int...  65.1    5e-09   Crinalium epipsammum
ref|WP_028090688.1|  NADH:ubiquinone oxidoreductase                   65.1    6e-09   Dolichospermum circinale
ref|WP_027401452.1|  NADH:ubiquinone oxidoreductase                   64.3    1e-08   Aphanizomenon flos-aquae
ref|WP_009545319.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  64.3    1e-08   Cyanothece
ref|WP_015206966.1|  NmrA-like family protein                         63.5    2e-08   Cylindrospermum stagnale
gb|EFA71480.1|  hypothetical protein CRC_00684                        60.8    2e-08   Cylindrospermopsis raciborskii CS-505
ref|WP_017659907.1|  hypothetical protein                             63.2    2e-08   Geitlerinema sp. PCC 7105
ref|WP_015216704.1|  NADH:ubiquinone oxidoreductase complex I int...  63.2    2e-08   Anabaena cylindrica
ref|WP_015189798.1|  NADH:ubiquinone oxidoreductase complex I int...  63.2    3e-08   Gloeocapsa sp. PCC 7428
ref|WP_008183365.1|  complex I intermediate-associated protein, N...  62.8    3e-08   Moorea producens
ref|WP_009457802.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  62.4    4e-08   Fischerella thermalis
ref|WP_026721354.1|  NADH:ubiquinone oxidoreductase                   62.4    4e-08   Fischerella sp. PCC 9431
gb|KIJ84806.1|  NADH:ubiquinone oxidoreductase                        62.4    5e-08   Scytonema tolypothrichoides VB-61278
ref|WP_015116675.1|  NmrA-like family protein                         62.4    5e-08   Rivularia sp. PCC 7116
ref|WP_017312960.1|  NADH:ubiquinone oxidoreductase complex I int...  62.0    5e-08   Fischerella sp. PCC 9339
ref|WP_013192562.1|  NADH:ubiquinone oxidoreductase complex I int...  61.6    9e-08   Trichormus azollae
ref|WP_028084600.1|  NADH:ubiquinone oxidoreductase                   61.2    1e-07   Dolichospermum circinale
ref|WP_016864210.1|  NADH:ubiquinone oxidoreductase complex I int...  61.2    1e-07   Fischerella muscicola
ref|WP_017318111.1|  NADH:ubiquinone oxidoreductase complex I int...  60.8    1e-07   Mastigocladopsis repens
ref|WP_044446747.1|  NADH:ubiquinone oxidoreductase                   60.8    1e-07   Mastigocladus laminosus
ref|WP_015176136.1|  NADH:ubiquinone oxidoreductase complex I int...  60.5    2e-07   Oscillatoria nigro-viridis
ref|WP_012626990.1|  NADH:ubiquinone oxidoreductase complex I int...  60.1    2e-07   Cyanothece sp. PCC 7425
ref|WP_019492893.1|  NADH:ubiquinone oxidoreductase complex I int...  60.1    2e-07   Calothrix sp. PCC 7103
gb|AFZ51428.1|  NAD dependent epimerase/dehydratase family protein    60.1    3e-07   Dactylococcopsis salina PCC 8305
ref|WP_009782432.1|  hypothetical protein                             59.7    3e-07   Lyngbya sp. PCC 8106
ref|WP_006634404.1|  NADH:ubiquinone oxidoreductase complex I int...  59.7    4e-07   Microcoleus vaginatus
ref|WP_009344296.1|  hypothetical protein                             59.3    5e-07   Raphidiopsis brookii
ref|WP_016866205.1|  NADH:ubiquinone oxidoreductase complex I int...  58.9    6e-07   Fischerella muscicola
ref|WP_015180824.1|  NmrA-like family protein                         58.5    8e-07   Microcoleus sp. PCC 7113
ref|WP_006104868.1|  Complex I intermediate-associated protein 30     58.2    1e-06   Coleofasciculus chthonoplastes
ref|WP_012599050.1|  NADH:ubiquinone oxidoreductase complex I int...  58.2    1e-06   Cyanothece sp. PCC 7424
ref|WP_015783548.1|  NADH:ubiquinone oxidoreductase complex I int...  57.8    1e-06   Cyanothece sp. PCC 8802
ref|WP_012594575.1|  NADH:ubiquinone oxidoreductase complex I int...  57.8    1e-06   Cyanothece sp. PCC 8801
ref|WP_015146863.1|  NmrA-like family protein                         57.8    2e-06   Oscillatoria acuminata
ref|WP_015224203.1|  NADH:ubiquinone oxidoreductase complex I int...  57.0    3e-06   Halothece sp. PCC 7418
ref|WP_006623969.1|  MULTISPECIES: NmrA-like protein                  56.6    4e-06   Arthrospira
ref|WP_026098965.1|  NADH:ubiquinone oxidoreductase                   56.6    4e-06   Oscillatoria sp. PCC 10802
ref|WP_042154417.1|  NADH:ubiquinone oxidoreductase                   56.2    4e-06   Planktothrix agardhii
ref|WP_027250028.1|  NADH:ubiquinone oxidoreductase                   56.2    4e-06   Planktothrix agardhii
ref|WP_041235904.1|  NADH:ubiquinone oxidoreductase                   56.2    6e-06   
ref|WP_015143937.1|  NmrA-like family protein                         55.8    7e-06   Pleurocapsa minor
ref|WP_044137683.1|  NADH:ubiquinone oxidoreductase                   55.5    9e-06   Trichodesmium erythraeum
ref|WP_006618043.1|  NmrA-like protein                                55.5    9e-06   Arthrospira platensis
gb|ABG52549.1|  NmrA-like                                             55.5    9e-06   Trichodesmium erythraeum IMS101
ref|WP_026795424.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase     55.5    9e-06   Planktothrix
ref|WP_013325168.1|  NADH:ubiquinone oxidoreductase complex I int...  55.1    1e-05   Cyanothece sp. PCC 7822
ref|WP_002792198.1|  hypothetical protein                             54.7    1e-05   Microcystis aeruginosa
ref|WP_002767146.1|  hypothetical protein                             54.7    2e-05   Microcystis aeruginosa
ref|WP_008198923.1|  hypothetical protein                             53.9    2e-05   Microcystis
ref|WP_027255199.1|  NADH:ubiquinone oxidoreductase                   54.3    3e-05   Planktothrix agardhii
ref|WP_026796563.1|  NADH:ubiquinone oxidoreductase                   54.3    3e-05   Planktothrix
ref|WP_026787787.1|  NADH:ubiquinone oxidoreductase                   53.9    3e-05   Planktothrix rubescens
ref|WP_007356111.1|  MULTISPECIES: NmrA-like                          53.9    3e-05   Kamptonema
gb|EWM29347.1|  nadh:ubiquinone oxidoreductase complex i intermed...  53.5    5e-05   Nannochloropsis gaditana
ref|WP_002732100.1|  complex I intermediate-associated 30 family ...  52.8    6e-05   Microcystis aeruginosa
ref|WP_015194049.1|  NADH:ubiquinone oxidoreductase complex I int...  53.1    6e-05   Stanieria cyanosphaera
ref|WP_023067525.1|  short chain dehydrogenase family protein         53.1    6e-05   Lyngbya aestuarii
ref|WP_016517314.1|  Complex I intermediate-associated protein 30...  52.8    7e-05   Microcystis aeruginosa
ref|WP_002775482.1|  hypothetical protein                             52.8    7e-05   Microcystis aeruginosa
gb|AHJ26864.1|  hypothetical protein NSP_5140                         52.8    7e-05   Nodularia spumigena CCY9414
ref|WP_004158103.1|  hypothetical protein                             52.4    8e-05   Microcystis aeruginosa
ref|WP_039754165.1|  NADH:ubiquinone oxidoreductase                   52.4    1e-04   
ref|XP_005855477.1|  nadh:ubiquinone oxidoreductase complex i int...  52.0    2e-04   Nannochloropsis gaditana CCMP526
ref|XP_002982038.1|  hypothetical protein SELMODRAFT_445069           51.2    2e-04   
ref|XP_002966481.1|  hypothetical protein SELMODRAFT_439518           51.2    2e-04   
ref|WP_006530839.1|  NmrA-like family protein                         50.8    3e-04   Gloeocapsa sp. PCC 73106
ref|XP_005709172.1|  hypothetical protein Gasu_00240                  50.4    5e-04   Galdieria sulphuraria
ref|WP_040943935.1|  NADH:ubiquinone oxidoreductase                   49.7    7e-04   



>ref|XP_009783189.1| PREDICTED: uncharacterized protein LOC104231828 isoform X1 [Nicotiana 
sylvestris]
Length=601

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 156/206 (76%), Gaps = 6/206 (3%)
 Frame = +2

Query  50   CFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpC---HQLKIKAQPFLRKQ  220
            C+  V K   S SA+LNF+G SSVGV  S+KSL         C    +   K Q  + ++
Sbjct  4    CYFAVTKPSSSSSAILNFQGVSSVGVRSSQKSLRATPSQL--CWPFSRPNKKYQNLVYRR  61

Query  221  SPLHLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKP  397
            +  +LSF T+KGP  A++G+Q WD GRFL TLY+FNGPPSP+KFFE LIEKL+GPSPS P
Sbjct  62   TSQNLSFKTFKGPILAEAGKQGWDLGRFLETLYFFNGPPSPAKFFESLIEKLTGPSPSTP  121

Query  398  VKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDIT  577
            V SMDSSGI LV GATGGVGRRVVD+LR+K L VR LVRNEEKAR+M GEDVDL+VGD+T
Sbjct  122  VNSMDSSGITLVTGATGGVGRRVVDVLRNKRLHVRVLVRNEEKARRMLGEDVDLVVGDVT  181

Query  578  KASTLLPEYFKGVRKVINAVSVIXGP  655
            K++TLLPEYFKGV  VINAVSVI GP
Sbjct  182  KSNTLLPEYFKGVTSVINAVSVIVGP  207



>ref|XP_002265546.1| PREDICTED: uncharacterized protein LOC100241189 [Vitis vinifera]
 emb|CBI30719.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 158/210 (75%), Gaps = 6/210 (3%)
 Frame = +2

Query  44   MECFCGVNK-TLPSCSAVLNFRGFSS-VGVGYSEksllppfplskpCH---QLKIKAQPF  208
            M+CFC   K      S++LN R  SS VG  +S+K L P    S       QL  +  PF
Sbjct  1    MDCFCCSTKLPSSPSSSILNQRASSSPVGGRFSKKVLRPGLLSSPHSEPFIQLNDRLNPF  60

Query  209  LRKQSPLHLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPS  385
              ++   + S  TYKGP +A++ +Q WD GRFLSTLY+FNGPPSP+KFFEFLIEKLSGP+
Sbjct  61   AYQRRSSNFSLRTYKGPIYAEAKKQAWDLGRFLSTLYFFNGPPSPAKFFEFLIEKLSGPT  120

Query  386  PSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIV  565
            PS+P K+M++SGI+LVAGATGGVGRRVVDILR KGL VR LVRNEEKARKM G D+DLIV
Sbjct  121  PSEPEKAMETSGIVLVAGATGGVGRRVVDILRKKGLPVRVLVRNEEKARKMLGPDIDLIV  180

Query  566  GDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            GDITK STL+PEYFKGVRKVINAVSVI GP
Sbjct  181  GDITKESTLVPEYFKGVRKVINAVSVIVGP  210



>ref|XP_009631263.1| PREDICTED: uncharacterized protein LOC104121071 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631268.1| PREDICTED: uncharacterized protein LOC104121071 isoform X1 [Nicotiana 
tomentosiformis]
Length=602

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 157/207 (76%), Gaps = 7/207 (3%)
 Frame = +2

Query  50   CFCGVNK-TLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQL---KIKAQPFLRK  217
            C+  V K +  S SA+LNF+G SSVGV  S+KSL         C  L     K Q F+ +
Sbjct  4    CYFAVTKPSSSSSSAILNFQGVSSVGVRSSQKSLRAAPSQL--CWPLSRPNKKYQNFVYR  61

Query  218  QSPLHLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSK  394
            ++  +LSF T+KGP  A++G+Q WD GRF+ TLY+FNGPPSP+KFFE LIEKL+GPSPS 
Sbjct  62   RTSQNLSFKTFKGPILAEAGKQGWDLGRFIETLYFFNGPPSPAKFFESLIEKLTGPSPST  121

Query  395  PVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDI  574
            PV SMDSSGI LV GATGGVGRRVVD+LR+K L VR LVRNEEKAR+M G DVDL+VGD+
Sbjct  122  PVNSMDSSGITLVTGATGGVGRRVVDVLRNKRLPVRILVRNEEKARRMLGADVDLVVGDV  181

Query  575  TKASTLLPEYFKGVRKVINAVSVIXGP  655
            TK+STLLPEYFKGV  VINAVSVI GP
Sbjct  182  TKSSTLLPEYFKGVTSVINAVSVIVGP  208



>ref|XP_006358105.1| PREDICTED: uncharacterized protein LOC102598210 isoform X1 [Solanum 
tuberosum]
 ref|XP_006358106.1| PREDICTED: uncharacterized protein LOC102598210 isoform X2 [Solanum 
tuberosum]
 ref|XP_006358107.1| PREDICTED: uncharacterized protein LOC102598210 isoform X3 [Solanum 
tuberosum]
 ref|XP_006358108.1| PREDICTED: uncharacterized protein LOC102598210 isoform X4 [Solanum 
tuberosum]
Length=593

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 154/203 (76%), Gaps = 8/203 (4%)
 Frame = +2

Query  50   CFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKAQPFLRKQSPL  229
            C+  V K   S S +LNF+G SS G   S+KSL  P  LS P  + + K Q F+ +Q   
Sbjct  4    CYFTVTKPSSSSSTILNFQGVSSFGGRSSQKSLGAPSYLSWPLSRPEKKHQNFVYRQK--  61

Query  230  HLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKS  406
                 T+KG   A++G+Q WDFGRF+ TLY+FNGPPSP+KFFE LIEKL+GPSPSKPV S
Sbjct  62   -----TFKGAILAEAGKQGWDFGRFIKTLYFFNGPPSPAKFFESLIEKLTGPSPSKPVNS  116

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            MDSSGI LV GATGGVGRRVVD+LR+K LSVR LVRNEEKAR+M GEDVDL+VGD+TKAS
Sbjct  117  MDSSGITLVTGATGGVGRRVVDVLRNKKLSVRVLVRNEEKARRMLGEDVDLVVGDVTKAS  176

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TLLPEYFKGV  VINAVS I GP
Sbjct  177  TLLPEYFKGVTSVINAVSAIVGP  199



>ref|XP_004233027.1| PREDICTED: uncharacterized protein LOC101268540 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010316840.1| PREDICTED: uncharacterized protein LOC101268540 isoform X1 [Solanum 
lycopersicum]
Length=592

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 156/203 (77%), Gaps = 9/203 (4%)
 Frame = +2

Query  50   CFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKAQPFLRKQSPL  229
            C+  V K   S S +LNF+G SS+G   S+KSL  P  LS P      K+Q F+ ++   
Sbjct  4    CYFSVTKP-SSSSTILNFQGVSSLGGRSSQKSLGAPSHLSWPLSGPNKKSQNFVYRRK--  60

Query  230  HLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKS  406
                 T+KGP  A++G+Q WDFGRF+ TLY+FNGPPSP+KFFE LIEKL+GPSPSKPV S
Sbjct  61   -----TFKGPILAEAGKQGWDFGRFIKTLYFFNGPPSPAKFFESLIEKLTGPSPSKPVNS  115

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            MDSSGI LV GATGGVGRRVVD+LR+K LSVR LVRNEEKAR+M GEDVDL+VGD+TKAS
Sbjct  116  MDSSGITLVTGATGGVGRRVVDVLRNKKLSVRVLVRNEEKARRMLGEDVDLVVGDVTKAS  175

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TLLPEYFKG+  VINAVSVI GP
Sbjct  176  TLLPEYFKGITSVINAVSVIVGP  198



>emb|CDO96855.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 151/214 (71%), Gaps = 7/214 (3%)
 Frame = +2

Query  35   CEKMECFCGVNKTLPSCSA--VLNFRGFSSVGVGYS-EksllppfplskpCHQ---LKIK  196
            CE M+C C      PS S   VLNF+  S+V   +S +       P    C Q   L  +
Sbjct  83   CEIMDCNCCYTLARPSSSITPVLNFQSVSAVNRNFSVKNLHPRVLPSPGSCRQFGRLSDQ  142

Query  197  AQPFLRKQSPLHLSFTTYKGPFA-QSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKL  373
             +PF+ + +       TY+G  + ++ +Q WDFGRFL TLY+FNGPPSP+KFFEFLIEKL
Sbjct  143  FRPFIYQGNSELPCLRTYRGQISSEARRQGWDFGRFLKTLYFFNGPPSPAKFFEFLIEKL  202

Query  374  SGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDV  553
            S PSPSK    MD SG+ILVAGATGGVGRRV DILRSKG +V+ LVRNE+KAR+M G DV
Sbjct  203  SNPSPSKTENRMDPSGVILVAGATGGVGRRVFDILRSKGYTVKVLVRNEDKARRMLGPDV  262

Query  554  DLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            DLIVGDITKASTL+PEYFKGVRKVINAVSVI GP
Sbjct  263  DLIVGDITKASTLVPEYFKGVRKVINAVSVIVGP  296



>ref|XP_002305056.2| hypothetical protein POPTR_0004s05960g [Populus trichocarpa]
 gb|EEE85567.2| hypothetical protein POPTR_0004s05960g [Populus trichocarpa]
Length=599

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 147/212 (69%), Gaps = 17/212 (8%)
 Frame = +2

Query  44   MECFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKA---QPFLR  214
            MECF     + P  S++LN +G SS+         +         H   + +   +PF +
Sbjct  1    MECFNSTKLSSPCTSSILNLQGSSSL---------VCNKFSKNSVHPWLLSSPPPKPFFQ  51

Query  215  KQSPLHL----SFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG  379
                L      +  TY+GP  A++G+Q WD GRFL TLY+FNGPPSPSKFFEFLIEKLS 
Sbjct  52   LDDRLQCRQKSAHRTYRGPILAEAGKQGWDLGRFLKTLYFFNGPPSPSKFFEFLIEKLSS  111

Query  380  PSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDL  559
            PSPS+P KSM+SSGI+LV GATGGVGRRVVD+L+ KGL VR L RNEEKARKM G D+DL
Sbjct  112  PSPSEPKKSMESSGIVLVVGATGGVGRRVVDVLQKKGLPVRVLARNEEKARKMLGPDIDL  171

Query  560  IVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            I+GDITK STLLPEYFKGVRKVINA SVI GP
Sbjct  172  IIGDITKESTLLPEYFKGVRKVINAASVIVGP  203



>ref|XP_010999785.1| PREDICTED: uncharacterized protein LOC105107529 isoform X1 [Populus 
euphratica]
Length=598

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 146/212 (69%), Gaps = 17/212 (8%)
 Frame = +2

Query  44   MECFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKA---QPFLR  214
            MECF       P  S++LN +G SS+         +         H   + +   +PF +
Sbjct  1    MECFNPTKLCSPCTSSILNLQGSSSL---------VCNKFSKNSVHPWLLSSPPPKPFFQ  51

Query  215  KQSPLHL----SFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG  379
                L      +  TY+GP  A++G+Q WD GRFL TLY+FNGPPSP+KFFEFLIEKLS 
Sbjct  52   LDDRLQFRQKSAHRTYRGPILAEAGKQGWDLGRFLKTLYFFNGPPSPTKFFEFLIEKLSS  111

Query  380  PSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDL  559
            PSPS+P KSM+SSGI+LV GATGGVGRRVVD+L+ KGL VR L RNEEKARKM G D+DL
Sbjct  112  PSPSEPKKSMESSGIVLVVGATGGVGRRVVDVLQKKGLPVRVLARNEEKARKMLGPDIDL  171

Query  560  IVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            I+GDITK STLLPEYFKGVRKVINA SVI GP
Sbjct  172  IIGDITKESTLLPEYFKGVRKVINAASVIVGP  203



>emb|CAN69941.1| hypothetical protein VITISV_006129 [Vitis vinifera]
Length=243

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 128/159 (81%), Gaps = 8/159 (5%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  +  PF  ++   + S  TYKGP +A++ +Q WD GRFL TLY+FNGPPSP+KFFEF
Sbjct  58   QLNDRLNPFAYQRRSSNFSLRTYKGPIYAEAKKQAWDXGRFLXTLYFFNGPPSPAKFFEF  117

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            LIEKLSGP+PS+PVK+M++SGI+LVAGATGGVGRRVVDILR KGL VR LVRNEEKARKM
Sbjct  118  LIEKLSGPTPSEPVKAMETSGIVLVAGATGGVGRRVVDILRKKGLPVRVLVRNEEKARKM  177

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+DL        STL+PEYFKGVRKVINAVSVI GP
Sbjct  178  LGPDIDL-------ESTLVPEYFKGVRKVINAVSVIVGP  209



>gb|EYU28114.1| hypothetical protein MIMGU_mgv1a0046271mg, partial [Erythranthe 
guttata]
Length=257

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvaga  442
            A++ +Q WD GRFL TLY+FNGPPSP+K FEFLIEKLSG SPS+PVK+MD+SG+ILVAGA
Sbjct  69   AEAEKQGWDVGRFLKTLYFFNGPPSPAKLFEFLIEKLSGTSPSEPVKAMDNSGVILVAGA  128

Query  443  tggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRK  622
            TGGVGRRVVD+LR  G SVR LVRNEEKA++M G DVDLIVGDITKASTLLPEYFKGVR 
Sbjct  129  TGGVGRRVVDLLRKNGRSVRVLVRNEEKAKRMLGPDVDLIVGDITKASTLLPEYFKGVRM  188

Query  623  VINAVSVIXGP  655
            VINAVSVI GP
Sbjct  189  VINAVSVIVGP  199



>ref|XP_007214164.1| hypothetical protein PRUPE_ppa018961mg, partial [Prunus persica]
 gb|EMJ15363.1| hypothetical protein PRUPE_ppa018961mg, partial [Prunus persica]
Length=592

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  +   F  +Q+  HLS  TY+    A++G+Q WD GRFL T+++FN PP+P+KFFEF
Sbjct  30   QLNDRPHSFPYQQNSDHLSPRTYRRSISAEAGKQSWDLGRFLKTIFFFNEPPTPAKFFEF  89

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            + EKLS PSPSKP K M++SGI+LVAGATGGVGRRVVD+LR KGL VR LVRNEEKARKM
Sbjct  90   VSEKLSSPSPSKPEKKMETSGIVLVAGATGGVGRRVVDVLRKKGLPVRVLVRNEEKARKM  149

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G DVDLIVGDITK STL+PEYFKGVR+VINAVSVI GP
Sbjct  150  LGPDVDLIVGDITKESTLVPEYFKGVRRVINAVSVIVGP  188



>ref|XP_006467612.1| PREDICTED: uncharacterized protein LOC102627312 [Citrus sinensis]
 gb|KDO77910.1| hypothetical protein CISIN_1g047192mg [Citrus sinensis]
Length=600

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 142/208 (68%), Gaps = 7/208 (3%)
 Frame = +2

Query  44   MECFCGVNKTL----PSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKAQPFL  211
            ME  C     L    PS   + + RGF       S    L    L KP  Q+      FL
Sbjct  1    MESCCSTCTKLSSASPSHPCIADSRGFGRKFTRNSLDHHLLSSSLPKPFLQVNNARNTFL  60

Query  212  RKQSPLHLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPS  391
             ++S      T  +G  +    + WDFGRFL TLY+FNGPPSP+KF EFL+EKLSGPSP 
Sbjct  61   YRRSSSRFPSTASRGIISA---EAWDFGRFLKTLYFFNGPPSPAKFVEFLVEKLSGPSPK  117

Query  392  KPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGD  571
            +PVK+M++SGI+LVAGATGGVGRRVVDILR+KGL VR LVRNEEKARKM G DVDLIVGD
Sbjct  118  EPVKAMETSGIVLVAGATGGVGRRVVDILRNKGLPVRVLVRNEEKARKMLGPDVDLIVGD  177

Query  572  ITKASTLLPEYFKGVRKVINAVSVIXGP  655
            ITK +TL PEYFKGVRKVINAVSVI GP
Sbjct  178  ITKENTLTPEYFKGVRKVINAVSVIVGP  205



>ref|XP_011101423.1| PREDICTED: uncharacterized protein LOC105179488 isoform X1 [Sesamum 
indicum]
Length=588

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 129/158 (82%), Gaps = 1/158 (1%)
 Frame = +2

Query  185  LKIKAQPFLRKQSPLHLSFTTYKG-PFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            L  K QP + ++     S  T++G   +++G+Q WD GRFL TLY+FNGPPSP+KFF+ L
Sbjct  36   LPCKFQPLVYQKKLSFHSLRTHRGLILSEAGRQGWDVGRFLKTLYFFNGPPSPAKFFQNL  95

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
            IEKLSGPSPS+  K+MD+S IILVAGATGGVGRRVVD+LR KGL VR LVRNEEKAR+M 
Sbjct  96   IEKLSGPSPSEAEKAMDTSRIILVAGATGGVGRRVVDLLRKKGLPVRVLVRNEEKARRML  155

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            G DVDLIVGDITKASTL+PEYFKGVR V+NAVSVI GP
Sbjct  156  GPDVDLIVGDITKASTLIPEYFKGVRMVVNAVSVIVGP  193



>ref|XP_011101425.1| PREDICTED: uncharacterized protein LOC105179488 isoform X2 [Sesamum 
indicum]
Length=583

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 129/158 (82%), Gaps = 1/158 (1%)
 Frame = +2

Query  185  LKIKAQPFLRKQSPLHLSFTTYKG-PFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            L  K QP + ++     S  T++G   +++G+Q WD GRFL TLY+FNGPPSP+KFF+ L
Sbjct  31   LPCKFQPLVYQKKLSFHSLRTHRGLILSEAGRQGWDVGRFLKTLYFFNGPPSPAKFFQNL  90

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
            IEKLSGPSPS+  K+MD+S IILVAGATGGVGRRVVD+LR KGL VR LVRNEEKAR+M 
Sbjct  91   IEKLSGPSPSEAEKAMDTSRIILVAGATGGVGRRVVDLLRKKGLPVRVLVRNEEKARRML  150

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            G DVDLIVGDITKASTL+PEYFKGVR V+NAVSVI GP
Sbjct  151  GPDVDLIVGDITKASTLIPEYFKGVRMVVNAVSVIVGP  188



>gb|KCW74152.1| hypothetical protein EUGRSUZ_E02785 [Eucalyptus grandis]
Length=480

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = +2

Query  245  TYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSG  421
            +Y+GP  A++G+Q WDFGRFL T+Y+F GPPSPSKF EF+IEKLSGP+PS+  K M+SSG
Sbjct  58   SYRGPISAEAGKQGWDFGRFLKTIYFFQGPPSPSKFIEFIIEKLSGPAPSELPKRMESSG  117

Query  422  IILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPE  601
            I+LVAGATGGVGRRVVDILR KGL VR LVRNEEKAR+M G DVDL+VGDITK STL PE
Sbjct  118  IVLVAGATGGVGRRVVDILRKKGLRVRVLVRNEEKARRMLGPDVDLVVGDITKESTLAPE  177

Query  602  YFKGVRKVINAVSVIXGP  655
             F+GVRKVINAVSVI GP
Sbjct  178  NFRGVRKVINAVSVIVGP  195



>ref|XP_002522251.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40109.1| conserved hypothetical protein [Ricinus communis]
Length=530

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 123/151 (81%), Gaps = 3/151 (2%)
 Frame = +2

Query  206  FLRKQSPLHLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGP  382
            +  K +P  L   TY+GP  A++G+Q WDFGRF+ TLY+FNGPPSP+KFFEFLIEKLS  
Sbjct  61   YQEKSAPFALK--TYRGPILAEAGKQGWDFGRFVKTLYFFNGPPSPAKFFEFLIEKLSSS  118

Query  383  SPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLI  562
            SPS+P  +M+ SGI+LV GATGGVG+RVVDILR KG  VR LVRN EKARK+ G D+DL+
Sbjct  119  SPSEPKNAMEGSGIVLVVGATGGVGKRVVDILRKKGSPVRVLVRNAEKARKLLGSDIDLV  178

Query  563  VGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            VGDITK +TL+PEYFKGVRKVINA SVI GP
Sbjct  179  VGDITKENTLVPEYFKGVRKVINAASVIVGP  209



>ref|XP_010057126.1| PREDICTED: uncharacterized protein LOC104445030 isoform X1 [Eucalyptus 
grandis]
 gb|KCW74149.1| hypothetical protein EUGRSUZ_E02785 [Eucalyptus grandis]
 gb|KCW74150.1| hypothetical protein EUGRSUZ_E02785 [Eucalyptus grandis]
Length=590

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = +2

Query  245  TYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSG  421
            +Y+GP  A++G+Q WDFGRFL T+Y+F GPPSPSKF EF+IEKLSGP+PS+  K M+SSG
Sbjct  58   SYRGPISAEAGKQGWDFGRFLKTIYFFQGPPSPSKFIEFIIEKLSGPAPSELPKRMESSG  117

Query  422  IILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPE  601
            I+LVAGATGGVGRRVVDILR KGL VR LVRNEEKAR+M G DVDL+VGDITK STL PE
Sbjct  118  IVLVAGATGGVGRRVVDILRKKGLRVRVLVRNEEKARRMLGPDVDLVVGDITKESTLAPE  177

Query  602  YFKGVRKVINAVSVIXGP  655
             F+GVRKVINAVSVI GP
Sbjct  178  NFRGVRKVINAVSVIVGP  195



>ref|XP_008371503.1| PREDICTED: uncharacterized protein LOC103434908 [Malus domestica]
Length=603

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  +   FL +Q+  +LS  TY+    A++G+Q WD  RFL T+Y+FN PPSP+KF E 
Sbjct  50   QLNDRPHSFLXQQNTDNLSTRTYRRYISAEAGKQSWDLTRFLKTIYFFNEPPSPAKFIEA  109

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            LI+KLSGPSPSKP + M++SGI+LVAGATGGVGRR V+ILR KG  VR LVRNEEKAR+M
Sbjct  110  LIQKLSGPSPSKPERKMETSGIVLVAGATGGVGRRAVNILRKKGFPVRVLVRNEEKARQM  169

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+DL+VGDITK STL+PEYFKGVR+VINAVSVI GP
Sbjct  170  LGPDIDLVVGDITKESTLVPEYFKGVRRVINAVSVIVGP  208



>ref|XP_009351587.1| PREDICTED: uncharacterized protein LOC103943107 [Pyrus x bretschneideri]
Length=603

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  +   FL +Q+  +LS  TY+    A++G+Q WD  RFL T+Y+FN  PSP+KF E 
Sbjct  50   QLNDRPHSFLYQQNTDNLSTRTYRRYISAEAGKQSWDLTRFLKTIYFFNELPSPAKFIEA  109

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            LIEKLSGPSPSKP + M++SGI+LVAGATGGVGRR V+ILR KG  VR LVRNEEKARKM
Sbjct  110  LIEKLSGPSPSKPERKMETSGIVLVAGATGGVGRRAVNILRKKGFPVRVLVRNEEKARKM  169

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+DL+VGDITK STL+PEYFKGVR+VINAVSVI GP
Sbjct  170  LGPDIDLVVGDITKESTLVPEYFKGVRRVINAVSVIVGP  208



>ref|XP_004147385.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101203416 
[Cucumis sativus]
Length=572

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 123/159 (77%), Gaps = 7/159 (4%)
 Frame = +2

Query  200  QPFLR----KQSPLHLSF---TTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
             PFL+      S LHLS     + + P      + WDFGRFL TLY+FNGPPSPSKFFE 
Sbjct  44   NPFLQILAGNHSFLHLSIPQSCSLRLPTKPVSAEAWDFGRFLRTLYFFNGPPSPSKFFES  103

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            LI +LSGPSPSKPV+ M++SG ILVAGATGGVGRRVVDILR KGL VRALVRNEEKARKM
Sbjct  104  LIAQLSGPSPSKPVEEMETSGFILVAGATGGVGRRVVDILRKKGLPVRALVRNEEKARKM  163

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+ LIVGD+TK STL PE FKGVRKVINA+SVI GP
Sbjct  164  LGPDIGLIVGDVTKGSTLAPENFKGVRKVINAISVIVGP  202



>ref|XP_004161197.1| PREDICTED: uncharacterized LOC101203416 [Cucumis sativus]
Length=597

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 123/159 (77%), Gaps = 7/159 (4%)
 Frame = +2

Query  200  QPFLR----KQSPLHLSF---TTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
             PFL+      S LHLS     + + P      + WDFGRFL TLY+FNGPPSPSKFFE 
Sbjct  44   NPFLQILAGNHSFLHLSIPQSCSLRLPTKPVSAEAWDFGRFLRTLYFFNGPPSPSKFFES  103

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            LI +LSGPSP+KPV+ M++SG ILVAGATGGVGRRVVDILR KGL VRALVRNEEKARKM
Sbjct  104  LIAQLSGPSPTKPVEEMETSGFILVAGATGGVGRRVVDILRKKGLPVRALVRNEEKARKM  163

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+ LIVGD+TK STL PE FKGVRKVINAVSVI GP
Sbjct  164  LGPDIGLIVGDVTKGSTLAPENFKGVRKVINAVSVIVGP  202



>ref|XP_010106609.1| hypothetical protein L484_004838 [Morus notabilis]
 gb|EXC10939.1| hypothetical protein L484_004838 [Morus notabilis]
Length=590

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 125/159 (79%), Gaps = 2/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  + + FL + +   LS   Y+G   AQ+  Q WD GRFL T Y+FNG PSP+KF EF
Sbjct  50   QLNHRPKYFLYQPNSASLSPRLYRGLISAQAQNQGWDLGRFLKTFYFFNGLPSPAKFLEF  109

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            +IEKLSGPSPSKP K M++SGI+LV GATGGVGRRVVDILR KGL VR LVRNEEKARK+
Sbjct  110  VIEKLSGPSPSKPEK-METSGIVLVTGATGGVGRRVVDILRKKGLPVRVLVRNEEKARKI  168

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+DL++GD+TK STL+PEYFKGVRKVIN VSVI GP
Sbjct  169  LGPDIDLVLGDVTKESTLVPEYFKGVRKVINVVSVIIGP  207



>ref|XP_007159482.1| hypothetical protein PHAVU_002G241100g [Phaseolus vulgaris]
 gb|ESW31476.1| hypothetical protein PHAVU_002G241100g [Phaseolus vulgaris]
Length=600

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 125/158 (79%), Gaps = 1/158 (1%)
 Frame = +2

Query  185  LKIKAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            L+I  +P     +   LS  T++    A++G+Q WDFGRF+ TLY+FNG PSP+KFF+FL
Sbjct  48   LQIYGRPQTLIYTSTRLSSGTHRAAISAEAGRQNWDFGRFVKTLYFFNGFPSPAKFFDFL  107

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
             EKLSGPSPS  V SM +S I+LVAGATGGVGRRVVDILR KG+ VR LVRNEEKAR+M 
Sbjct  108  AEKLSGPSPSVMVNSMRTSDIVLVAGATGGVGRRVVDILRKKGIPVRVLVRNEEKARRML  167

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            G DVDL+VGDITK STL+PEYFKGV+KVINA SVI GP
Sbjct  168  GSDVDLVVGDITKDSTLIPEYFKGVKKVINAASVIVGP  205



>gb|AAM19355.1|AF369888_1 UOS1 [Pisum sativum]
Length=620

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            Q+  K    + +Q+   LS  T++    A+SG+Q WD GRF+ TLY+FNGPPSP+KFF+F
Sbjct  67   QIYGKPHKLIYEQNSTKLSPRTHRASISAKSGRQNWDLGRFIKTLYFFNGPPSPAKFFDF  126

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            L+ KLS  SPS  V SM +S I+LVAGATGGVGRRVVD+LR KG+ VR LVRNEEKARKM
Sbjct  127  LVGKLSSTSPSVSVNSMGTSDIVLVAGATGGVGRRVVDVLRKKGIPVRVLVRNEEKARKM  186

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G DVDL+VGDITK STL+PEYFKGV+KVINAVSVI GP
Sbjct  187  LGSDVDLVVGDITKDSTLIPEYFKGVKKVINAVSVIVGP  225



>ref|XP_008443516.1| PREDICTED: uncharacterized protein LOC103487085 [Cucumis melo]
Length=597

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 119/158 (75%), Gaps = 3/158 (2%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            Q+      FL   SP   S      P +    + WD GRFL TLY+FNGPPSPSKFFE L
Sbjct  48   QILAGNHSFLHLSSPKSCSVRLSTKPISA---EAWDIGRFLRTLYFFNGPPSPSKFFESL  104

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
            I +LSG SPSKPV+ M++SG ILVAGATGGVGRRVVDILR KGL VRALVRNEEKARKM 
Sbjct  105  IAQLSGSSPSKPVEEMETSGFILVAGATGGVGRRVVDILRKKGLPVRALVRNEEKARKML  164

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            G D+ LIVGD+TKASTL PE FKGVRKVINAVSVI GP
Sbjct  165  GPDIGLIVGDVTKASTLAPENFKGVRKVINAVSVIVGP  202



>ref|XP_010242113.1| PREDICTED: uncharacterized protein LOC104586544 [Nelumbo nucifera]
Length=602

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 139/210 (66%), Gaps = 9/210 (4%)
 Frame = +2

Query  44   MECFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCH-----QLKIKAQPF  208
            ME  C    T  S S+   F+GFSS  V            L    H     QL  + +  
Sbjct  1    MESCCS---TKLSTSSFSTFQGFSSSPVVRRFSKNTSHQRLLFHPHSKQFLQLNDRLRSS  57

Query  209  LRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPS  385
            L   +       T + P  A++ +Q WDFGRFL TLY+FNGPPS S FFEFLI KLS P 
Sbjct  58   LYHHTKNSYFLQTNRRPIVAEASKQSWDFGRFLKTLYFFNGPPSHSNFFEFLIAKLSSPK  117

Query  386  PSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIV  565
             S+PVK+M++S +ILVAGATGGVGRRVVDILR KGL VR LVRNEEKA++M G DVDLIV
Sbjct  118  ASEPVKAMETSDVILVAGATGGVGRRVVDILRKKGLPVRVLVRNEEKAKRMLGPDVDLIV  177

Query  566  GDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            GDITK STL+PE+FKGV+KVINAVSVI GP
Sbjct  178  GDITKESTLVPEHFKGVKKVINAVSVIVGP  207



>ref|XP_006449545.1| hypothetical protein CICLE_v10018335mg, partial [Citrus clementina]
 gb|ESR62785.1| hypothetical protein CICLE_v10018335mg, partial [Citrus clementina]
Length=662

 Score =   176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 121/160 (76%), Gaps = 18/160 (11%)
 Frame = +2

Query  221  SPLHLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSK---------------FFE  355
            S LH   +  +G  +    + WDFGRFL TLY+FNGP SP+K               F E
Sbjct  110  SSLHRRLSASRGIISA---EAWDFGRFLKTLYFFNGPLSPAKLNSVLHCLTWVVVWKFVE  166

Query  356  FLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARK  535
            FL+EKLSGPSP +PVKSM++SG++LVAGATGGVGRRVVDILR+KGL VR LVRNEEKARK
Sbjct  167  FLVEKLSGPSPKEPVKSMETSGVVLVAGATGGVGRRVVDILRNKGLPVRVLVRNEEKARK  226

Query  536  MFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            M G DVDLIVGDITK +TL PEYFKGVRKVINAVSVI GP
Sbjct  227  MLGPDVDLIVGDITKENTLTPEYFKGVRKVINAVSVIVGP  266



>ref|XP_004295588.1| PREDICTED: uncharacterized protein LOC101314642 [Fragaria vesca 
subsp. vesca]
Length=592

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYK-GPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  + Q FL +     LS  T K    AQSG Q WD GRFL TL++FN PPSP+K FE 
Sbjct  39   QLNGRPQTFLSQLKSDRLSRRTSKRSIIAQSGSQGWDLGRFLKTLFFFNEPPSPAKIFES  98

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            L+ K+S PSPS+ VK M++SG +LVAGATGGVGRRVV+ILR KG+ VR LVRNE+KAR+M
Sbjct  99   LVSKISSPSPSESVKRMETSGTVLVAGATGGVGRRVVNILRKKGIPVRVLVRNEQKARQM  158

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+DLIVGDITK STL+PEYFKGVRKVINAVSVI GP
Sbjct  159  LGPDIDLIVGDITKESTLIPEYFKGVRKVINAVSVIVGP  197



>ref|XP_004504280.1| PREDICTED: uncharacterized protein LOC101492899 isoform X1 [Cicer 
arietinum]
Length=598

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvaga  442
            A++G+Q WDFGRF+ TLY+FNGPPSP+KFF+FL+ KLSGPS S+ V SM +S I+LVAGA
Sbjct  73   AEAGKQNWDFGRFIKTLYFFNGPPSPAKFFDFLVGKLSGPSASELVTSMGTSDIVLVAGA  132

Query  443  tggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRK  622
            TGGVGRRVVD LR +G+ VR LVRNEEKAR+M G DVDL+VGDITK STL+PEYFKGV+K
Sbjct  133  TGGVGRRVVDELRKRGIPVRVLVRNEEKARRMLGSDVDLVVGDITKDSTLIPEYFKGVKK  192

Query  623  VINAVSVIXGP  655
            VINAVSVI GP
Sbjct  193  VINAVSVIVGP  203



>gb|KHN48016.1| hypothetical protein glysoja_015486 [Glycine soja]
Length=518

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 124/158 (78%), Gaps = 1/158 (1%)
 Frame = +2

Query  185  LKIKAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            L+I  +P     +   LS   +K    A++G+Q WDFGRF+ TL++FNG PSP+KFF+FL
Sbjct  48   LQICGRPQTLIYTSTRLSSGAHKATISAEAGRQNWDFGRFVKTLFFFNGFPSPAKFFDFL  107

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
             EK+S PSPS+ + +M +S I+LVAGATGGVGRRVVDILR KG+ VR LVRNEEKARKM 
Sbjct  108  AEKISDPSPSEVINTMGTSDIVLVAGATGGVGRRVVDILRKKGIPVRVLVRNEEKARKML  167

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            G DVDL++GDITK STL+PEYFKGV+KVINA SVI GP
Sbjct  168  GSDVDLVIGDITKDSTLIPEYFKGVKKVINAASVIVGP  205



>ref|XP_007025317.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY27939.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=560

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            QL  + + FL +Q   +LS  TYKGP +   +Q WD GRFL TLY+FNGPPS +K  EF+
Sbjct  52   QLNGRPKCFLYQQRSAYLSSRTYKGPISAE-KQSWDLGRFLKTLYFFNGPPSLAKVVEFI  110

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
            I KLSGPSP +  K M++S  ILVAGATGGVGRRVVD LR KGL V+ALVRNEEKAR+M 
Sbjct  111  IGKLSGPSPEESAKKMETSSFILVAGATGGVGRRVVDNLRKKGLPVKALVRNEEKARRML  170

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
              +++LIVGDITK STL PEYFKGVRKVINA SVI GP
Sbjct  171  APEIELIVGDITKESTLAPEYFKGVRKVINAASVIIGP  208



>gb|KHN06420.1| Putative complex I intermediate-associated protein 30 [Glycine 
soja]
Length=597

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvaga  442
            A++G+Q WDFGRF+ TL++FNG PSP+KFF+FL+EKLS PSPS+ V +M +S I+LVAGA
Sbjct  75   AEAGRQNWDFGRFVKTLFFFNGFPSPAKFFDFLVEKLSDPSPSEVVNTMGTSDIVLVAGA  134

Query  443  tggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRK  622
            TGGVGRRVVDILR KG+ VR LVRNEEKAR+M G DVDL++GDITK STL+PEYFKGV+K
Sbjct  135  TGGVGRRVVDILRKKGIPVRVLVRNEEKARRMLGSDVDLVIGDITKDSTLIPEYFKGVKK  194

Query  623  VINAVSVIXGP  655
            VINA SVI GP
Sbjct  195  VINAASVIVGP  205



>ref|XP_003524972.1| PREDICTED: uncharacterized protein LOC100500578 [Glycine max]
Length=601

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvaga  442
            A++G+Q WDFGRF+ TL++FNG PSP+KFF+FL+EKLS PSPS+ V +M +S I+LVAGA
Sbjct  75   AEAGRQNWDFGRFVKTLFFFNGFPSPAKFFDFLVEKLSDPSPSEVVNTMGTSDIVLVAGA  134

Query  443  tggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRK  622
            TGGVGRRVVDILR KG+ VR LVRNEEKAR+M G DVDL++GDITK STL+PEYFKGV+K
Sbjct  135  TGGVGRRVVDILRKKGIPVRVLVRNEEKARRMLGSDVDLVIGDITKDSTLIPEYFKGVKK  194

Query  623  VINAVSVIXGP  655
            VINA SVI GP
Sbjct  195  VINAASVIVGP  205



>ref|XP_010686245.1| PREDICTED: uncharacterized protein LOC104900519 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=606

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL+    PF+ ++  L+ S   YKG  +A +G QPWD GRF+ TL++F+  PSP KF E 
Sbjct  52   QLENTLDPFIYQKQSLYNSRRLYKGQIYAATGNQPWDLGRFVKTLFFFDAIPSPVKFIES  111

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            LI+KLS    S+P+++M+SSGI+LVAGATGGVGRRVVD+LR+KG+ VR LVRNEEKAR+M
Sbjct  112  LIDKLSDQPSSEPIRNMESSGIVLVAGATGGVGRRVVDVLRNKGVPVRVLVRNEEKARQM  171

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D++L+VGDITK STLLPEYFKGV+KVINA SVI GP
Sbjct  172  LGPDINLVVGDITKDSTLLPEYFKGVKKVINAASVIVGP  210



>ref|XP_007025316.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY27938.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=603

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            QL  + + FL +Q   +LS  TYKGP +   +Q WD GRFL TLY+FNGPPS +K  EF+
Sbjct  52   QLNGRPKCFLYQQRSAYLSSRTYKGPISAE-KQSWDLGRFLKTLYFFNGPPSLAKVVEFI  110

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
            I KLSGPSP +  K M++S  ILVAGATGGVGRRVVD LR KGL V+ALVRNEEKAR+M 
Sbjct  111  IGKLSGPSPEESAKKMETSSFILVAGATGGVGRRVVDNLRKKGLPVKALVRNEEKARRML  170

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
              +++LIVGDITK STL PEYFKGVRKVINA SVI GP
Sbjct  171  APEIELIVGDITKESTLAPEYFKGVRKVINAASVIIGP  208



>ref|XP_007025318.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY27940.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=604

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            QL  + + FL +Q   +LS  TYKGP +   +Q WD GRFL TLY+FNGPPS +K  EF+
Sbjct  52   QLNGRPKCFLYQQRSAYLSSRTYKGPISAE-KQSWDLGRFLKTLYFFNGPPSLAKVVEFI  110

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
            I KLSGPSP +  K M++S  ILVAGATGGVGRRVVD LR KGL V+ALVRNEEKAR+M 
Sbjct  111  IGKLSGPSPEESAKKMETSSFILVAGATGGVGRRVVDNLRKKGLPVKALVRNEEKARRML  170

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
              +++LIVGDITK STL PEYFKGVRKVINA SVI GP
Sbjct  171  APEIELIVGDITKESTLAPEYFKGVRKVINAASVIIGP  208



>ref|XP_010686246.1| PREDICTED: uncharacterized protein LOC104900519 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=599

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL+    PF+ ++  L+ S   YKG  +A +G QPWD GRF+ TL++F+  PSP KF E 
Sbjct  45   QLENTLDPFIYQKQSLYNSRRLYKGQIYAATGNQPWDLGRFVKTLFFFDAIPSPVKFIES  104

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            LI+KLS    S+P+++M+SSGI+LVAGATGGVGRRVVD+LR+KG+ VR LVRNEEKAR+M
Sbjct  105  LIDKLSDQPSSEPIRNMESSGIVLVAGATGGVGRRVVDVLRNKGVPVRVLVRNEEKARQM  164

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D++L+VGDITK STLLPEYFKGV+KVINA SVI GP
Sbjct  165  LGPDINLVVGDITKDSTLLPEYFKGVKKVINAASVIVGP  203



>ref|XP_004147418.1| PREDICTED: uncharacterized protein LOC101211769 [Cucumis sativus]
Length=597

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 120/159 (75%), Gaps = 7/159 (4%)
 Frame = +2

Query  200  QPFLR----KQSPLHLSF---TTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
             PFL+      S LHLS     + + P      + WD GRFL TLY+FN PPSPSKFFE 
Sbjct  44   NPFLQIFPGNHSFLHLSIPKSCSLRLPKEPISAEAWDLGRFLRTLYFFNVPPSPSKFFES  103

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            LI +LSGPSPSKPV+ M++SG ILVAGATGGVGRRVVDILR KGL VRALVRNEEKARKM
Sbjct  104  LIAQLSGPSPSKPVEEMETSGFILVAGATGGVGRRVVDILRKKGLPVRALVRNEEKARKM  163

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+ LIVGD+TK STL PE  KGVRKVINAVSVI GP
Sbjct  164  LGPDIGLIVGDVTKRSTLAPENLKGVRKVINAVSVIVGP  202



>ref|XP_008790013.1| PREDICTED: uncharacterized protein LOC103707347 isoform X1 [Phoenix 
dactylifera]
Length=603

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 137/208 (66%), Gaps = 9/208 (4%)
 Frame = +2

Query  50   CFCGVN-KTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKAQPFLRKQSP  226
            CF   +  + PS +A+L+ +GFSS    Y+ +S      L  P HQ K   Q    +   
Sbjct  4    CFTPASPSSRPSTAALLHPQGFSS---SYTRRSHSSALHLKVPSHQSKQFIQLTHTRDQH  60

Query  227  LHLSFTTYKGP-----FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPS  391
               S   Y  P      A+SG+Q WDF RF  TLY+FNGPP+P +F   LIEKL+ P+ S
Sbjct  61   KGASRFVYSRPSKGTIIAKSGRQAWDFSRFFRTLYFFNGPPNPVEFIRSLIEKLASPTAS  120

Query  392  KPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGD  571
            +P K M +S I+LV GATGGVGRRVVDILR KGL VRALVRN+EKAR MFG DVDLIV D
Sbjct  121  EPSKEMKTSSIVLVTGATGGVGRRVVDILRKKGLPVRALVRNKEKARTMFGPDVDLIVAD  180

Query  572  ITKASTLLPEYFKGVRKVINAVSVIXGP  655
            ITK  TL PEYFKGVR+VINAVSVI GP
Sbjct  181  ITKDDTLAPEYFKGVRRVINAVSVIVGP  208



>ref|XP_008790015.1| PREDICTED: uncharacterized protein LOC103707347 isoform X3 [Phoenix 
dactylifera]
Length=572

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 137/208 (66%), Gaps = 9/208 (4%)
 Frame = +2

Query  50   CFCGVN-KTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKAQPFLRKQSP  226
            CF   +  + PS +A+L+ +GFSS    Y+ +S      L  P HQ K   Q    +   
Sbjct  4    CFTPASPSSRPSTAALLHPQGFSS---SYTRRSHSSALHLKVPSHQSKQFIQLTHTRDQH  60

Query  227  LHLSFTTYKGP-----FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPS  391
               S   Y  P      A+SG+Q WDF RF  TLY+FNGPP+P +F   LIEKL+ P+ S
Sbjct  61   KGASRFVYSRPSKGTIIAKSGRQAWDFSRFFRTLYFFNGPPNPVEFIRSLIEKLASPTAS  120

Query  392  KPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGD  571
            +P K M +S I+LV GATGGVGRRVVDILR KGL VRALVRN+EKAR MFG DVDLIV D
Sbjct  121  EPSKEMKTSSIVLVTGATGGVGRRVVDILRKKGLPVRALVRNKEKARTMFGPDVDLIVAD  180

Query  572  ITKASTLLPEYFKGVRKVINAVSVIXGP  655
            ITK  TL PEYFKGVR+VINAVSVI GP
Sbjct  181  ITKDDTLAPEYFKGVRRVINAVSVIVGP  208



>ref|XP_008790014.1| PREDICTED: uncharacterized protein LOC103707347 isoform X2 [Phoenix 
dactylifera]
Length=579

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 137/208 (66%), Gaps = 9/208 (4%)
 Frame = +2

Query  50   CFCGVN-KTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKAQPFLRKQSP  226
            CF   +  + PS +A+L+ +GFSS    Y+ +S      L  P HQ K   Q    +   
Sbjct  4    CFTPASPSSRPSTAALLHPQGFSS---SYTRRSHSSALHLKVPSHQSKQFIQLTHTRDQH  60

Query  227  LHLSFTTYKGP-----FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPS  391
               S   Y  P      A+SG+Q WDF RF  TLY+FNGPP+P +F   LIEKL+ P+ S
Sbjct  61   KGASRFVYSRPSKGTIIAKSGRQAWDFSRFFRTLYFFNGPPNPVEFIRSLIEKLASPTAS  120

Query  392  KPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGD  571
            +P K M +S I+LV GATGGVGRRVVDILR KGL VRALVRN+EKAR MFG DVDLIV D
Sbjct  121  EPSKEMKTSSIVLVTGATGGVGRRVVDILRKKGLPVRALVRNKEKARTMFGPDVDLIVAD  180

Query  572  ITKASTLLPEYFKGVRKVINAVSVIXGP  655
            ITK  TL PEYFKGVR+VINAVSVI GP
Sbjct  181  ITKDDTLAPEYFKGVRRVINAVSVIVGP  208



>ref|XP_009381202.1| PREDICTED: uncharacterized protein LOC103969413 [Musa acuminata 
subsp. malaccensis]
Length=603

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 143/210 (68%), Gaps = 8/210 (4%)
 Frame = +2

Query  44   MECFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQL---KIKAQPFLR  214
            MEC CG++    S SA+L+ +G SS          L    LS    Q      +  P L 
Sbjct  1    MECCCGLS-LRSSASALLDPQGISSSHTCKRNSGDLHRQVLSLRAKQFIPHAYRLDPCLY  59

Query  215  KQS--PLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPS  385
            K++  P   S   YKG   A+SG+Q WDFGRF+ TLY+FNGPP+P+KF E LIEKLS P+
Sbjct  60   KEALPPFKYS-RKYKGAISAESGRQTWDFGRFIRTLYFFNGPPNPAKFIESLIEKLSSPT  118

Query  386  PSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIV  565
             ++ +K M++S ++LVAGATGGVGRRVV+ILR+KG  V ALVRN+EKAR M G DVDLIV
Sbjct  119  STELIKKMETSDMVLVAGATGGVGRRVVNILRNKGFPVCALVRNKEKARSMLGPDVDLIV  178

Query  566  GDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            GDITK  TL PEYFKGV+KVINA SVI GP
Sbjct  179  GDITKMETLSPEYFKGVKKVINAASVIIGP  208



>ref|XP_010529212.1| PREDICTED: uncharacterized protein LOC104806167 isoform X1 [Tarenaya 
hassleriana]
Length=596

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 143/216 (66%), Gaps = 27/216 (13%)
 Frame = +2

Query  44   MECFCGVNKTLPSCSAVLNFRGFSS-VGVGYSEksllppfplskpCHQLKIKAQPFLR--  214
            ME  C +  + P    +LN +G SS + V +S               +L    +PFL+  
Sbjct  1    MEALCSLKLSSPLSPPILNIQGSSSPIDVKFS---------------KLSPLPKPFLQLN  45

Query  215  -KQSPLH---LSFTTYKGPF-----AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIE  367
             +   LH   +S++ Y  P      A S  Q W+FGRFL T+Y+FNGPPSP KF   +IE
Sbjct  46   DRSRHLHYGQVSYSVYLRPHNRRATAVSELQGWNFGRFLKTVYFFNGPPSPLKFVASVIE  105

Query  368  KLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGE  547
            KL+  SP +P K+M++SG+ILVAGATGGVGRRVVDIL  KGL V+ALVRNEEKARKM G 
Sbjct  106  KLTNGSPEEPPKAMETSGVILVAGATGGVGRRVVDILMKKGLPVKALVRNEEKARKMLGP  165

Query  548  DVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            D+DLIVGDITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  166  DIDLIVGDITKENTLVPEKFKGVRKVINAVSVIVGP  201



>ref|XP_010915482.1| PREDICTED: uncharacterized protein LOC105040590 isoform X2 [Elaeis 
guineensis]
Length=595

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
            FA+SG+Q WDFGRFL TLY+FNGPP+P +    LI KLS P+ S+P+K M +SGI+LV G
Sbjct  77   FAKSGRQAWDFGRFLRTLYFFNGPPNPVELVRSLIGKLSSPTSSEPLKEMKTSGIVLVTG  136

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVDILR KG+ VR LVRN+EKAR MFG DVDLIV DITK  TL PEYFKGVR
Sbjct  137  ATGGVGRRVVDILRKKGIPVRVLVRNKEKARTMFGPDVDLIVADITKEDTLAPEYFKGVR  196

Query  620  KVINAVSVIXGP  655
            +VINAVSVI GP
Sbjct  197  RVINAVSVIVGP  208



>gb|EPS64358.1| hypothetical protein M569_10423, partial [Genlisea aurea]
Length=490

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvaga  442
            ++  +Q WD  RF  TLY+FNGPPSP+KFFEFLIEKLSGPS +K  K M + GIILV GA
Sbjct  40   SEDRRQGWDVSRFFKTLYFFNGPPSPAKFFEFLIEKLSGPSTAKEAKVMKADGIILVVGA  99

Query  443  tggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRK  622
            TGGVGRRVVD+LR K L VR L RNEEKAR+M G DVDL+VGDITKASTLLPEYFKGV+ 
Sbjct  100  TGGVGRRVVDLLRRKQLPVRVLARNEEKARRMLGPDVDLVVGDITKASTLLPEYFKGVKA  159

Query  623  VINAVSVIXGP  655
            VINA SVI GP
Sbjct  160  VINAASVIVGP  170



>ref|XP_010915481.1| PREDICTED: uncharacterized protein LOC105040590 isoform X1 [Elaeis 
guineensis]
Length=603

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
            FA+SG+Q WDFGRFL TLY+FNGPP+P +    LI KLS P+ S+P+K M +SGI+LV G
Sbjct  77   FAKSGRQAWDFGRFLRTLYFFNGPPNPVELVRSLIGKLSSPTSSEPLKEMKTSGIVLVTG  136

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVDILR KG+ VR LVRN+EKAR MFG DVDLIV DITK  TL PEYFKGVR
Sbjct  137  ATGGVGRRVVDILRKKGIPVRVLVRNKEKARTMFGPDVDLIVADITKEDTLAPEYFKGVR  196

Query  620  KVINAVSVIXGP  655
            +VINAVSVI GP
Sbjct  197  RVINAVSVIVGP  208



>gb|KFK28552.1| hypothetical protein AALP_AA7G011200 [Arabis alpina]
Length=585

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 139/207 (67%), Gaps = 21/207 (10%)
 Frame = +2

Query  44   MECFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKAQPFLRKQS  223
            ME  C +N + PS    +N +G++S+   +                QL  K++  LR Q 
Sbjct  1    MEISCSLNLSSPS---FINLQGYTSLPKPF---------------LQLDDKSRGLLRNQQ  42

Query  224  PLH-LSFTTYKGPF--AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSK  394
              H L+  +Y+     A+SG Q WDFGRF+ TLY+FNG PSP KF   + EKLS  +  +
Sbjct  43   VSHSLNLRSYRKRVITAKSGSQGWDFGRFIKTLYFFNGTPSPLKFVASVFEKLSNGTMEE  102

Query  395  PVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDI  574
            PV  M++SGIILVAGATGGVGRRVVD+LR +GL V+ALVRNEEKARKM G D+DLIV DI
Sbjct  103  PVSVMETSGIILVAGATGGVGRRVVDVLRQRGLPVKALVRNEEKARKMLGPDIDLIVADI  162

Query  575  TKASTLLPEYFKGVRKVINAVSVIXGP  655
            TK +TL+PE FKGVRKVINAVSVI GP
Sbjct  163  TKENTLVPEKFKGVRKVINAVSVIVGP  189



>ref|NP_001242339.1| uncharacterized protein LOC100815475 [Glycine max]
 gb|ACU21450.1| unknown [Glycine max]
Length=600

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvaga  442
            A++G+Q WDFGRF+ TL++FNG PSP+KFF+FL EK+S PSPS+ + +M +S I+LVAGA
Sbjct  75   AEAGRQNWDFGRFVKTLFFFNGFPSPAKFFDFLAEKISDPSPSEVINTMGTSDIVLVAGA  134

Query  443  tggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRK  622
            TGGVGRRVVDIL  KG+ VR LVRNEEKARKM G DVDL++GDITK STL+PEYFKGV+K
Sbjct  135  TGGVGRRVVDILCKKGIPVRVLVRNEEKARKMLGSDVDLVIGDITKDSTLIPEYFKGVKK  194

Query  623  VINAVSVIXGP  655
            VINA SVI GP
Sbjct  195  VINAASVIVGP  205



>dbj|BAJ33613.1| unnamed protein product [Thellungiella halophila]
Length=336

 Score =   163 bits (413),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 116/153 (76%), Gaps = 4/153 (3%)
 Frame = +2

Query  209  LRKQSPLH---LSFTTY-KGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLS  376
            LR Q   H   ++  +Y K   A+S  Q WDFGRF+ TLY+FNGPPSP KF   + EKL+
Sbjct  54   LRHQQASHSHSVNLRSYRKRVTAKSESQGWDFGRFVKTLYFFNGPPSPLKFVSSVFEKLT  113

Query  377  GPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVD  556
              S  +PV  M++SGIILVAGATGGVGRRVVDILR +GL V+ALVRNEEKARKM G D+D
Sbjct  114  NGSTEEPVNEMETSGIILVAGATGGVGRRVVDILRKRGLPVKALVRNEEKARKMLGPDID  173

Query  557  LIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            LI  DITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  174  LIFADITKENTLVPEKFKGVRKVINAVSVIVGP  206



>ref|XP_002867974.1| transcriptional repressor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44233.1| transcriptional repressor [Arabidopsis lyrata subsp. lyrata]
Length=596

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTY-KGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  K++    +Q+   L+  +Y K   A+SG Q WDFGRF+ TLY+FNG PSP KF   
Sbjct  43   QLDDKSRRLRDQQASHSLNLRSYRKRVTAKSGSQGWDFGRFIKTLYFFNGAPSPLKFVSS  102

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            + EKL+  S  +PV  M +SGIILVAGATGGVGRRVVDILR +GL V+ALVRNEEKARKM
Sbjct  103  VFEKLTNGSTEEPVTEMGTSGIILVAGATGGVGRRVVDILRKRGLPVKALVRNEEKARKM  162

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+DLIV DITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  163  LGPDIDLIVADITKENTLVPEKFKGVRKVINAVSVIVGP  201



>ref|XP_010434493.1| PREDICTED: uncharacterized protein LOC104718440 isoform X2 [Camelina 
sativa]
Length=630

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 2/153 (1%)
 Frame = +2

Query  203  PFLRKQSPLH-LSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLS  376
            P LR Q   H L+  +Y+    A+SG Q WDFGRF+ TLY+FNGPPSP KF   + EKL+
Sbjct  52   PRLRDQQVSHSLNLRSYRNRVTAKSGSQGWDFGRFVKTLYFFNGPPSPLKFVSSVFEKLT  111

Query  377  GPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVD  556
              S  +PV  M+++GIILVAGATGGVGRRVVDIL+ +GL V+ALVRNEEKARKM G D+D
Sbjct  112  NGSTEEPVNEMETTGIILVAGATGGVGRRVVDILKMRGLPVKALVRNEEKARKMLGLDID  171

Query  557  LIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            LIV DITK +TL+PE FKGVRKVINAVS I GP
Sbjct  172  LIVADITKENTLVPEKFKGVRKVINAVSCIVGP  204



>ref|XP_010434492.1| PREDICTED: uncharacterized protein LOC104718440 isoform X1 [Camelina 
sativa]
Length=599

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 2/153 (1%)
 Frame = +2

Query  203  PFLRKQSPLH-LSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLS  376
            P LR Q   H L+  +Y+    A+SG Q WDFGRF+ TLY+FNGPPSP KF   + EKL+
Sbjct  52   PRLRDQQVSHSLNLRSYRNRVTAKSGSQGWDFGRFVKTLYFFNGPPSPLKFVSSVFEKLT  111

Query  377  GPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVD  556
              S  +PV  M+++GIILVAGATGGVGRRVVDIL+ +GL V+ALVRNEEKARKM G D+D
Sbjct  112  NGSTEEPVNEMETTGIILVAGATGGVGRRVVDILKMRGLPVKALVRNEEKARKMLGLDID  171

Query  557  LIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            LIV DITK +TL+PE FKGVRKVINAVS I GP
Sbjct  172  LIVADITKENTLVPEKFKGVRKVINAVSCIVGP  204



>ref|XP_003629826.1| UOS1 [Medicago truncatula]
Length=589

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 122/155 (79%), Gaps = 1/155 (1%)
 Frame = +2

Query  194  KAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEK  370
            K Q  + +Q    LS   Y+    A++G+Q WDFGRF+ TLY+FNGPPSP+KFF+FL+ K
Sbjct  40   KPQTLIYEQKSTRLSTGAYRTIISAKAGRQSWDFGRFIKTLYFFNGPPSPAKFFDFLVGK  99

Query  371  LSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGED  550
            LS  S S+ V SM +S I+LVAGATGGVGRRVVD LR KG+ VR LVRNEEKARKM G D
Sbjct  100  LSSSSTSESVNSMGTSDIVLVAGATGGVGRRVVDELRKKGIPVRVLVRNEEKARKMLGSD  159

Query  551  VDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            VDL++GDITK STL+PEYFKGV+KVINAVSVI GP
Sbjct  160  VDLVIGDITKDSTLIPEYFKGVKKVINAVSVIVGP  194



>gb|AET04302.2| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=597

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 122/155 (79%), Gaps = 1/155 (1%)
 Frame = +2

Query  194  KAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEK  370
            K Q  + +Q    LS   Y+    A++G+Q WDFGRF+ TLY+FNGPPSP+KFF+FL+ K
Sbjct  48   KPQTLIYEQKSTRLSTGAYRTIISAKAGRQSWDFGRFIKTLYFFNGPPSPAKFFDFLVGK  107

Query  371  LSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGED  550
            LS  S S+ V SM +S I+LVAGATGGVGRRVVD LR KG+ VR LVRNEEKARKM G D
Sbjct  108  LSSSSTSESVNSMGTSDIVLVAGATGGVGRRVVDELRKKGIPVRVLVRNEEKARKMLGSD  167

Query  551  VDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            VDL++GDITK STL+PEYFKGV+KVINAVSVI GP
Sbjct  168  VDLVIGDITKDSTLIPEYFKGVKKVINAVSVIVGP  202



>ref|XP_010449465.1| PREDICTED: uncharacterized protein LOC104731696 isoform X2 [Camelina 
sativa]
Length=594

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = +2

Query  209  LRKQSPLH-LSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGP  382
            LR Q   H L+  +Y+    A+S  Q WDFGRF+ TLY+FNGPPSP KF   + EKL+  
Sbjct  52   LRDQQVSHSLNLRSYRNRVTAKSASQGWDFGRFVKTLYFFNGPPSPLKFVSSVFEKLTNG  111

Query  383  SPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLI  562
            S  +PV  M+++GIILVAGATGGVGRRVVDILR +GL V+ALVRNEEKARKM G D+DLI
Sbjct  112  STEEPVNQMETTGIILVAGATGGVGRRVVDILRMRGLPVKALVRNEEKARKMLGPDIDLI  171

Query  563  VGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            V DITK +TL+PE FKGVRKVINAVS I GP
Sbjct  172  VADITKENTLVPEMFKGVRKVINAVSCIVGP  202



>ref|XP_010449466.1| PREDICTED: uncharacterized protein LOC104731696 isoform X3 [Camelina 
sativa]
Length=624

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = +2

Query  209  LRKQSPLH-LSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGP  382
            LR Q   H L+  +Y+    A+S  Q WDFGRF+ TLY+FNGPPSP KF   + EKL+  
Sbjct  52   LRDQQVSHSLNLRSYRNRVTAKSASQGWDFGRFVKTLYFFNGPPSPLKFVSSVFEKLTNG  111

Query  383  SPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLI  562
            S  +PV  M+++GIILVAGATGGVGRRVVDILR +GL V+ALVRNEEKARKM G D+DLI
Sbjct  112  STEEPVNQMETTGIILVAGATGGVGRRVVDILRMRGLPVKALVRNEEKARKMLGPDIDLI  171

Query  563  VGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            V DITK +TL+PE FKGVRKVINAVS I GP
Sbjct  172  VADITKENTLVPEMFKGVRKVINAVSCIVGP  202



>ref|XP_010439809.1| PREDICTED: uncharacterized protein LOC104723179 isoform X2 [Camelina 
sativa]
Length=629

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  +++    +Q    L+  +Y+    A+SG Q WDFGRF+ TLY+FNGPPSP KF   
Sbjct  45   QLDDRSRRLRDQQVSHSLNLRSYRNRVTAKSGSQGWDFGRFVKTLYFFNGPPSPLKFVSS  104

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            + EKL+  S  +PV  M+++GIILVAGATGGVGRRVVDIL+ +GL V+ALVRNEEKARKM
Sbjct  105  VFEKLTNGSTEEPVNEMETTGIILVAGATGGVGRRVVDILKMRGLPVKALVRNEEKARKM  164

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+DLIV DITK +TL+PE FKGVRKVINAVS I GP
Sbjct  165  LGPDIDLIVADITKENTLVPEKFKGVRKVINAVSCIVGP  203



>ref|XP_010439808.1| PREDICTED: uncharacterized protein LOC104723179 isoform X1 [Camelina 
sativa]
Length=598

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  +++    +Q    L+  +Y+    A+SG Q WDFGRF+ TLY+FNGPPSP KF   
Sbjct  45   QLDDRSRRLRDQQVSHSLNLRSYRNRVTAKSGSQGWDFGRFVKTLYFFNGPPSPLKFVSS  104

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            + EKL+  S  +PV  M+++GIILVAGATGGVGRRVVDIL+ +GL V+ALVRNEEKARKM
Sbjct  105  VFEKLTNGSTEEPVNEMETTGIILVAGATGGVGRRVVDILKMRGLPVKALVRNEEKARKM  164

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+DLIV DITK +TL+PE FKGVRKVINAVS I GP
Sbjct  165  LGPDIDLIVADITKENTLVPEKFKGVRKVINAVSCIVGP  203



>ref|XP_010449464.1| PREDICTED: uncharacterized protein LOC104731696 isoform X1 [Camelina 
sativa]
Length=597

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = +2

Query  209  LRKQSPLH-LSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGP  382
            LR Q   H L+  +Y+    A+S  Q WDFGRF+ TLY+FNGPPSP KF   + EKL+  
Sbjct  52   LRDQQVSHSLNLRSYRNRVTAKSASQGWDFGRFVKTLYFFNGPPSPLKFVSSVFEKLTNG  111

Query  383  SPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLI  562
            S  +PV  M+++GIILVAGATGGVGRRVVDILR +GL V+ALVRNEEKARKM G D+DLI
Sbjct  112  STEEPVNQMETTGIILVAGATGGVGRRVVDILRMRGLPVKALVRNEEKARKMLGPDIDLI  171

Query  563  VGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            V DITK +TL+PE FKGVRKVINAVS I GP
Sbjct  172  VADITKENTLVPEMFKGVRKVINAVSCIVGP  202



>emb|CAB37466.1| putative protein [Arabidopsis thaliana]
 emb|CAB78883.1| putative protein [Arabidopsis thaliana]
Length=621

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTY-KGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  K++    +Q    L   +Y K   A+SG Q WDFGRF+ TLY+FNGPPSP KF   
Sbjct  43   QLDDKSRRLRDQQVSHSLELRSYRKRVTAKSGSQGWDFGRFVKTLYFFNGPPSPLKFVSS  102

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            + EKL+  +  +PV  M +SGIILVAGATGGVGRR+VDILR +GL V+ALVRNEEKARKM
Sbjct  103  VFEKLTNGATEEPVAEMGTSGIILVAGATGGVGRRIVDILRKRGLPVKALVRNEEKARKM  162

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G ++DLIV DITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  163  LGPEIDLIVADITKENTLVPEKFKGVRKVINAVSVIVGP  201



>ref|XP_010686247.1| PREDICTED: uncharacterized protein LOC104900519 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=577

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
            +A +G QPWD GRF+ TL++F+  PSP KF E LI+KLS    S+P+++M+SSGI+LVAG
Sbjct  50   YAATGNQPWDLGRFVKTLFFFDAIPSPVKFIESLIDKLSDQPSSEPIRNMESSGIVLVAG  109

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVD+LR+KG+ VR LVRNEEKAR+M G D++L+VGDITK STLLPEYFKGV+
Sbjct  110  ATGGVGRRVVDVLRNKGVPVRVLVRNEEKARQMLGPDINLVVGDITKDSTLLPEYFKGVK  169

Query  620  KVINAVSVIXGP  655
            KVINA SVI GP
Sbjct  170  KVINAASVIVGP  181



>ref|NP_193616.2| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAL61926.1| putative protein [Arabidopsis thaliana]
 gb|AAP37723.1| At4g18810 [Arabidopsis thaliana]
 gb|AEE84092.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=596

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTY-KGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  K++    +Q    L   +Y K   A+SG Q WDFGRF+ TLY+FNGPPSP KF   
Sbjct  43   QLDDKSRRLRDQQVSHSLELRSYRKRVTAKSGSQGWDFGRFVKTLYFFNGPPSPLKFVSS  102

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            + EKL+  +  +PV  M +SGIILVAGATGGVGRR+VDILR +GL V+ALVRNEEKARKM
Sbjct  103  VFEKLTNGATEEPVAEMGTSGIILVAGATGGVGRRIVDILRKRGLPVKALVRNEEKARKM  162

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G ++DLIV DITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  163  LGPEIDLIVADITKENTLVPEKFKGVRKVINAVSVIVGP  201



>ref|NP_001190764.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AEE84093.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=627

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTY-KGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  K++    +Q    L   +Y K   A+SG Q WDFGRF+ TLY+FNGPPSP KF   
Sbjct  43   QLDDKSRRLRDQQVSHSLELRSYRKRVTAKSGSQGWDFGRFVKTLYFFNGPPSPLKFVSS  102

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            + EKL+  +  +PV  M +SGIILVAGATGGVGRR+VDILR +GL V+ALVRNEEKARKM
Sbjct  103  VFEKLTNGATEEPVAEMGTSGIILVAGATGGVGRRIVDILRKRGLPVKALVRNEEKARKM  162

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G ++DLIV DITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  163  LGPEIDLIVADITKENTLVPEKFKGVRKVINAVSVIVGP  201



>gb|KJB66861.1| hypothetical protein B456_010G161400 [Gossypium raimondii]
Length=587

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            QL  + +  L ++   +LS  TYK P +   +Q WD GRF  TLY+FNGPPSP+K  EF+
Sbjct  52   QLNGRPKYRLNQRRSAYLSSATYKDPISAE-KQGWDLGRFFKTLYFFNGPPSPAKIVEFI  110

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
            IEKLSG SP +  K M +S  +LV GATGGVGRRVV+ LR KGL V+ALVRNEEKARKM 
Sbjct  111  IEKLSGSSPEESEKKMGTSDYVLVVGATGGVGRRVVNNLRKKGLPVKALVRNEEKARKML  170

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            G D++LIVGDITK STL+ +YFKGV+KVINA SVI GP
Sbjct  171  GPDIELIVGDITKESTLVAQYFKGVKKVINAASVIIGP  208



>gb|KJB66858.1| hypothetical protein B456_010G161400 [Gossypium raimondii]
 gb|KJB66862.1| hypothetical protein B456_010G161400 [Gossypium raimondii]
Length=603

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            QL  + +  L ++   +LS  TYK P +   +Q WD GRF  TLY+FNGPPSP+K  EF+
Sbjct  52   QLNGRPKYRLNQRRSAYLSSATYKDPISAE-KQGWDLGRFFKTLYFFNGPPSPAKIVEFI  110

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
            IEKLSG SP +  K M +S  +LV GATGGVGRRVV+ LR KGL V+ALVRNEEKARKM 
Sbjct  111  IEKLSGSSPEESEKKMGTSDYVLVVGATGGVGRRVVNNLRKKGLPVKALVRNEEKARKML  170

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            G D++LIVGDITK STL+ +YFKGV+KVINA SVI GP
Sbjct  171  GPDIELIVGDITKESTLVAQYFKGVKKVINAASVIIGP  208



>ref|XP_006414054.1| hypothetical protein EUTSA_v10024714mg [Eutrema salsugineum]
 gb|ESQ55507.1| hypothetical protein EUTSA_v10024714mg [Eutrema salsugineum]
Length=601

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 116/153 (76%), Gaps = 4/153 (3%)
 Frame = +2

Query  209  LRKQSPLH---LSFTTY-KGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLS  376
            LR Q   H   ++  +Y K   A+S  Q WDFGRF+ TLY+FNGPPSP KF   + EKL+
Sbjct  54   LRHQQASHSHSVNLRSYRKRVTAKSESQGWDFGRFVKTLYFFNGPPSPLKFVSSVFEKLT  113

Query  377  GPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVD  556
              S  +PV  M++SGIILVAGATGGVGRRVVDILR +GL V+ALVRNEEKARKM G D+D
Sbjct  114  NGSTEEPVNEMETSGIILVAGATGGVGRRVVDILRKRGLPVKALVRNEEKARKMLGPDID  173

Query  557  LIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            LI  DITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  174  LIFADITKENTLVPEKFKGVRKVINAVSVIVGP  206



>ref|XP_006414053.1| hypothetical protein EUTSA_v10024714mg [Eutrema salsugineum]
 gb|ESQ55506.1| hypothetical protein EUTSA_v10024714mg [Eutrema salsugineum]
Length=598

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 116/153 (76%), Gaps = 4/153 (3%)
 Frame = +2

Query  209  LRKQSPLH---LSFTTY-KGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLS  376
            LR Q   H   ++  +Y K   A+S  Q WDFGRF+ TLY+FNGPPSP KF   + EKL+
Sbjct  51   LRHQQASHSHSVNLRSYRKRVTAKSESQGWDFGRFVKTLYFFNGPPSPLKFVSSVFEKLT  110

Query  377  GPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVD  556
              S  +PV  M++SGIILVAGATGGVGRRVVDILR +GL V+ALVRNEEKARKM G D+D
Sbjct  111  NGSTEEPVNEMETSGIILVAGATGGVGRRVVDILRKRGLPVKALVRNEEKARKMLGPDID  170

Query  557  LIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            LI  DITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  171  LIFADITKENTLVPEKFKGVRKVINAVSVIVGP  203



>ref|XP_006830227.1| hypothetical protein AMTR_s00130p00051210 [Amborella trichopoda]
 gb|ERM97643.1| hypothetical protein AMTR_s00130p00051210 [Amborella trichopoda]
Length=601

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
            FA+SG+Q WD GRFL T+Y+F+GPPSP+KFFEFL+EKLS    S+PV + +   ++LV G
Sbjct  75   FAESGRQSWDIGRFLKTVYFFSGPPSPAKFFEFLLEKLSSSGSSEPVMAKEKHDVVLVTG  134

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVDIL  K L VR LVRNEEKAR + G D+DLIVGD+TK  TL PEYFKGV+
Sbjct  135  ATGGVGRRVVDILYKKSLPVRVLVRNEEKARTILGPDIDLIVGDVTKKDTLAPEYFKGVK  194

Query  620  KVINAVSVIXGP  655
            KVINAVSVI GP
Sbjct  195  KVINAVSVIVGP  206



>emb|CDX99422.1| BnaC01g11300D [Brassica napus]
Length=599

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSF---TTYKGPFAQSG-QQPWDFGRFLSTLYYFNGPPSPSKF  349
            QL  + Q  LR Q   H S    ++ K   A+SG  Q WDFGRF+ TLY+FNGPPSP KF
Sbjct  44   QLDDRGQ-RLRDQQASHSSVYLRSSRKLVTAKSGGSQGWDFGRFIKTLYFFNGPPSPLKF  102

Query  350  FEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKA  529
               + EKL+  S  +P+  M++SGIILVAGATGGVGRRVVDILRS+GL V+ALVRNEEKA
Sbjct  103  VSSVFEKLTNGSTEEPLNEMETSGIILVAGATGGVGRRVVDILRSRGLPVKALVRNEEKA  162

Query  530  RKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            RKM G D+DLIV DITK +TL+ E FKGVRKVINAVSVI GP
Sbjct  163  RKMLGPDIDLIVADITKENTLVAEKFKGVRKVINAVSVIVGP  204



>ref|XP_004161206.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101211769 
[Cucumis sativus]
Length=597

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 116/159 (73%), Gaps = 7/159 (4%)
 Frame = +2

Query  200  QPFLR----KQSPLHLSF---TTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
             PFL+      S LHLS     + + P      + WD G F   + +FN PPSPSKFFE 
Sbjct  44   NPFLQIFPGNHSFLHLSIPKSCSLRLPKEPISAEAWDLGGFXENIDFFNVPPSPSKFFES  103

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            LI +LSGPSP+KPV+ M++SG ILVAGATGGVGRRVVDILR KGL VRALVRNEEKARKM
Sbjct  104  LIAQLSGPSPTKPVEEMETSGFILVAGATGGVGRRVVDILRKKGLPVRALVRNEEKARKM  163

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
             G D+ LIVGD+TK STL PE  KGVRKVINAVSVI GP
Sbjct  164  LGPDIGLIVGDVTKRSTLAPENLKGVRKVINAVSVIVGP  202



>emb|CDX78897.1| BnaA01g09640D [Brassica napus]
Length=628

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 121/163 (74%), Gaps = 6/163 (4%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSF---TTYKGPFAQS-GQQPWDFGRFLSTLYYFNGPPSPSKF  349
            QL  + Q  LR Q   H S    +  K   A+S G Q WD GRF+ TLY+FNGPPSP KF
Sbjct  44   QLDDRGQ-RLRDQHASHSSVYLRSFRKRVIAKSEGSQGWDIGRFIKTLYFFNGPPSPLKF  102

Query  350  FEFLIEKLS-GPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEK  526
               + EKL+ G +  +PV  M++SGIILVAGATGGVGRRVVDILRS+GL V+ALVRNEEK
Sbjct  103  VSSVFEKLTNGSTTEEPVNEMETSGIILVAGATGGVGRRVVDILRSRGLPVKALVRNEEK  162

Query  527  ARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            ARKM G D+DLIV DITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  163  ARKMLGPDIDLIVADITKENTLVPEKFKGVRKVINAVSVIVGP  205



>ref|NP_001288965.1| uncharacterized LOC103856855 [Brassica rapa]
 gb|ABV89650.1| transcriptional repressor [Brassica rapa]
Length=600

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = +2

Query  272  GQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLS-GPSPSKPVKSMDSSGIILvagatg  448
            G Q WD GRF+ TLY+FNGPPSP KF   + EKL+ G +  +PV  M++SGIILVAGATG
Sbjct  77   GSQGWDIGRFIKTLYFFNGPPSPLKFVSSVFEKLTNGSTTEEPVNEMETSGIILVAGATG  136

Query  449  gvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            GVGRRVVDILRS+GL V+ALVRNEEKARKM G D+DLIV DITK +TL+PE FKGVRKVI
Sbjct  137  GVGRRVVDILRSRGLPVKALVRNEEKARKMLGPDIDLIVADITKENTLVPEKFKGVRKVI  196

Query  629  NAVSVIXGP  655
            NAVSVI GP
Sbjct  197  NAVSVIVGP  205



>gb|KHG02784.1| hypothetical protein F383_26204 [Gossypium arboreum]
Length=606

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFL  361
            QL  + +  L ++   +LS  TYK   +   +Q WD GRF  TLY+FNGPPSP+K  EF+
Sbjct  55   QLNGRPKYRLNQRRSAYLSSATYKETISAE-KQGWDLGRFFKTLYFFNGPPSPAKIVEFI  113

Query  362  IEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF  541
            IEKLSG SP +  K M +S  +LV GATGGVGRRVV+  R KGL V+ALVRNEEKARKM 
Sbjct  114  IEKLSGSSPEESEKKMGTSDYVLVVGATGGVGRRVVNNFRKKGLPVKALVRNEEKARKML  173

Query  542  GEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            G D++LIVGDITK STL+ +YFKGV+KVINA SVI GP
Sbjct  174  GPDIELIVGDITKESTLVAQYFKGVKKVINAASVIIGP  211



>ref|XP_006648484.1| PREDICTED: uncharacterized protein LOC102714621 [Oryza brachyantha]
Length=628

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQ WD GRF+ TLY+FNGPP+P K  E +I   +G  PS+  K M++S ++LV G
Sbjct  102  IAFAGQQSWDIGRFVRTLYFFNGPPNPLKIVESIISSFTGSGPSEATKKMETSDVVLVTG  161

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVDILR KGL VR L RNEEKAR M G DVDLI+GD+TK +TL P+YFKG++
Sbjct  162  ATGGVGRRVVDILRKKGLPVRVLARNEEKARSMLGPDVDLIIGDVTKENTLDPKYFKGIK  221

Query  620  KVINAVSVIXGP  655
            KV+NAVSVI GP
Sbjct  222  KVVNAVSVIVGP  233



>gb|EEC72794.1| hypothetical protein OsI_06478 [Oryza sativa Indica Group]
Length=587

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQ WD GRF+ TLY+FNGPP+P K  E ++   +G +P +  K M+SS ++LV G
Sbjct  61   IAFAGQQSWDIGRFVRTLYFFNGPPNPLKIVESILSSFTGSAPGEVPKKMESSDVVLVTG  120

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVDILR+KG+ VR L RNEEKAR M G DVDLI+GD+TK ++L P+YFKG++
Sbjct  121  ATGGVGRRVVDILRNKGIPVRVLARNEEKARSMLGPDVDLIIGDVTKENSLDPKYFKGIK  180

Query  620  KVINAVSVIXGP  655
            KV+NAVSVI GP
Sbjct  181  KVVNAVSVIVGP  192



>ref|NP_001046381.1| Os02g0234500 [Oryza sativa Japonica Group]
 dbj|BAD27664.1| putative UOS1 [Oryza sativa Japonica Group]
 dbj|BAF08295.1| Os02g0234500 [Oryza sativa Japonica Group]
 dbj|BAG90704.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56622.1| hypothetical protein OsJ_06005 [Oryza sativa Japonica Group]
Length=587

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQ WD GRF+ TLY+FNGPP+P K  E ++   +G +P +  K M+SS ++LV G
Sbjct  61   IAFAGQQSWDIGRFVRTLYFFNGPPNPLKIVESILSSFTGSAPGEVPKKMESSDVVLVTG  120

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVDILR+KG+ VR L RNEEKAR M G DVDLI+GD+TK ++L P+YFKG++
Sbjct  121  ATGGVGRRVVDILRNKGIPVRVLARNEEKARSMLGPDVDLIIGDVTKENSLDPKYFKGIK  180

Query  620  KVINAVSVIXGP  655
            KV+NAVSVI GP
Sbjct  181  KVVNAVSVIVGP  192



>ref|XP_002451838.1| hypothetical protein SORBIDRAFT_04g008450 [Sorghum bicolor]
 gb|EES04814.1| hypothetical protein SORBIDRAFT_04g008450 [Sorghum bicolor]
Length=592

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQPWD GRF  TLY+FNGPP+P K  E +I   +GP+ S+  K M++S ++LV G
Sbjct  66   IAFAGQQPWDLGRFFKTLYFFNGPPNPLKIVESIISSFTGPASSEAPKKMETSDVVLVTG  125

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVDILR KG+ VR L RN +KAR M G DV+LI+GD+TK  TL P+ FKG++
Sbjct  126  ATGGVGRRVVDILRKKGIPVRVLARNGDKARSMLGPDVNLIIGDVTKEDTLDPKLFKGIK  185

Query  620  KVINAVSVIXGP  655
            KV+NAVSVI GP
Sbjct  186  KVVNAVSVIVGP  197



>ref|XP_003571881.1| PREDICTED: uncharacterized protein LOC100826457 [Brachypodium 
distachyon]
Length=593

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQ WD GRF  TL++FNGPP+P K  E ++  ++  +P++  K M +S ++LV G
Sbjct  67   IAFAGQQSWDIGRFARTLFFFNGPPNPLKIVESIMSSITASAPTEAPKKMQTSDVVLVTG  126

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVD+LR KGL VR LVRNEEKAR M G DVDLI+GD+TK  TL P+YFKG++
Sbjct  127  ATGGVGRRVVDVLRKKGLPVRVLVRNEEKARTMLGPDVDLIIGDVTKGDTLDPKYFKGIK  186

Query  620  KVINAVSVIXGP  655
            +VI+AVSVI GP
Sbjct  187  QVISAVSVIVGP  198



>gb|EMT20673.1| hypothetical protein F775_52263 [Aegilops tauschii]
Length=570

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 105/142 (74%), Gaps = 3/142 (2%)
 Frame = +2

Query  230  HLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSM  409
            HLS    +   A +G+Q WD GRF  TL++FNGPP+P K  E ++  ++  +P++  K  
Sbjct  75   HLS---RRSVIALAGKQSWDIGRFAKTLFFFNGPPNPLKIVESIMSSITASAPTEAPKKA  131

Query  410  DSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAST  589
            ++S ++LV GATGGVGRRVVD+LR KG+ VR LVRN EKAR M G DVDLI+GD+TK  T
Sbjct  132  ETSDVVLVTGATGGVGRRVVDVLRKKGVPVRVLVRNAEKARTMLGPDVDLIIGDVTKGDT  191

Query  590  LLPEYFKGVRKVINAVSVIXGP  655
            L P+YFKG++KVINAVSVI GP
Sbjct  192  LDPKYFKGIKKVINAVSVIVGP  213



>ref|XP_004951358.1| PREDICTED: uncharacterized protein LOC101762330 isoform X3 [Setaria 
italica]
Length=590

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQ WD GRF+ TLY+FNGPP+P K  E +I   +G + ++  K M++S ++LV G
Sbjct  66   IAFAGQQSWDIGRFVRTLYFFNGPPNPLKIVESIISSFTGSASTEVPKKMETSDVVLVTG  125

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVDILR KG+ VR L RN++KAR M G DVDLI+GD+TK  TL P+ FKG++
Sbjct  126  ATGGVGRRVVDILRKKGVPVRVLARNQDKARSMLGTDVDLIIGDVTKEDTLDPKLFKGIK  185

Query  620  KVINAVSVIXGP  655
            KV+NAVSVI GP
Sbjct  186  KVVNAVSVIVGP  197



>ref|XP_004951356.1| PREDICTED: uncharacterized protein LOC101762330 isoform X1 [Setaria 
italica]
Length=621

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQ WD GRF+ TLY+FNGPP+P K  E +I   +G + ++  K M++S ++LV G
Sbjct  66   IAFAGQQSWDIGRFVRTLYFFNGPPNPLKIVESIISSFTGSASTEVPKKMETSDVVLVTG  125

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVDILR KG+ VR L RN++KAR M G DVDLI+GD+TK  TL P+ FKG++
Sbjct  126  ATGGVGRRVVDILRKKGVPVRVLARNQDKARSMLGTDVDLIIGDVTKEDTLDPKLFKGIK  185

Query  620  KVINAVSVIXGP  655
            KV+NAVSVI GP
Sbjct  186  KVVNAVSVIVGP  197



>gb|EMS56081.1| putative complex I intermediate-associated protein 30 [Triticum 
urartu]
Length=769

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 105/142 (74%), Gaps = 3/142 (2%)
 Frame = +2

Query  230  HLSFTTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSM  409
            HLS    +   A +G+Q WD GRF  TL++FNGPP+P K  E ++  ++  +P++  K  
Sbjct  225  HLS---RRAVIALAGKQSWDIGRFAKTLFFFNGPPNPLKIVESIMSSITASAPTEAPKKA  281

Query  410  DSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAST  589
            ++S ++LV GATGG+GRRVVD+LR KG+ VR LVRN EKAR M G DVDLI+GD+TK  T
Sbjct  282  ETSDLVLVTGATGGIGRRVVDVLRKKGVPVRVLVRNAEKARTMLGPDVDLIIGDVTKGDT  341

Query  590  LLPEYFKGVRKVINAVSVIXGP  655
            L P+YFKG++KVINAVSVI GP
Sbjct  342  LDPKYFKGIKKVINAVSVIVGP  363



>gb|AFW65986.1| hypothetical protein ZEAMMB73_939804 [Zea mays]
Length=408

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQPWD GRF+ TLY+FNGPP+  K  E +I   +GP+ S+  K M++S ++LV G
Sbjct  64   IAFAGQQPWDIGRFVKTLYFFNGPPNLLKIVESIISSFTGPASSEVPKKMETSDVVLVTG  123

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVD+L+ KG+ VR L RN +KAR M G DV LI+GD+TK  TL P+ FKG++
Sbjct  124  ATGGVGRRVVDVLQKKGVPVRVLARNVDKARSMLGPDVPLIIGDVTKEDTLDPKLFKGIK  183

Query  620  KVINAVSVIXGP  655
            KV+NAVSVI GP
Sbjct  184  KVVNAVSVIVGP  195



>gb|AFW65985.1| hypothetical protein ZEAMMB73_939804 [Zea mays]
Length=510

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQPWD GRF+ TLY+FNGPP+  K  E +I   +GP+ S+  K M++S ++LV G
Sbjct  64   IAFAGQQPWDIGRFVKTLYFFNGPPNLLKIVESIISSFTGPASSEVPKKMETSDVVLVTG  123

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVD+L+ KG+ VR L RN +KAR M G DV LI+GD+TK  TL P+ FKG++
Sbjct  124  ATGGVGRRVVDVLQKKGVPVRVLARNVDKARSMLGPDVPLIIGDVTKEDTLDPKLFKGIK  183

Query  620  KVINAVSVIXGP  655
            KV+NAVSVI GP
Sbjct  184  KVVNAVSVIVGP  195



>ref|XP_008679815.1| PREDICTED: uncharacterized protein LOC103654777 [Zea mays]
 gb|AFW65983.1| hypothetical protein ZEAMMB73_939804 [Zea mays]
Length=590

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQPWD GRF+ TLY+FNGPP+  K  E +I   +GP+ S+  K M++S ++LV G
Sbjct  64   IAFAGQQPWDIGRFVKTLYFFNGPPNLLKIVESIISSFTGPASSEVPKKMETSDVVLVTG  123

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVD+L+ KG+ VR L RN +KAR M G DV LI+GD+TK  TL P+ FKG++
Sbjct  124  ATGGVGRRVVDVLQKKGVPVRVLARNVDKARSMLGPDVPLIIGDVTKEDTLDPKLFKGIK  183

Query  620  KVINAVSVIXGP  655
            KV+NAVSVI GP
Sbjct  184  KVVNAVSVIVGP  195



>gb|AFW65984.1| hypothetical protein ZEAMMB73_939804 [Zea mays]
Length=598

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQPWD GRF+ TLY+FNGPP+  K  E +I   +GP+ S+  K M++S ++LV G
Sbjct  64   IAFAGQQPWDIGRFVKTLYFFNGPPNLLKIVESIISSFTGPASSEVPKKMETSDVVLVTG  123

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVGRRVVD+L+ KG+ VR L RN +KAR M G DV LI+GD+TK  TL P+ FKG++
Sbjct  124  ATGGVGRRVVDVLQKKGVPVRVLARNVDKARSMLGPDVPLIIGDVTKEDTLDPKLFKGIK  183

Query  620  KVINAVSVIXGP  655
            KV+NAVSVI GP
Sbjct  184  KVVNAVSVIVGP  195



>gb|ABR17731.1| unknown [Picea sitchensis]
Length=587

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvaga  442
            A + ++ WD GRF  TLY+FNGPPSP+K F+ LI +LS  S  +     ++   +LVAGA
Sbjct  62   ADANRKQWDIGRFFQTLYFFNGPPSPAKLFQSLIGQLSSSSSRQSPTEKENMDTVLVAGA  121

Query  443  tggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRK  622
            TGGVG+RVVD+LR KG+ VRALVRN +KAR + G DVDL++GDITK  +L+PEYF+GV+K
Sbjct  122  TGGVGKRVVDVLRKKGIPVRALVRNADKARSLLGPDVDLVIGDITKEDSLIPEYFQGVKK  181

Query  623  VINAVSVIXGP  655
            VINAVSVI GP
Sbjct  182  VINAVSVIVGP  192



>gb|ACN39869.1| unknown [Picea sitchensis]
Length=587

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvaga  442
            A + ++ WD GRF  TLY+FNGPPSP+K F+ LI +LS  S  +     ++   +LVAGA
Sbjct  62   ADANRKQWDIGRFFQTLYFFNGPPSPAKLFQSLIGQLSSSSSRQSPTEKENMDTVLVAGA  121

Query  443  tggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRK  622
            TGGVG+RVVD+LR KG+ VRALVRN +KAR + G DVDL++GDITK  +L+PEYF+GV+K
Sbjct  122  TGGVGKRVVDVLRKKGIPVRALVRNADKARSLLGPDVDLVIGDITKEDSLIPEYFQGVKK  181

Query  623  VINAVSVIXGP  655
            VINAVSVI GP
Sbjct  182  VINAVSVIVGP  192



>ref|XP_006283353.1| hypothetical protein CARUB_v10004397mg [Capsella rubella]
 gb|EOA16251.1| hypothetical protein CARUB_v10004397mg [Capsella rubella]
Length=612

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 108/159 (68%), Gaps = 18/159 (11%)
 Frame = +2

Query  182  QLKIKAQPFLRKQSPLHLSFTTYKGPF-AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEF  358
            QL  +++P   +Q+   L   +Y+    A+SG Q WDFGRF+ TLY+FNGPPSP KF   
Sbjct  45   QLDDRSRPLRDQQASHSLILRSYRNRVTAKSGSQGWDFGRFVKTLYFFNGPPSPLKFVSS  104

Query  359  LIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKM  538
            + EKL+  S  +PVK M+++GIILVAGATGGVGRRVVDILR KGL V+A           
Sbjct  105  VFEKLTNGSTEEPVKEMETTGIILVAGATGGVGRRVVDILRKKGLPVKA-----------  153

Query  539  FGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
                  LIV DITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  154  ------LIVADITKENTLVPEKFKGVRKVINAVSVIVGP  186



>ref|XP_009783190.1| PREDICTED: uncharacterized protein LOC104231828 isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 122/206 (59%), Gaps = 45/206 (22%)
 Frame = +2

Query  50   CFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpC---HQLKIKAQPFLRKQ  220
            C+  V K   S SA+LNF+G SSVGV  S+KSL         C    +   K Q  + ++
Sbjct  4    CYFAVTKPSSSSSAILNFQGVSSVGVRSSQKSLRATPSQL--CWPFSRPNKKYQNLVYRR  61

Query  221  SPLHLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKP  397
            +  +LSF T+KGP  A++G+Q                                       
Sbjct  62   TSQNLSFKTFKGPILAEAGKQ---------------------------------------  82

Query  398  VKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDIT  577
            V SMDSSGI LV GATGGVGRRVVD+LR+K L VR LVRNEEKAR+M GEDVDL+VGD+T
Sbjct  83   VNSMDSSGITLVTGATGGVGRRVVDVLRNKRLHVRVLVRNEEKARRMLGEDVDLVVGDVT  142

Query  578  KASTLLPEYFKGVRKVINAVSVIXGP  655
            K++TLLPEYFKGV  VINAVSVI GP
Sbjct  143  KSNTLLPEYFKGVTSVINAVSVIVGP  168



>ref|XP_009631270.1| PREDICTED: uncharacterized protein LOC104121071 isoform X2 [Nicotiana 
tomentosiformis]
Length=563

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 123/207 (59%), Gaps = 46/207 (22%)
 Frame = +2

Query  50   CFCGVNK-TLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQL---KIKAQPFLRK  217
            C+  V K +  S SA+LNF+G SSVGV  S+KSL         C  L     K Q F+ +
Sbjct  4    CYFAVTKPSSSSSSAILNFQGVSSVGVRSSQKSLRAAPSQL--CWPLSRPNKKYQNFVYR  61

Query  218  QSPLHLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSK  394
            ++  +LSF T+KGP  A++G+Q                                      
Sbjct  62   RTSQNLSFKTFKGPILAEAGKQ--------------------------------------  83

Query  395  PVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDI  574
             V SMDSSGI LV GATGGVGRRVVD+LR+K L VR LVRNEEKAR+M G DVDL+VGD+
Sbjct  84   -VNSMDSSGITLVTGATGGVGRRVVDVLRNKRLPVRILVRNEEKARRMLGADVDLVVGDV  142

Query  575  TKASTLLPEYFKGVRKVINAVSVIXGP  655
            TK+STLLPEYFKGV  VINAVSVI GP
Sbjct  143  TKSSTLLPEYFKGVTSVINAVSVIVGP  169



>gb|EYU28115.1| hypothetical protein MIMGU_mgv1a0046271mg, partial [Erythranthe 
guttata]
Length=218

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 94/138 (68%), Gaps = 13/138 (9%)
 Frame = +2

Query  242  TTYKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSG  421
            ++   PF     +P+ + R LS   Y N     S   E            K VK+MD+SG
Sbjct  36   SSLSNPFLHHKFKPFGYDRNLS---YHNRTKRGSIRAE----------AEKQVKAMDNSG  82

Query  422  IILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPE  601
            +ILVAGATGGVGRRVVD+LR  G SVR LVRNEEKA++M G DVDLIVGDITKASTLLPE
Sbjct  83   VILVAGATGGVGRRVVDLLRKNGRSVRVLVRNEEKAKRMLGPDVDLIVGDITKASTLLPE  142

Query  602  YFKGVRKVINAVSVIXGP  655
            YFKGVR VINAVSVI GP
Sbjct  143  YFKGVRMVINAVSVIVGP  160



>ref|XP_010316841.1| PREDICTED: uncharacterized protein LOC101268540 isoform X2 [Solanum 
lycopersicum]
Length=553

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = +2

Query  320  FNGPPSPSKFFEFLIEKLSGP---SPSKPVKSMDSSGIILvagatggvgrrvvDILRSKG  490
             +GP   S+ F +  +   GP      K V SMDSSGI LV GATGGVGRRVVD+LR+K 
Sbjct  45   LSGPNKKSQNFVYRRKTFKGPILAEAGKQVNSMDSSGITLVTGATGGVGRRVVDVLRNKK  104

Query  491  LSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            LSVR LVRNEEKAR+M GEDVDL+VGD+TKASTLLPEYFKG+  VINAVSVI GP
Sbjct  105  LSVRVLVRNEEKARRMLGEDVDLVVGDVTKASTLLPEYFKGITSVINAVSVIVGP  159



>ref|XP_006358109.1| PREDICTED: uncharacterized protein LOC102598210 isoform X5 [Solanum 
tuberosum]
Length=554

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 118/203 (58%), Gaps = 47/203 (23%)
 Frame = +2

Query  50   CFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKAQPFLRKQSPL  229
            C+  V K   S S +LNF+G SS G   S+KSL  P  LS P  + + K Q F+ +Q   
Sbjct  4    CYFTVTKPSSSSSTILNFQGVSSFGGRSSQKSLGAPSYLSWPLSRPEKKHQNFVYRQK--  61

Query  230  HLSFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKS  406
                 T+KG   A++G+Q                                       V S
Sbjct  62   -----TFKGAILAEAGKQ---------------------------------------VNS  77

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            MDSSGI LV GATGGVGRRVVD+LR+K LSVR LVRNEEKAR+M GEDVDL+VGD+TKAS
Sbjct  78   MDSSGITLVTGATGGVGRRVVDVLRNKKLSVRVLVRNEEKARRMLGEDVDLVVGDVTKAS  137

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TLLPEYFKGV  VINAVS I GP
Sbjct  138  TLLPEYFKGVTSVINAVSAIVGP  160



>ref|XP_010999786.1| PREDICTED: uncharacterized protein LOC105107529 isoform X2 [Populus 
euphratica]
Length=544

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 98/212 (46%), Gaps = 71/212 (33%)
 Frame = +2

Query  44   MECFCGVNKTLPSCSAVLNFRGFSSVGVGYSEksllppfplskpCHQLKIKA---QPFLR  214
            MECF       P  S++LN +G SS+         +         H   + +   +PF +
Sbjct  1    MECFNPTKLCSPCTSSILNLQGSSSL---------VCNKFSKNSVHPWLLSSPPPKPFFQ  51

Query  215  KQSPLHL----SFTTYKGP-FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG  379
                L      +  TY+GP  A++G+Q WD GRFL TLY+FNGPPS              
Sbjct  52   LDDRLQFRQKSAHRTYRGPILAEAGKQGWDLGRFLKTLYFFNGPPS--------------  97

Query  380  PSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDL  559
              P+K                                       RNEEKARKM G D+DL
Sbjct  98   --PTK--------------------------------------ARNEEKARKMLGPDIDL  117

Query  560  IVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            I+GDITK STLLPEYFKGVRKVINA SVI GP
Sbjct  118  IIGDITKESTLLPEYFKGVRKVINAASVIVGP  149



>ref|XP_010316842.1| PREDICTED: uncharacterized protein LOC101268540 isoform X3 [Solanum 
lycopersicum]
Length=477

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            MDSSGI LV GATGGVGRRVVD+LR+K LSVR LVRNEEKAR+M GEDVDL+VGD+TKAS
Sbjct  1    MDSSGITLVTGATGGVGRRVVDVLRNKKLSVRVLVRNEEKARRMLGEDVDLVVGDVTKAS  60

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TLLPEYFKG+  VINAVSVI GP
Sbjct  61   TLLPEYFKGITSVINAVSVIVGP  83



>ref|XP_001752746.1| predicted protein [Physcomitrella patens]
 gb|EDQ82250.1| predicted protein [Physcomitrella patens]
Length=591

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKL-SGPSPSKPVKSMDSSGIILvag  439
            A+ G+QPWD GRF+ TLY+FNGPPS SKF   +++ +      S    +    G++LV G
Sbjct  63   AEGGRQPWDIGRFIQTLYFFNGPPSISKFVSSVMQSMVKEKEESGGSNNGRDGGLVLVTG  122

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVVD LR  G+ VRALVR+ EKA+ +   DVD++  DIT+++TLLPEYF+GV 
Sbjct  123  ATGGVGKRVVDELRKNGVQVRALVRSVEKAQNLLNSDVDIVAADITQSATLLPEYFEGVT  182

Query  620  KVINAVSVIXGP  655
             V+ A S I GP
Sbjct  183  SVVVAHSCIVGP  194



>ref|XP_011101430.1| PREDICTED: uncharacterized protein LOC105179488 isoform X7 [Sesamum 
indicum]
Length=553

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  389  SKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVG  568
            S+  K+MD+S IILVAGATGGVGRRVVD+LR KGL VR LVRNEEKAR+M G DVDLIVG
Sbjct  70   SEAEKAMDTSRIILVAGATGGVGRRVVDLLRKKGLPVRVLVRNEEKARRMLGPDVDLIVG  129

Query  569  DITKASTLLPEYFKGVRKVINAVSVIXGP  655
            DITKASTL+PEYFKGVR V+NAVSVI GP
Sbjct  130  DITKASTLIPEYFKGVRMVVNAVSVIVGP  158



>ref|XP_011101427.1| PREDICTED: uncharacterized protein LOC105179488 isoform X4 [Sesamum 
indicum]
Length=565

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  389  SKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVG  568
            S+  K+MD+S IILVAGATGGVGRRVVD+LR KGL VR LVRNEEKAR+M G DVDLIVG
Sbjct  82   SEAEKAMDTSRIILVAGATGGVGRRVVDLLRKKGLPVRVLVRNEEKARRMLGPDVDLIVG  141

Query  569  DITKASTLLPEYFKGVRKVINAVSVIXGP  655
            DITKASTL+PEYFKGVR V+NAVSVI GP
Sbjct  142  DITKASTLIPEYFKGVRMVVNAVSVIVGP  170



>ref|XP_011101428.1| PREDICTED: uncharacterized protein LOC105179488 isoform X5 [Sesamum 
indicum]
Length=564

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  389  SKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVG  568
            S+  K+MD+S IILVAGATGGVGRRVVD+LR KGL VR LVRNEEKAR+M G DVDLIVG
Sbjct  81   SEAEKAMDTSRIILVAGATGGVGRRVVDLLRKKGLPVRVLVRNEEKARRMLGPDVDLIVG  140

Query  569  DITKASTLLPEYFKGVRKVINAVSVIXGP  655
            DITKASTL+PEYFKGVR V+NAVSVI GP
Sbjct  141  DITKASTLIPEYFKGVRMVVNAVSVIVGP  169



>ref|XP_011101426.1| PREDICTED: uncharacterized protein LOC105179488 isoform X3 [Sesamum 
indicum]
Length=568

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  389  SKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVG  568
            S+  K+MD+S IILVAGATGGVGRRVVD+LR KGL VR LVRNEEKAR+M G DVDLIVG
Sbjct  85   SEAEKAMDTSRIILVAGATGGVGRRVVDLLRKKGLPVRVLVRNEEKARRMLGPDVDLIVG  144

Query  569  DITKASTLLPEYFKGVRKVINAVSVIXGP  655
            DITKASTL+PEYFKGVR V+NAVSVI GP
Sbjct  145  DITKASTLIPEYFKGVRMVVNAVSVIVGP  173



>ref|XP_011101429.1| PREDICTED: uncharacterized protein LOC105179488 isoform X6 [Sesamum 
indicum]
Length=554

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  401  KSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITK  580
            K+MD+S IILVAGATGGVGRRVVD+LR KGL VR LVRNEEKAR+M G DVDLIVGDITK
Sbjct  75   KAMDTSRIILVAGATGGVGRRVVDLLRKKGLPVRVLVRNEEKARRMLGPDVDLIVGDITK  134

Query  581  ASTLLPEYFKGVRKVINAVSVIXGP  655
            ASTL+PEYFKGVR V+NAVSVI GP
Sbjct  135  ASTLIPEYFKGVRMVVNAVSVIVGP  159



>ref|XP_011101431.1| PREDICTED: uncharacterized protein LOC105179488 isoform X8 [Sesamum 
indicum]
Length=550

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  401  KSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITK  580
            K+MD+S IILVAGATGGVGRRVVD+LR KGL VR LVRNEEKAR+M G DVDLIVGDITK
Sbjct  71   KAMDTSRIILVAGATGGVGRRVVDLLRKKGLPVRVLVRNEEKARRMLGPDVDLIVGDITK  130

Query  581  ASTLLPEYFKGVRKVINAVSVIXGP  655
            ASTL+PEYFKGVR V+NAVSVI GP
Sbjct  131  ASTLIPEYFKGVRMVVNAVSVIVGP  155



>ref|XP_011101432.1| PREDICTED: uncharacterized protein LOC105179488 isoform X9 [Sesamum 
indicum]
Length=478

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            MD+S IILVAGATGGVGRRVVD+LR KGL VR LVRNEEKAR+M G DVDLIVGDITKAS
Sbjct  1    MDTSRIILVAGATGGVGRRVVDLLRKKGLPVRVLVRNEEKARRMLGPDVDLIVGDITKAS  60

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TL+PEYFKGVR V+NAVSVI GP
Sbjct  61   TLIPEYFKGVRMVVNAVSVIVGP  83



>ref|XP_002976078.1| hypothetical protein SELMODRAFT_175261 [Selaginella moellendorffii]
 gb|EFJ22983.1| hypothetical protein SELMODRAFT_175261 [Selaginella moellendorffii]
Length=581

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 97/150 (65%), Gaps = 11/150 (7%)
 Frame = +2

Query  236  SFTTYKG--------PFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPS  391
            SFT++ G        P   +    WDFGRFL T+++FN P  P K  + + E+ +    +
Sbjct  38   SFTSHPGRTKLACSSPSQAAAVASWDFGRFLKTVFFFNEPSFP-KLVQSITERFTKSREA  96

Query  392  KPVKS--MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIV  565
             P+ +    +  ++LV GATGGVG+RVVD+LR KG+ VR LVRN EKAR + G D D++ 
Sbjct  97   VPMAASKAKNGDLVLVTGATGGVGKRVVDVLRKKGIPVRVLVRNTEKARTLLGPDTDIVT  156

Query  566  GDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            GD+TK +TLLP YF GV+KVI+A SVI GP
Sbjct  157  GDVTKKATLLPHYFHGVKKVISAASVIVGP  186



>gb|KDP21131.1| hypothetical protein JCGZ_21602 [Jatropha curcas]
Length=478

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            MDSSGI+LV GATGGVG+RVVD+LR KGL VR LVRN EKARK+ G ++DLIVGDITK S
Sbjct  1    MDSSGIVLVVGATGGVGKRVVDVLREKGLPVRVLVRNAEKARKLLGSNIDLIVGDITKES  60

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TL+PEYFKGVRKVINA SVI GP
Sbjct  61   TLVPEYFKGVRKVINAASVIVGP  83



>ref|XP_008225254.1| PREDICTED: uncharacterized protein LOC103324919 [Prunus mume]
Length=319

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            M++SGI+LVAGATGGVGRR V  LR KGL VR LVRNEEKARKM G DVDLIVGDITK S
Sbjct  1    METSGIVLVAGATGGVGRRGVAALRKKGLPVRVLVRNEEKARKMLGPDVDLIVGDITKES  60

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TL+P+YFKGVR+VINAVSVI GP
Sbjct  61   TLVPDYFKGVRRVINAVSVIVGP  83



>ref|XP_010529213.1| PREDICTED: uncharacterized protein LOC104806167 isoform X2 [Tarenaya 
hassleriana]
Length=478

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            M++SG+ILVAGATGGVGRRVVDIL  KGL V+ALVRNEEKARKM G D+DLIVGDITK +
Sbjct  1    METSGVILVAGATGGVGRRVVDILMKKGLPVKALVRNEEKARKMLGPDIDLIVGDITKEN  60

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TL+PE FKGVRKVINAVSVI GP
Sbjct  61   TLVPEKFKGVRKVINAVSVIVGP  83



>ref|XP_003606736.1| UOS1, partial [Medicago truncatula]
Length=386

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            M +S I+LVAGATGGVGRRVVD LR KG+ VR LVRNEEKARKM G DVDL++GDITK S
Sbjct  1    MGTSDIVLVAGATGGVGRRVVDELRKKGIPVRVLVRNEEKARKMLGSDVDLVIGDITKDS  60

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TL+PEYFKGV+KVINAVSVI GP
Sbjct  61   TLIPEYFKGVKKVINAVSVIVGP  83



>ref|XP_003629827.1| UOS1 [Medicago truncatula]
 gb|AET04303.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=478

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            M +S I+LVAGATGGVGRRVVD LR KG+ VR LVRNEEKARKM G DVDL++GDITK S
Sbjct  1    MGTSDIVLVAGATGGVGRRVVDELRKKGIPVRVLVRNEEKARKMLGSDVDLVIGDITKDS  60

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TL+PEYFKGV+KVINAVSVI GP
Sbjct  61   TLIPEYFKGVKKVINAVSVIVGP  83



>ref|XP_004504281.1| PREDICTED: uncharacterized protein LOC101492899 isoform X2 [Cicer 
arietinum]
Length=478

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  407  MDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKAS  586
            M +S I+LVAGATGGVGRRVVD LR +G+ VR LVRNEEKAR+M G DVDL+VGDITK S
Sbjct  1    MGTSDIVLVAGATGGVGRRVVDELRKRGIPVRVLVRNEEKARRMLGSDVDLVVGDITKDS  60

Query  587  TLLPEYFKGVRKVINAVSVIXGP  655
            TL+PEYFKGV+KVINAVSVI GP
Sbjct  61   TLIPEYFKGVKKVINAVSVIVGP  83



>ref|XP_004951357.1| PREDICTED: uncharacterized protein LOC101762330 isoform X2 [Setaria 
italica]
Length=591

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  344  KFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrvvDILRSKGLSVRALVRNEE  523
            +  E +I   +G + ++  K M++S ++LV GATGGVGRRVVDILR KG+ VR L RN++
Sbjct  64   EIVESIISSFTGSASTEVPKKMETSDVVLVTGATGGVGRRVVDILRKKGVPVRVLARNQD  123

Query  524  KARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            KAR M G DVDLI+GD+TK  TL P+ FKG++KV+NAVSVI GP
Sbjct  124  KARSMLGTDVDLIIGDVTKEDTLDPKLFKGIKKVVNAVSVIVGP  167



>gb|KJB66859.1| hypothetical protein B456_010G161400 [Gossypium raimondii]
 gb|KJB66860.1| hypothetical protein B456_010G161400 [Gossypium raimondii]
Length=478

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  476  LRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            LR KGL V+ALVRNEEKARKM G D++LIVGDITK STL+ +YFKGV+KVINA SVI GP
Sbjct  24   LRKKGLPVKALVRNEEKARKMLGPDIELIVGDITKESTLVAQYFKGVKKVINAASVIIGP  83



>ref|XP_002968299.1| hypothetical protein SELMODRAFT_170011 [Selaginella moellendorffii]
 gb|EFJ30553.1| hypothetical protein SELMODRAFT_170011 [Selaginella moellendorffii]
Length=483

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  470  DILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIX  649
            D+LR KG+ VR LVRN EKAR + G D D++ GD+TK +TL P YF GV+KVI+A SVI 
Sbjct  27   DVLRKKGIPVRVLVRNTEKARTLLGPDTDIVTGDVTKKATLQPHYFHGVKKVISAASVIV  86

Query  650  GP  655
            GP
Sbjct  87   GP  88



>gb|AFW65982.1| hypothetical protein ZEAMMB73_939804 [Zea mays]
Length=151

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A +GQQPWD GRF+ TLY+FNGPP+  K  E +I   +GP+ S+  K M++S ++LV G
Sbjct  64   IAFAGQQPWDIGRFVKTLYFFNGPPNLLKIVESIISSFTGPASSEVPKKMETSDVVLVTG  123

Query  440  atggvgrrvvDILRSKGLSVRALVRNE  520
            ATGGVGRRVVD+L+ KG+ VR L R E
Sbjct  124  ATGGVGRRVVDVLQKKGVPVRVLFRLE  150



>ref|XP_001700919.1| protein with predicted nucleoside-diphosphate-sugar epimerase 
activity [Chlamydomonas reinhardtii]
 gb|EDP07173.1| protein with predicted nucleoside-diphosphate-sugar epimerase 
activity [Chlamydomonas reinhardtii]
Length=461

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 87/152 (57%), Gaps = 21/152 (14%)
 Frame = +2

Query  248  YKGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMD-----  412
            +KG  A  G+QPWDF RF+ T+ YFN  PSP K  + L+++LS       V  ++     
Sbjct  5    HKG-VAAGGRQPWDFFRFVKTVAYFNELPSPDKLLQGLVKQLSPQGAGDSVVPVELPQAS  63

Query  413  --------SSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF-------GE  547
                     +GI++V GATGGVGRRVV  L + G  VRALVR+ EKAR M        G 
Sbjct  64   SSGAVEVPITGIVMVTGATGGVGRRVVARLLAAGKHVRALVRDLEKARGMLSDLPVAPGG  123

Query  548  DVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
             ++L   D+T+  TLLPE F+GVR V+   +V
Sbjct  124  KLELAAADVTQRQTLLPEMFEGVRAVVCCTAV  155



>ref|XP_002949080.1| hypothetical protein VOLCADRAFT_89408 [Volvox carteri f. nagariensis]
 gb|EFJ50015.1| hypothetical protein VOLCADRAFT_89408 [Volvox carteri f. nagariensis]
Length=601

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 85/151 (56%), Gaps = 22/151 (15%)
 Frame = +2

Query  269  SGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMD------------  412
            SG+QPWD  RFL T+ YFN  P+P K    ++++L+  SP + V  +D            
Sbjct  12   SGRQPWDVLRFLKTVAYFNELPTPDKVLANMLKQLNPQSPVESVVPVDLPPAPASAATIA  71

Query  413  ---SSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGE-------DVDLI  562
                +GII+V GATGGVGRRVV  L + G  VRALVR+ EKA+ M  E        ++L 
Sbjct  72   KVPLTGIIMVTGATGGVGRRVVSRLLAAGKHVRALVRDLEKAKSMLSELPVAAGGKLELA  131

Query  563  VGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
              D+ +  TLLPE F+GVR V+   +V   P
Sbjct  132  AADVVQRQTLLPEMFEGVRAVVCCTAVKVTP  162



>ref|WP_035150436.1| NADH:ubiquinone oxidoreductase [Calothrix sp. 336/3]
 gb|KFB82257.1| NADH:ubiquinone oxidoreductase [Calothrix sp. 336/3]
Length=497

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 80/134 (60%), Gaps = 3/134 (2%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVK--SMDSSGIILv  433
              +  ++ WD  RF+ TL YF   P P  + + LI  LSG SPS   +       G+ILV
Sbjct  1    MTEKKRESWDLSRFIQTLSYFEVAP-PINWIQNLINNLSGKSPSNQNQPSGAKKVGVILV  59

Query  434  agatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKG  613
            AGATGGVG+RVV  L S+G  VR LVR+ +KAR + G++VDL++GDIT+  TL P     
Sbjct  60   AGATGGVGKRVVKKLISQGYPVRCLVRDIDKARAILGDEVDLVLGDITQPETLSPLVVGN  119

Query  614  VRKVINAVSVIXGP  655
            ++ VI   +V   P
Sbjct  120  IQAVICCTAVRVQP  133



>ref|WP_011319070.1| hypothetical protein [Anabaena variabilis]
 gb|ABA21904.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=493

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 79/134 (59%), Gaps = 6/134 (4%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG-PSPSKP-VKSMDSSGIILv  433
             A   +  W+  RF+ TL YF   P    F  ++ + + G P  ++P     ++ G+ILV
Sbjct  1    MADKNRSQWNLCRFIETLTYFEVIP----FLNWVQQLIQGRPQDNQPRTDGENNMGVILV  56

Query  434  agatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKG  613
            AGATGGVG+RVV  LR +G  VRALVR+ +KAR + G+DVDL+V DITK  TL P     
Sbjct  57   AGATGGVGKRVVRKLRERGEKVRALVRDIDKARSILGDDVDLVVADITKPETLTPMVMAN  116

Query  614  VRKVINAVSVIXGP  655
            ++ VI   +V   P
Sbjct  117  IQAVICCTAVRIQP  130



>ref|WP_010999152.1| hypothetical protein [Nostoc sp. PCC 7120]
 dbj|BAB76725.1| all5026 [Nostoc sp. PCC 7120]
Length=493

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 78/134 (58%), Gaps = 6/134 (4%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG-PSPSKP-VKSMDSSGIILv  433
             A   +  W+  RF+ TL YF   P    F  ++ + + G P   +P     ++ G+ILV
Sbjct  1    MADKNRSQWNLCRFIETLTYFEVIP----FLNWVQQLIQGRPQDYQPRTDGENNMGVILV  56

Query  434  agatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKG  613
            AGATGGVG+RVV  LR +G  VRALVR+ +KAR + G+DVDL+V DITK  TL P     
Sbjct  57   AGATGGVGKRVVQKLRERGEKVRALVRDIDKARSILGDDVDLVVADITKPETLTPIVMAN  116

Query  614  VRKVINAVSVIXGP  655
            ++ VI   +V   P
Sbjct  117  IQAVICCTAVRVQP  130



>ref|WP_037224336.1| NADH:ubiquinone oxidoreductase [Richelia intracellularis]
 emb|CDN16871.1| similar to nucleoside-diphosphate-sugar epimerases [Richelia 
intracellularis]
Length=492

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 78/132 (59%), Gaps = 7/132 (5%)
 Frame = +2

Query  266  QSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSS--GIILvag  439
             S + PW+FGR   TL YF   P  S      ++K+   S  K ++       G++LVAG
Sbjct  3    NSDRSPWNFGRLFQTLDYFEIIPVFS-----WVKKVLNKSEKKRIQPNGGKVMGLVLVAG  57

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVV+ L+++G  VRALVR+ +KAR + G D DL+V DITK  TL+P     ++
Sbjct  58   ATGGVGKRVVNKLQAQGYQVRALVRDMDKARNILGNDTDLVVADITKPETLIPMVMGNIQ  117

Query  620  KVINAVSVIXGP  655
             VI   SV   P
Sbjct  118  AVICCTSVRVQP  129



>ref|WP_015131038.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Calothrix sp. PCC 7507]
 gb|AFY35243.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Calothrix sp. PCC 7507]
Length=494

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRF+ TL YF   P  + + + LI+     +  +P+   +  G+ILVAGATGGVG+R
Sbjct  9    WDLGRFIETLTYFEVIPFLN-WVQQLIQGRPQDNEKRPIGGRNV-GVILVAGATGGVGKR  66

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L+ +G  VR LVR+ ++AR + G DVDL+V DITK+ TL P     ++ VI   +V
Sbjct  67   VVKRLKERGDQVRCLVRDIDRARAILGNDVDLVVADITKSDTLTPVVLANIQAVICCTAV  126

Query  644  IXGP  655
               P
Sbjct  127  RVQP  130



>ref|WP_016878104.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Chlorogloeopsis fritschii]
Length=494

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 74/126 (59%), Gaps = 6/126 (5%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVK--SMDSSGIILvagatggvg  457
            WD GRF+ TL YF   P    F  ++ E   G + +   K       G+ILVAGATGGVG
Sbjct  9    WDLGRFIQTLTYFEVIP----FLNWIQELFQGSAKNNQDKPDGAKQVGVILVAGATGGVG  64

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAV  637
            +RVV  L  +G  VR+LVR+ +KAR + G++VDL+VGDITK  TL P     ++ V+   
Sbjct  65   KRVVRRLVERGYRVRSLVRDIDKARSILGDNVDLVVGDITKPETLTPLVMANIQAVVCCT  124

Query  638  SVIXGP  655
            +V   P
Sbjct  125  AVRVQP  130



>ref|WP_015141536.1| NmrA-like family protein [Nostoc sp. PCC 7524]
 gb|AFY51135.1| NmrA-like family protein [Nostoc sp. PCC 7524]
Length=492

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 73/125 (58%), Gaps = 6/125 (5%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG-PSPSKPVKSMDSSGIILvagatggvgr  460
            WD GRFL TL YF   P       ++ + + G P   +P     S G++LVAGATGGVG+
Sbjct  9    WDLGRFLETLTYFEVIP----LLNWVQQLIQGRPQDYRP-DGGKSVGVVLVAGATGGVGK  63

Query  461  rvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVS  640
            RVV  L   G+ VRALVR+ +KAR + G DVDL++ DITK  TL P     ++ VI   +
Sbjct  64   RVVKRLLETGVKVRALVRDIDKARSILGHDVDLVLADITKPETLTPVVMANIQAVICCTA  123

Query  641  VIXGP  655
            V   P
Sbjct  124  VRVQP  128



>ref|WP_017323313.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [cyanobacterium PCC 7702]
Length=494

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 68/132 (52%), Gaps = 2/132 (2%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
              Q     WD GRF+ TL +F   P  S + + L     G SP K   +   + +++   
Sbjct  1    MTQKNSAKWDLGRFIQTLTFFEVIPLVS-WIQNLFRANVGGSPKKADGARQVAAVLVAGA  59

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
              G   R V  +L  +G +VR+LVRN +KAR + G ++DL+ GDITK  TL    F G++
Sbjct  60   TGGVGRRVVRRLLE-EGYTVRSLVRNLDKARAILGNEIDLVFGDITKPETLNSCVFAGIQ  118

Query  620  KVINAVSVIXGP  655
             VI + +V   P
Sbjct  119  AVICSTAVRVQP  130



>ref|WP_017651686.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Microchaete sp. PCC 7126]
Length=500

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 77/124 (62%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRF+ TL YF   P  + + + LI+       ++P+    + G+ILVAGATGGVG+R
Sbjct  9    WDLGRFIETLTYFEVIPFLN-WVQQLIQGRPQKYENQPIGG-SNVGVILVAGATGGVGKR  66

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L+++G  VR LVR+ +KA+ + G+DVDL+V DITK  TL P     ++ VI   +V
Sbjct  67   VVRRLKARGEKVRCLVRDIDKAKAILGDDVDLVVADITKPETLTPVVMANIQAVICCTAV  126

Query  644  IXGP  655
               P
Sbjct  127  RVQP  130



>ref|WP_039716664.1| NADH:ubiquinone oxidoreductase [Scytonema millei]
 gb|KIF19171.1| NADH:ubiquinone oxidoreductase [Scytonema millei VB511283]
Length=494

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 75/126 (60%), Gaps = 7/126 (6%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPS--PSKPVKSMDSSGIILvagatggvg  457
            WD GRF+ TL YF   P     + +L + L G +  P   +      G+ILVAGATGGVG
Sbjct  9    WDAGRFIRTLAYFEAIPG----WSWLKQILPGVADKPENYLSGGKQVGVILVAGATGGVG  64

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAV  637
            +RVV  L  +G  VR+LVR+++KAR + G DV++ VGDIT+  TL PE    VR VI   
Sbjct  65   KRVVQRLLERGYQVRSLVRDKDKARSILG-DVEIYVGDITQPETLTPEMMANVRVVICCT  123

Query  638  SVIXGP  655
            +V   P
Sbjct  124  AVRVQP  129



>gb|KIE07000.1| NADH:ubiquinone oxidoreductase [Tolypothrix bouteillei VB521301]
Length=492

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG-PSPSKPVKSMDSSGIILva  436
             A + +  WD GRFL TL YF   P    F  +L +   G P     +      G+ILVA
Sbjct  1    MADNNRSQWDLGRFLETLTYFEVIP----FLNWLQDLFQGRPHNKDRLDGAKQVGVILVA  56

Query  437  gatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGV  616
            GATGG+G+RVV  L  +G  VR+LVR+ +KAR + G D +L+V DIT   TL P     +
Sbjct  57   GATGGLGKRVVGQLLQRGYKVRSLVRDIDKARSLLGNDTELVVADITNPETLTPLIAANI  116

Query  617  RKVINAVSVIXGP  655
            + V+   +V   P
Sbjct  117  QAVVCCTAVRVQP  129



>ref|WP_015113169.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Nostoc sp. PCC 7107]
 gb|AFY42954.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Nostoc sp. PCC 7107]
Length=494

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 71/127 (56%), Gaps = 8/127 (6%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPV---KSMDSSGIILvagatggv  454
            WD GRF+ TL YF   P     F   I+KL    P K         S G+ILVAGATGG+
Sbjct  9    WDLGRFIKTLSYFEVIP-----FLNCIQKLIQGRPQKTTSRPNGEKSVGVILVAGATGGL  63

Query  455  grrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINA  634
            G+RVV  L  +G  VR LVR+ EKAR + G+DVDL+V DITK  TL       ++ VI  
Sbjct  64   GKRVVKRLVKRGYQVRGLVRDIEKARSILGDDVDLVVADITKPETLNTLVMANIQAVICF  123

Query  635  VSVIXGP  655
             +V   P
Sbjct  124  TAVRVQP  130



>ref|WP_015200706.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Calothrix parietina]
 gb|AFZ04096.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Calothrix sp. PCC 6303]
Length=495

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 70/126 (56%), Gaps = 5/126 (4%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKP--VKSMDSSGIILvagatggvg  457
            WD GRF+ TL YF   P  +     L  K    S ++P   K M   G+ILVAGATGGVG
Sbjct  9    WDLGRFIQTLNYFEVVPPLNWIQNILQGKFFQNSQNQPDGAKKM---GVILVAGATGGVG  65

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAV  637
            +RVV  L  +G  VR LVR+ EKAR + G D DLIV DITK  TL       ++ VI   
Sbjct  66   KRVVQRLLQQGYRVRCLVRDIEKARNILGNDTDLIVADITKPETLNELVMSNIQAVICCT  125

Query  638  SVIXGP  655
            SV   P
Sbjct  126  SVRVQP  131



>ref|WP_006196301.1| hypothetical protein [Nodularia spumigena]
 gb|EAW45470.1| hypothetical protein N9414_03960 [Nodularia spumigena CCY9414]
Length=499

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 75/124 (60%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRF+ TL YF   P  + + + LI+  S  + + P     + G+ILVAGATGGVG+R
Sbjct  9    WDLGRFIETLTYFEVFPLLN-WVQQLIQGGSNDNQNLP-NGGRNVGVILVAGATGGVGKR  66

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L  +G  VRALVR+ +KAR + G+DVDL+ GDITK  TL       ++ VI   SV
Sbjct  67   VVRRLVERGEKVRALVRDIDKARSILGDDVDLVAGDITKPETLNSLVMANIQAVICCTSV  126

Query  644  IXGP  655
               P
Sbjct  127  RVQP  130



>ref|WP_027845680.1| NADH:ubiquinone oxidoreductase [Mastigocoleus testarum]
Length=497

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 69/127 (54%), Gaps = 2/127 (2%)
 Frame = +2

Query  275  QQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggv  454
            ++ WDFGRF+ TL YF   P  S    F   K       K        G+ILVAGATGGV
Sbjct  6    RETWDFGRFIKTLDYFEIIPFWSCIQNFF--KGKSQDNKKETNGSKQMGVILVAGATGGV  63

Query  455  grrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINA  634
            G+RVV  L ++G  VR LVRN  KAR + G+DVDL + DITK  TL       ++ VI  
Sbjct  64   GKRVVQKLVNRGYQVRCLVRNLNKARSILGDDVDLAIADITKPETLTYGVAGNIQAVICC  123

Query  635  VSVIXGP  655
             +V   P
Sbjct  124  TAVRVQP  130



>ref|WP_017747824.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Scytonema hofmanni]
Length=493

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 14/138 (10%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMD------SSG  421
             A + +  WD GRF+ TL YF   P    F  ++ +   G    +P+ + D        G
Sbjct  1    MADNNRSQWDLGRFIETLTYFEVIP----FLNWIQDLFQG----RPIHNKDRLDGAKQVG  52

Query  422  IILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPE  601
            +ILVAGATGG+G+RVV  L  +G  VR+LVR+ +KAR + G D +L+V DITK  TL P 
Sbjct  53   VILVAGATGGLGKRVVGQLLQRGYKVRSLVRDIDKARSLLGNDTELVVADITKPETLTPL  112

Query  602  YFKGVRKVINAVSVIXGP  655
                ++ V+   +V   P
Sbjct  113  IAANIQAVVCCTAVRVQP  130



>ref|WP_041032572.1| NADH:ubiquinone oxidoreductase [Tolypothrix campylonemoides]
 gb|KIJ78392.1| NADH:ubiquinone oxidoreductase [Tolypothrix campylonemoides VB511288]
Length=495

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 75/134 (56%), Gaps = 6/134 (4%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSS--GIILv  433
             A + +  WD GRF+ TL YF   P    F  ++ + + G S S    S  +   G+ILV
Sbjct  1    MANNNRSQWDLGRFIQTLTYFEVIP----FLNWIQDFIQGRSHSSSDISNGAKQMGVILV  56

Query  434  agatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKG  613
            AG TGGVG+RVV  L  +   VRALVR+ +KAR + G DV+L+V DITK  TL       
Sbjct  57   AGGTGGVGQRVVRRLLEQNYKVRALVRDIDKARSILGNDVELVVADITKPETLTSLVMAD  116

Query  614  VRKVINAVSVIXGP  655
            ++ VI A +V   P
Sbjct  117  IQAVICATAVRVQP  130



>ref|WP_026735574.1| NADH:ubiquinone oxidoreductase [Fischerella sp. PCC 9605]
Length=494

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRF+ TL YF   P  + + + L +  S     KP       G+ILVAGATGGVG+R
Sbjct  9    WDLGRFVQTLTYFEVIPLVN-WIQDLFQGRSKDRQDKP-DGAKQVGVILVAGATGGVGKR  66

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L ++G  VR+LVR+ EKAR + G+  DL+V DITK  TL P     ++ VI   +V
Sbjct  67   VVRRLVAQGYKVRSLVRDIEKARTILGDSTDLVVADITKPETLTPLVMANIQAVICCTAV  126

Query  644  IXGP  655
               P
Sbjct  127  RVQP  130



>ref|WP_008274624.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ92387.1| hypothetical protein CY0110_28549 [Cyanothece sp. CCY0110]
Length=489

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 75/132 (57%), Gaps = 4/132 (3%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             ++  ++PWDF RF++TL  F   P    F   L ++    +   P +   + G+ILV G
Sbjct  1    MSEKKRKPWDFRRFITTLNDFELIP----FISDLQKRFKKNNRISPKQKNSTMGMILVTG  56

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVV  L S+   VRALVR++E A+ +F E V+L+ GD+T+  TL P     V 
Sbjct  57   ATGGVGKRVVARLLSQNYHVRALVRDKEAAKSLFDERVELVQGDVTRPETLTPRLLDNVS  116

Query  620  KVINAVSVIXGP  655
             VI+ V     P
Sbjct  117  AVISCVGTRVQP  128



>ref|WP_007304974.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii]
 gb|EAM51462.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 8501]
 emb|CCQ61075.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 0401]
 emb|CCQ52384.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 8502]
Length=489

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 77/133 (58%), Gaps = 6/133 (5%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVK-SMDSSGIILva  436
             ++  ++ WD GRFL+TL YF   P  S      ++KL  PS    V  + D+  +ILV 
Sbjct  1    MSEKERKSWDLGRFLNTLNYFELIPFVSD-----LQKLFQPSDRPSVNLNNDTMSMILVT  55

Query  437  gatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGV  616
            GATGGVG+RVV  L  +   VRALVR+ E A+ +F E V+LI GD+T+  TL P+  + V
Sbjct  56   GATGGVGKRVVRRLLEQNYYVRALVRDIEAAKPLFDEKVELIQGDVTRPETLTPKLLENV  115

Query  617  RKVINAVSVIXGP  655
              VI+ V     P
Sbjct  116  SAVISCVGTRVQP  128



>ref|WP_009633206.1| NmrA-like family protein [Synechocystis sp. PCC 7509]
Length=489

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 73/124 (59%), Gaps = 5/124 (4%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRF+ TL YF+  P    F   L   LSG + +K      S GI+LVAGATGGVG+R
Sbjct  8    WDIGRFVKTLAYFDIIP----FIGCLQRLLSG-NDNKNRFIGKSMGIVLVAGATGGVGKR  62

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L   G  VR LVRN ++A+ +  ++V+LI GDITK  TL PE    V+ VI   SV
Sbjct  63   VVQKLVDLGYQVRCLVRNCDRAKSILPQNVELIEGDITKPETLTPELMANVQAVICCTSV  122

Query  644  IXGP  655
               P
Sbjct  123  KVQP  126



>ref|WP_021832890.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii]
 emb|CCQ55699.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 0005]
Length=489

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 77/133 (58%), Gaps = 6/133 (5%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVK-SMDSSGIILva  436
             ++  ++ WD GRFL+TL YF   P  S      ++KL  PS    V  + D+  +ILV 
Sbjct  1    MSEKERKSWDLGRFLNTLNYFELIPFVSD-----LQKLFQPSDRPSVNLNNDTMSMILVT  55

Query  437  gatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGV  616
            GATGGVG+RVV  L  +   VRALVR+ E A+ +F E V+LI GD+T+  TL P+  + V
Sbjct  56   GATGGVGKRVVRRLLEQNYYVRALVRDIEAAKPLFDEKVELIQGDVTRPETLTPKLLENV  115

Query  617  RKVINAVSVIXGP  655
              VI+ V     P
Sbjct  116  SAVISCVGTRVQP  128



>ref|WP_007309137.1| hypothetical Transposase-like protein, IS200/IS605 family, partial 
[Crocosphaera watsonii]
 gb|EHJ14809.1| hypothetical Transposase-like protein, IS200/IS605 family, partial 
[Crocosphaera watsonii WH 0003]
Length=485

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 77/133 (58%), Gaps = 6/133 (5%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVK-SMDSSGIILva  436
             ++  ++ WD GRFL+TL YF   P  S      ++KL  PS    V  + D+  +ILV 
Sbjct  1    MSEKERKSWDLGRFLNTLNYFELIPFVSD-----LQKLFQPSDRPSVNLNNDTMSMILVT  55

Query  437  gatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGV  616
            GATGGVG+RVV  L  +   VRALVR+ E A+ +F E V+LI GD+T+  TL P+  + V
Sbjct  56   GATGGVGKRVVRRLLEQNYYVRALVRDIEAAKPLFDEKVELIQGDVTRPETLTPKLLENV  115

Query  617  RKVINAVSVIXGP  655
              VI+ V     P
Sbjct  116  SAVISCVGTRVQP  128



>ref|XP_010057127.1| PREDICTED: uncharacterized protein LOC104445030 isoform X2 [Eucalyptus 
grandis]
 gb|KCW74151.1| hypothetical protein EUGRSUZ_E02785 [Eucalyptus grandis]
Length=435

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  536  MFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            M G DVDL+VGDITK STL PE F+GVRKVINAVSVI GP
Sbjct  1    MLGPDVDLVVGDITKESTLAPENFRGVRKVINAVSVIVGP  40



>ref|WP_015154354.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Chroococcidiopsis thermalis]
 gb|AFY87806.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Chroococcidiopsis thermalis PCC 7203]
Length=495

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 72/126 (57%), Gaps = 6/126 (5%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPS--PSKPVKSMDSSGIILvagatggvg  457
            WD GRF+ TL YF   P     + +L + L G +  P   +      G+ILVAGATGGVG
Sbjct  9    WDAGRFIRTLAYFEAIPG----WSWLKQILPGVADKPENYLSGGKQVGVILVAGATGGVG  64

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAV  637
            +RVV  L  +G  VR+LVR+++KA  + G +V+  VGDIT+  TL P     VR VI   
Sbjct  65   KRVVQRLLERGYQVRSLVRDKDKASSILGNNVETYVGDITQPETLTPAMMANVRAVICCT  124

Query  638  SVIXGP  655
            +V   P
Sbjct  125  AVRVQP  130



>ref|WP_015078922.1| hypothetical protein [Anabaena sp. 90]
 gb|AFW93758.1| hypothetical protein ANA_C10968 [Anabaena sp. 90]
Length=494

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 79/136 (58%), Gaps = 10/136 (7%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSG----II  427
             + + +  WD  RF+ TL YF   P  +      IEKL   SP K  + +  +G    +I
Sbjct  1    MSNNDRSQWDLCRFIKTLTYFEVFPVLN-----WIEKLFQGSP-KDHQDISKAGGNMAVI  54

Query  428  LvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYF  607
            LVAGATGGVG+RVV  L ++G +VR LVR+  KAR + G+D+DL+VGDITK+ TL     
Sbjct  55   LVAGATGGVGKRVVKKLIAQGYNVRCLVRDIAKARTILGDDIDLVVGDITKSETLTSLVM  114

Query  608  KGVRKVINAVSVIXGP  655
              ++ VI   SV   P
Sbjct  115  ANIQAVICCTSVRVQP  130



>ref|WP_012412749.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Nostoc punctiforme]
 gb|ACC84813.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Nostoc punctiforme PCC 73102]
Length=494

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 73/130 (56%), Gaps = 14/130 (11%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMD------SSGIILvagat  445
            WD GRFL TL YF   P    F  ++ + + G     P  + D      + G+ILVAGAT
Sbjct  9    WDLGRFLETLTYFEVIP----FLNWVQQLIQG----HPKDNQDRPNGGRNVGVILVAGAT  60

Query  446  ggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKV  625
            GGVG+RVV     +G  VRALVR+ +KAR + G D+DL+V DIT+  TL P     ++ V
Sbjct  61   GGVGKRVVQRSLQQGYKVRALVRDIDKARSILGNDIDLVVADITQPETLTPLVMADIQAV  120

Query  626  INAVSVIXGP  655
            +   +V   P
Sbjct  121  VCCTAVRVQP  130



>ref|XP_006283354.1| hypothetical protein CARUB_v10004397mg [Capsella rubella]
 gb|EOA16252.1| hypothetical protein CARUB_v10004397mg [Capsella rubella]
Length=435

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  536  MFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            M G D+DLIV DITK +TL+PE FKGVRKVINAVSVI GP
Sbjct  1    MLGPDIDLIVADITKENTLVPEKFKGVRKVINAVSVIVGP  40



>ref|WP_015205483.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Crinalium epipsammum]
 gb|AFZ15393.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Crinalium epipsammum PCC 9333]
Length=493

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 70/126 (56%), Gaps = 6/126 (5%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSM--DSSGIILvagatggvg  457
            WDFGRF  TL YF   P    F   L   L G +     K +   + G+ILVAGATGGVG
Sbjct  10   WDFGRFFQTLAYFEVIP----FLGCLTRLLQGKAKDNANKPLGDKNVGVILVAGATGGVG  65

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAV  637
            +RVV  L  +G  VR+LVR+  KA ++ G+ V+LI GDIT   TL P   K ++ VI   
Sbjct  66   KRVVRRLIEQGYQVRSLVRDSTKASEILGDRVELIEGDITIKETLTPAVMKDIQAVICCT  125

Query  638  SVIXGP  655
             V   P
Sbjct  126  GVKVQP  131



>ref|WP_028090688.1| NADH:ubiquinone oxidoreductase [Dolichospermum circinale]
Length=498

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 76/133 (57%), Gaps = 8/133 (6%)
 Frame = +2

Query  266  QSGQQPWDFGRFLSTLYYFNGPPSPS---KFFEFLIEKLSGPSPSKPVKSMDSSGIILva  436
             + +  WD  RF+ TL YF   P  +   K F+   E     S     K+  + G+ILVA
Sbjct  3    NNNRSQWDLCRFIKTLTYFEVFPVLNWVQKLFQGGYEDHQNLS-----KAGINMGVILVA  57

Query  437  gatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGV  616
            GATGGVG+RVV  L ++G +VR LVR+ EKAR + G+D+DL+VGDITK  TL       +
Sbjct  58   GATGGVGKRVVKKLVAQGYNVRCLVRDVEKARPILGDDIDLVVGDITKPETLTSLVLANI  117

Query  617  RKVINAVSVIXGP  655
            + VI   +V   P
Sbjct  118  QAVICCTAVRVQP  130



>ref|WP_027401452.1| NADH:ubiquinone oxidoreductase [Aphanizomenon flos-aquae]
Length=494

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 77/130 (59%), Gaps = 2/130 (2%)
 Frame = +2

Query  266  QSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagat  445
             + +  WD  RF+ TL YF   P  + + + L    S     +P K  ++  +ILVAGAT
Sbjct  3    NNNRSQWDLCRFIKTLTYFEVFPILN-WIQKLFPGSSTDYQDRP-KQGENMAVILVAGAT  60

Query  446  ggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKV  625
            GGVG+RVV  L ++G +VR LVR+ EKAR++ G+D++L+VGDITK  TL       ++ V
Sbjct  61   GGVGKRVVKKLITQGYNVRCLVRDIEKARQVLGDDINLVVGDITKPETLTNLVMANIQAV  120

Query  626  INAVSVIXGP  655
            I   SV   P
Sbjct  121  ICCTSVRVQP  130



>ref|WP_009545319.1| MULTISPECIES: NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece]
 gb|ACB52863.1| unknown [Cyanothece sp. ATCC 51142]
Length=497

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 78/141 (55%), Gaps = 14/141 (10%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPS---------KPVKSMD  412
             +++ ++PWD GRF++TL  F   P  S      ++KL  PS            P     
Sbjct  1    MSKTERKPWDLGRFITTLNKFELIPFISD-----LQKLFKPSAPLRGSLRDRFSPKLQNS  55

Query  413  SSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTL  592
            + G+ILV GATGGVG+RVV  L S+   VRALVR++E A+ +F E V+LI GD+T+  TL
Sbjct  56   TMGMILVTGATGGVGKRVVRRLLSQNYYVRALVRDKETAKSLFDERVELIQGDVTRPETL  115

Query  593  LPEYFKGVRKVINAVSVIXGP  655
             P   + V  VI+ V     P
Sbjct  116  TPRLLENVSAVISCVGTRVQP  136



>ref|WP_015206966.1| NmrA-like family protein [Cylindrospermum stagnale]
 gb|AFZ23710.1| NmrA-like family protein [Cylindrospermum stagnale PCC 7417]
Length=494

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD  RF+ TL YF   P  + + + LI+     + + P       G+ILVAGATGGVG+R
Sbjct  9    WDLCRFIETLTYFEVIPLLN-WVQQLIQGRPKDNENIP-NGGRKVGVILVAGATGGVGKR  66

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L  +G  VR+LVR+ EKAR + G DVDL+V DITK  TL P     ++ V+   +V
Sbjct  67   VVRRLVEQGYKVRSLVRDIEKARTILGNDVDLVVADITKPETLTPIVMANIQAVVCCTAV  126

Query  644  IXGP  655
               P
Sbjct  127  RVQP  130



>gb|EFA71480.1| hypothetical protein CRC_00684 [Cylindrospermopsis raciborskii 
CS-505]
Length=167

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD  RFL TL YF   P  + + + +++        +P   +   G+ILVAGATGGVG+R
Sbjct  9    WDLCRFLKTLTYFEVFPLLN-WIQNILQNRPTNQQDQPTGRI-QMGVILVAGATGGVGKR  66

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L ++G  VR LVR+ EKAR++ G + DL+VGDITK  +L       ++ V+   +V
Sbjct  67   VVKKLLTQGYRVRCLVRDIEKAREILGNEADLVVGDITKPESLNNLVMSNIQGVVCCTAV  126

Query  644  IXGP  655
               P
Sbjct  127  RVQP  130



>ref|WP_017659907.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=500

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 69/123 (56%), Gaps = 2/123 (2%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A   ++PWDFGRFL TL +F   P    F    I+K  G      +      G++LV G
Sbjct  1    MANPPREPWDFGRFLQTLGFFGEIPFLGNFR--WIQKKLGMRDDTAMTPPKPPGLVLVVG  58

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVV  L+ + + VR LVR+  + R++ G DV+L+  DIT   TL    F+ VR
Sbjct  59   ATGGVGKRVVKQLQQRNIPVRGLVRDARRGRELLGTDVELVEADITVPETLNFRVFENVR  118

Query  620  KVI  628
             VI
Sbjct  119  AVI  121



>ref|WP_015216704.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Anabaena cylindrica]
 gb|AFZ60088.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Anabaena cylindrica PCC 7122]
Length=494

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 74/132 (56%), Gaps = 2/132 (2%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
              +  +  WD  RF+ TL YF   P+ + + E L +     + ++P       G+ILVAG
Sbjct  1    MTEKNRSQWDLCRFIKTLTYFEVFPALN-WVEKLFQSHPQDNQNQP-NGGSKMGVILVAG  58

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVV  L ++G  VR LVR+ EKAR + G DVDL+ GDITK  TL       ++
Sbjct  59   ATGGVGKRVVKRLSAQGYKVRCLVRDIEKARLIVGNDVDLVAGDITKPETLNSLVMSNIQ  118

Query  620  KVINAVSVIXGP  655
             VI   +V   P
Sbjct  119  AVICCTAVRVQP  130



>ref|WP_015189798.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Gloeocapsa sp. PCC 7428]
 gb|AFZ31929.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Gloeocapsa sp. PCC 7428]
Length=490

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 75/125 (60%), Gaps = 5/125 (4%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSS-GIILvagatggvgr  460
            WD GRF+ TL +F   P    F  +L   + G   S+ V + +    ++LVAGATGGVGR
Sbjct  8    WDLGRFIQTLTFFEVIP----FIGWLQRLIPGFQDSEIVPTGEKRVRVVLVAGATGGVGR  63

Query  461  rvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVS  640
            RVV  L ++G  VR+LVR+ EKA+++ G++V+L VGDITK  TL  E    V  VI   +
Sbjct  64   RVVKRLMNRGYKVRSLVRDAEKAKEILGDNVELYVGDITKPETLTLEMMADVTAVICCTA  123

Query  641  VIXGP  655
            V   P
Sbjct  124  VRVQP  128



>ref|WP_008183365.1| complex I intermediate-associated protein, NmrA-like family [Moorea 
producens]
 gb|EGJ33004.1| complex I intermediate-associated protein, NmrA-like family [Moorea 
producens 3L]
Length=491

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPV-KSMDSSGIILva  436
              Q+ + PWD GRF+ TL YF   P  S        + +    S+   K M   G+ILVA
Sbjct  1    MTQNNRSPWDAGRFIKTLSYFEVIPFLSCLQRLFTGRANNQQSSQGRGKDM---GVILVA  57

Query  437  gatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGV  616
            GATGGVG+RVV  L  +   VRALVRN +KAR++ G +++L   DIT   TL P  +K +
Sbjct  58   GATGGVGKRVVRCLVERNYPVRALVRNAQKAREILGNNLELFEADITIPDTLTPALYKNI  117

Query  617  RKVI  628
              ++
Sbjct  118  TAIV  121



>ref|WP_009457802.1| MULTISPECIES: NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Fischerella]
 gb|EHC12311.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Fischerella sp. JSC-11]
Length=500

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 74/132 (56%), Gaps = 2/132 (2%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             A   +  WD GRF+ TL YF   P  + + + L +  +  + ++P       G+ILVAG
Sbjct  1    MANKNRSQWDLGRFIETLTYFEVVPLIN-WIQDLFQGRTKDNQNQP-NGAKQVGVILVAG  58

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVV  L  +G  VR+LVR+ E+ R + G++ +L+V DIT   TL P     ++
Sbjct  59   ATGGVGKRVVRRLAERGYRVRSLVRDIERGRSILGDNTELVVADITNPETLTPLVMANIQ  118

Query  620  KVINAVSVIXGP  655
             +I   +V   P
Sbjct  119  AIICCTAVRVQP  130



>ref|WP_026721354.1| NADH:ubiquinone oxidoreductase [Fischerella sp. PCC 9431]
Length=495

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD  RF+ TL YF   P  + + + L +  +    ++P       G+ILVAGATGGVG+R
Sbjct  9    WDLKRFVETLTYFEVVPLIN-WIQDLFQGRTKDHQNQP-SGAKQVGVILVAGATGGVGKR  66

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L  +G  VR+LVR+ EKAR + G+ VDL+V DIT+  TL P     ++ VI   +V
Sbjct  67   VVRRLVEQGYRVRSLVRDIEKARTILGDQVDLVVADITQPETLTPLVMANIQAVICCTAV  126

Query  644  IXGP  655
               P
Sbjct  127  RVQP  130



>gb|KIJ84806.1| NADH:ubiquinone oxidoreductase [Scytonema tolypothrichoides VB-61278]
Length=493

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRF+ TL YF   P  + + + LI+     S + P       G+ILVAGATGGVG+R
Sbjct  9    WDLGRFIQTLTYFEVVPFVN-WVQDLIQGRLNSSQNIP-DGAKQVGVILVAGATGGVGQR  66

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L   G  VRALVR+ +KAR +  ++V+L+VGDITK  TL       ++ VI   +V
Sbjct  67   VVKRLLDGGYKVRALVRDIDKARSILSDNVELVVGDITKPETLNSLVMANIQAVICCTAV  126

Query  644  IXGP  655
               P
Sbjct  127  RVQP  130



>ref|WP_015116675.1| NmrA-like family protein [Rivularia sp. PCC 7116]
 gb|AFY53097.1| NmrA-like family protein [Rivularia sp. PCC 7116]
Length=492

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 68/126 (54%), Gaps = 6/126 (5%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSS--GIILvagatggvg  457
            WD  RF+ TL +F   P       ++ +   G S   P KSM +    ++LVAGATGGVG
Sbjct  2    WDLNRFIKTLTFFEVIP----MLNWVQDLFKGDSQDNPDKSMGAKTVSVVLVAGATGGVG  57

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAV  637
            +RVV  L  KG  VR LVR+  KAR +  E  DL+V DITK  TL P     ++ V+   
Sbjct  58   KRVVQRLIDKGYKVRCLVRDIAKARSILSEKADLVVADITKPETLNPLLMANIQAVVCCT  117

Query  638  SVIXGP  655
            +V   P
Sbjct  118  AVRVQP  123



>ref|WP_017312960.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Fischerella sp. PCC 9339]
Length=493

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 10/128 (8%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG----PSPSKPVKSMDSSGIILvagatgg  451
            WD GRF+ TL YF   P  +   +    ++      PS +K V      G+ILVAGATGG
Sbjct  9    WDLGRFVQTLTYFEVVPLINWIQDLFQGRIKNDQNQPSGAKQV------GVILVAGATGG  62

Query  452  vgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVIN  631
            VG+RVV  L  +G  VR+LVR+ EKAR +    VDL+V DIT+  TL P     ++ VI 
Sbjct  63   VGKRVVRRLVERGYRVRSLVRDIEKARTIISNQVDLVVADITQPETLTPLVMANIQAVIC  122

Query  632  AVSVIXGP  655
              +V   P
Sbjct  123  CTAVRVQP  130



>ref|WP_013192562.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Trichormus azollae]
 gb|ADI65551.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 ['Nostoc azollae' 0708]
Length=494

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 71/134 (53%), Gaps = 6/134 (4%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG--PSPSKPVKSMDSSGIILv  433
              +  + PWD  RF+ TL YF   P       +L +   G   +   P       GIILV
Sbjct  1    MTEENRSPWDLYRFIKTLTYFEVFP----VLNWLQKLFQGRPANHQNPPNRGRKMGIILV  56

Query  434  agatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKG  613
            AGATGGVG+RVV  L ++G  VR LVR+ +K R + G +VDL+VGDITK  TL       
Sbjct  57   AGATGGVGKRVVKRLLTQGYKVRCLVRDIDKGRSIIGNEVDLVVGDITKPETLNSLVMSN  116

Query  614  VRKVINAVSVIXGP  655
            ++ V+   +V   P
Sbjct  117  IQAVVCCTAVRVQP  130



>ref|WP_028084600.1| NADH:ubiquinone oxidoreductase [Dolichospermum circinale]
Length=494

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 78/133 (59%), Gaps = 8/133 (6%)
 Frame = +2

Query  266  QSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKL--SGPSPSKPV-KSMDSSGIILva  436
             + +  WD  RF+ TL YF   P  +      I+KL   G   ++ + K+  + G+ILVA
Sbjct  3    NNNRSQWDLCRFIKTLTYFEVFPVLN-----WIQKLFQGGYKDNQNLSKAGINMGVILVA  57

Query  437  gatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGV  616
            GATGGVG+RVV  L ++G  +R LVR+ +KAR + G+D+DL+VGDITK  TL       +
Sbjct  58   GATGGVGKRVVKKLVAQGYHIRCLVRDIDKARPILGDDIDLVVGDITKPETLTNLVLANI  117

Query  617  RKVINAVSVIXGP  655
            + VI   +V   P
Sbjct  118  QAVICCTAVRVQP  130



>ref|WP_016864210.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Fischerella muscicola]
Length=500

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 73/124 (59%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            W+ GRF+ TL YF   P  + + + L +  +  + ++P       G+ILVAGATGGVG+R
Sbjct  9    WNLGRFVETLTYFEVVPLIN-WIQDLFQGRTKDNQNQP-SGAKQVGVILVAGATGGVGKR  66

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L  +G  VR+LVR+ +KAR + G+  +L+V DIT A TL P     ++ +I   +V
Sbjct  67   VVRRLLERGYRVRSLVRDLDKARSILGDSTELVVADITNAETLTPLVMANIQAIICCTAV  126

Query  644  IXGP  655
               P
Sbjct  127  RVQP  130



>ref|WP_017318111.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Mastigocladopsis repens]
Length=495

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 70/126 (56%), Gaps = 6/126 (5%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSS--GIILvagatggvg  457
            WD GRF+ TL YF   P    F  ++ + + G S S    S  +   G+ILV GATGGVG
Sbjct  9    WDLGRFIQTLTYFEVIP----FLNWIQDFIQGRSQSSSDISNGARQVGVILVVGATGGVG  64

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAV  637
            +RVV  L  +   VRALVR+ +KAR + G DV+L+  DITK  TL       ++ VI   
Sbjct  65   KRVVRRLLEQSYKVRALVRDIDKARSILGNDVELVGADITKPETLTSLVMADIQAVICCT  124

Query  638  SVIXGP  655
            +V   P
Sbjct  125  AVRVQP  130



>ref|WP_044446747.1| NADH:ubiquinone oxidoreductase [Mastigocladus laminosus]
 gb|KIY14874.1| NADH:ubiquinone oxidoreductase [Mastigocladus laminosus UU774]
Length=493

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 71/128 (55%), Gaps = 10/128 (8%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG----PSPSKPVKSMDSSGIILvagatgg  451
            WD GRF+ TL YF   P  +   +    ++      PS +K V      G+ILVAGATGG
Sbjct  9    WDLGRFVQTLTYFEVVPLINWIQDLFQGRIKNDQNQPSGAKQV------GVILVAGATGG  62

Query  452  vgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVIN  631
            VG+RVV  L  +G  VR+LVR+ EKAR +    +DL+V DIT+  TL P     ++ VI 
Sbjct  63   VGKRVVRRLVERGYRVRSLVRDIEKARTIISNQLDLVVADITQPETLTPLVMANIQAVIC  122

Query  632  AVSVIXGP  655
              +V   P
Sbjct  123  CTAVRVQP  130



>ref|WP_015176136.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Oscillatoria nigro-viridis]
 gb|AFZ06842.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Oscillatoria nigro-viridis PCC 7112]
Length=487

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 72/115 (63%), Gaps = 5/115 (4%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRFL TL YF   P         +++L G S SK  K  D   +ILVAGATGGVG+R
Sbjct  9    WDAGRFLKTLAYFGVIPFIGSIS--WLQQLFGSS-SKTKK--DQPKLILVAGATGGVGKR  63

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            VV  L+ +G  VR LVR+ ++A ++ G++V+L+ GDIT A TL P   +GV  VI
Sbjct  64   VVKRLQQRGYRVRCLVRDAKRATEILGKNVELVEGDITLAETLTPLVTEGVEAVI  118



>ref|WP_012626990.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7425]
 gb|ACL43899.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7425]
Length=500

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKF--FEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvg  457
            WD GRF+ TL +F   P    F      +E+L   S  +P ++ ++  IILV GATGGVG
Sbjct  9    WDAGRFVRTLAFFETIPLVGSFSWVRESLERLFPQSSPQPERA-ETGKIILVVGATGGVG  67

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAV  637
            RRVV  LRS+G +VRALVRN   A+++  E V L  GD+T+  TL  +  +GV  VI+ +
Sbjct  68   RRVVQRLRSQGYAVRALVRNPSTAQQIPSEGVQLFPGDVTRPETLTADLMEGVVGVISCL  127



>ref|WP_019492893.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Calothrix sp. PCC 7103]
Length=493

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 73/135 (54%), Gaps = 8/135 (6%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSS---GIIL  430
             +   +QPWD  RF+ TL YF   P  +      ++ L   S       ++ +   G+IL
Sbjct  1    MSDKNRQPWDLSRFIKTLSYFEVFPLLN-----WVQNLFQGSSQDSQSQLNGAKQVGVIL  55

Query  431  vagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFK  610
            VAGATGGVG+RVV  L   G  VR LVR+ EKAR + G +V+++VGDIT   TL P    
Sbjct  56   VAGATGGVGKRVVRRLNQLGYRVRCLVRDIEKARLILGNEVEMVVGDITNPDTLTPLVMA  115

Query  611  GVRKVINAVSVIXGP  655
             ++ VI   +V   P
Sbjct  116  NIQGVICCTAVRVQP  130



>gb|AFZ51428.1| NAD dependent epimerase/dehydratase family protein [Dactylococcopsis 
salina PCC 8305]
Length=501

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKF---FEFLIEKLSGPSPS-KPVKSMDSSGII  427
            FA S Q+ W+  RFL TL YF+  P  +      E ++ + S   PS  P K     G I
Sbjct  7    FAMSQQKSWEITRFLKTLTYFDVIPFLNNIPVIKEMILGQESIAQPSFSPQK-----GTI  61

Query  428  LvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYF  607
            LVAGATGGVG+RVV  L+ +  SVR LVR+ +++R + GE++D   GDIT + +L PE  
Sbjct  62   LVAGATGGVGKRVVQRLQQQNYSVRVLVRSIDRSRSIVGENLDFYEGDITISDSLKPELM  121

Query  608  KGVRKVI  628
            K V  +I
Sbjct  122  KNVTGII  128



>ref|WP_009782432.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW38977.1| hypothetical protein L8106_01642 [Lyngbya sp. PCC 8106]
Length=492

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 70/118 (59%), Gaps = 11/118 (9%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPP---SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggv  454
            WD GR L TL YF   P   S S   E    K + P P KP        ++LVAGATGGV
Sbjct  9    WDAGRLLKTLSYFGVVPFIGSISWIQELFGNKKNKPQP-KP-------EVVLVAGATGGV  60

Query  455  grrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            G+RVV  L+ +G++VRALVR+ ++A+K+ G  V++I  DIT   TL P+  K V  +I
Sbjct  61   GKRVVKRLQQQGMNVRALVRDAKRAKKVLGNTVEIIEADITIPETLTPQVMKDVTAII  118



>ref|WP_006634404.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Microcoleus vaginatus]
 gb|EGK85814.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Microcoleus vaginatus FGP-2]
Length=487

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 70/115 (61%), Gaps = 5/115 (4%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRFL TL YF   P       +L +  +  S SK     D   ++LVAGATGG+G+R
Sbjct  9    WDAGRFLKTLAYFGVIPFIGSM-SWLQQLFASSSNSKK----DQPKLVLVAGATGGLGKR  63

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            VV  L+ +G  VRALVR+ ++A ++ G++V+L+ GDIT   TL P   +G+  VI
Sbjct  64   VVKRLQQRGYRVRALVRDTKRATEILGQNVELVEGDITLPETLTPLVTEGIEAVI  118



>ref|WP_009344296.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA71868.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=498

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 70/130 (54%), Gaps = 14/130 (11%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDS------SGIILvagat  445
            WD  RF+ TL YF   P        L+  +     ++P    D        GIILVAGAT
Sbjct  9    WDLCRFIRTLTYFEVFP--------LLNWIQNILQNRPTNRQDQPTGRIQMGIILVAGAT  60

Query  446  ggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKV  625
            GGVG+RVV  L ++G  VR LVR+ EKAR++ G + DL+VGDITK  +L       ++ V
Sbjct  61   GGVGKRVVKKLLTQGYRVRCLVRDIEKAREILGNEADLVVGDITKPESLNDLVMSNIQGV  120

Query  626  INAVSVIXGP  655
            +   +V   P
Sbjct  121  VCCTAVRVQP  130



>ref|WP_016866205.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Fischerella muscicola]
Length=500

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 72/128 (56%), Gaps = 10/128 (8%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLI----EKLSGPSPSKPVKSMDSSGIILvagatgg  451
            WD GRF+ TL YF   P  +   +F      +  + P+ +K V      G+ILVAGATGG
Sbjct  9    WDLGRFIETLTYFEVVPLINWIQDFFQGRTKDNQNQPNGAKQV------GVILVAGATGG  62

Query  452  vgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVIN  631
            VG+RVV  L  +G  VR+LVR+ E+AR + G+  +L+V DIT + TL       ++ +I 
Sbjct  63   VGKRVVRRLVEQGYRVRSLVRDIERARSILGDSTELVVADITNSETLTSLVMANIQAIIC  122

Query  632  AVSVIXGP  655
              +V   P
Sbjct  123  CTAVRVQP  130



>ref|WP_015180824.1| NmrA-like family protein [Microcoleus sp. PCC 7113]
 gb|AFZ16661.1| NmrA-like family protein [Microcoleus sp. PCC 7113]
Length=496

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRFL TL YF   P  S        +    + ++    +   G+ILVAGATGGVG+R
Sbjct  9    WDAGRFLETLTYFEVIPFLSCLKRLFTNRAKNKTETQGGSQI--MGVILVAGATGGVGKR  66

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSV  643
            VV  L      VRALVR+ E+AR++ GE V+L   DIT   TL P+    V  V+    V
Sbjct  67   VVRRLIEHDYQVRALVRDAERAREILGEKVELFEADITLPDTLTPQLMNNVVAVVCCTGV  126

Query  644  IXGP  655
               P
Sbjct  127  RVQP  130



>ref|WP_006104868.1| Complex I intermediate-associated protein 30, partial [Coleofasciculus 
chthonoplastes]
 gb|EDX72053.1| Complex I intermediate-associated protein 30, partial [Coleofasciculus 
chthonoplastes PCC 7420]
Length=350

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 71/134 (53%), Gaps = 6/134 (4%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPS-KPVKSMDSS-GIILv  433
              Q+ +  WD GRF+ TL YF   P    F   L    SG +   KP +S     G I+V
Sbjct  1    MTQNNRSQWDAGRFVKTLAYFEVIP----FISCLKRLFSGNTQHHKPSQSGGKRLGKIVV  56

Query  434  agatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKG  613
            AGATGGVG+RVV  L  +   VRALVR+ ++ R+M G++V+L   DIT   TL P    G
Sbjct  57   AGATGGVGKRVVRRLMERDYPVRALVRDSQRGREMLGDEVELFEADITIPETLTPAMMDG  116

Query  614  VRKVINAVSVIXGP  655
            +  VI    V   P
Sbjct  117  ISAVICCTGVRVQP  130



>ref|WP_012599050.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7424]
 gb|ACK70106.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7424]
Length=494

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 67/131 (51%), Gaps = 5/131 (4%)
 Frame = +2

Query  266  QSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSS-GIILvaga  442
            Q+  + WD GRF  TL YF   P    FF  L    +    SK V   +   G ILVAGA
Sbjct  3    QNSSRKWDIGRFFQTLNYFEVIP----FFSCLQRLFTSDDKSKTVHLGEKKMGTILVAGA  58

Query  443  tggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRK  622
            TGGVG+RVV  L      VRALVR+  KAR++ G+ V+L  GD+T   TL  +    V  
Sbjct  59   TGGVGKRVVRRLLDNNYPVRALVRDSHKAREILGDKVELFEGDLTLKETLTSKLMDDVSA  118

Query  623  VINAVSVIXGP  655
            VI    V   P
Sbjct  119  VICCTGVRVQP  129



>ref|WP_015783548.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 8802]
 gb|ACV00188.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 8802]
Length=491

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 72/123 (59%), Gaps = 3/123 (2%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             +Q+ +  WD  RF +TL YF   P  +   + L+ K  G  PS  +    +   ILV G
Sbjct  1    MSQTNRAKWDLTRFWNTLNYFEIVPGIN-IVQRLLNK--GDRPSVNLYQNSTMNRILVVG  57

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVV +L++ G  VR LVR+ +KA+++    V++I GDIT+  TL P+  + + 
Sbjct  58   ATGGVGKRVVRLLQANGYPVRVLVRDSQKAQELLPPGVEIIEGDITRPETLTPKLIENIA  117

Query  620  KVI  628
             VI
Sbjct  118  AVI  120



>ref|WP_012594575.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 8801]
 gb|ACK65301.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 8801]
Length=491

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 72/123 (59%), Gaps = 3/123 (2%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
             +Q+ +  WD  RF +TL YF   P  +   + L+ K  G  PS  +    +   ILV G
Sbjct  1    MSQTNRAKWDLTRFWNTLNYFEIVPGIN-IVQRLLNK--GDRPSVNLYQNSTMNRILVVG  57

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+R+V +L++ G  VR LVR+ +KA+++    V++I GDIT+  TL P+  + + 
Sbjct  58   ATGGVGKRLVRLLQANGYPVRVLVRDSQKAQELLPPGVEIIEGDITRPETLTPKLIENIA  117

Query  620  KVI  628
             VI
Sbjct  118  AVI  120



>ref|WP_015146863.1| NmrA-like family protein [Oscillatoria acuminata]
 gb|AFY80213.1| NmrA-like family protein [Oscillatoria acuminata PCC 6304]
Length=499

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 73/137 (53%), Gaps = 13/137 (9%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSG-----PSPSKPVKSMDSSGI  424
              +  ++ WD GRF  TL YF   P       ++   L+G      +P KP       G+
Sbjct  1    MTEQKRRKWDAGRFWKTLSYFGVVPFLGNI-SWIRNLLTGGKSTISTPEKP-------GV  52

Query  425  ILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEY  604
            ILVAGATGGVG+RVV  L+ +G SVR LVR+ ++ R+M G  VDL+  DIT A +L    
Sbjct  53   ILVAGATGGVGKRVVQKLQQRGYSVRGLVRDLKRGREMLGTGVDLVDADITLADSLSDRL  112

Query  605  FKGVRKVINAVSVIXGP  655
             + V  VI+ +     P
Sbjct  113  LQDVTAVISCIGTRVQP  129



>ref|WP_015224203.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Halothece sp. PCC 7418]
 gb|AFZ42325.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Halothece sp. PCC 7418]
Length=493

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 66/118 (56%), Gaps = 0/118 (0%)
 Frame = +2

Query  275  QQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggv  454
            +Q WD  R + TL YF+  P  S         L   + ++P      +G ILVAGATGGV
Sbjct  4    KQSWDLCRLIRTLTYFDVLPVISSLPGVKQMILGKQAIAQPKALNPQTGTILVAGATGGV  63

Query  455  grrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            G+RV+  L+ K   VRALVR+ E+AR + G+DV+   GDIT   +L P+    V  VI
Sbjct  64   GKRVLQRLQQKNYPVRALVRSIERARSILGDDVEFYEGDITIPDSLKPDLIANVTAVI  121



>ref|WP_006623969.1| MULTISPECIES: NmrA-like protein [Arthrospira]
 emb|CCE18300.1| putative nucleoside-diphosphate-sugar epimerase [Arthrospira 
sp. PCC 8005]
 gb|EKD08188.1| NmrA-like protein [Arthrospira platensis C1]
 emb|CDM97045.1| putative nucleoside-diphosphate-sugar epimerase [Arthrospira 
sp. PCC 8005]
Length=493

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 71/124 (57%), Gaps = 9/124 (7%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPP--SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILva  436
             ++ + PWD  RF+ TL YF   P     ++ + L    + P PS P      S ++LV 
Sbjct  3    TENKKAPWDINRFVKTLNYFGVIPFLGSCRWLQKLFGGEAKP-PSPP------SEVVLVV  55

Query  437  gatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGV  616
            GATGGVG+RVV  L+ +G+ VRALVR+ ++  +M G  VD++  D+T   TL P+  + V
Sbjct  56   GATGGVGKRVVKRLQQQGIKVRALVRDRKRGLEMLGNKVDIMEADLTIPETLTPQVMQDV  115

Query  617  RKVI  628
              +I
Sbjct  116  TAII  119



>ref|WP_026098965.1| NADH:ubiquinone oxidoreductase [Oscillatoria sp. PCC 10802]
Length=496

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 65/115 (57%), Gaps = 1/115 (1%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRF  TL YF   P       ++ + L G    +     +  G+ILVAGATGGVG+R
Sbjct  9    WDAGRFAKTLTYFGVIPFVGNA-SWIQQLLKGAGKKQKATDTNKQGVILVAGATGGVGKR  67

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            VV  L+ +G  VRALVR+ ++ R++ G  V+++ GDIT   TL  +    +  V+
Sbjct  68   VVRRLQERGYKVRALVRDAKRGREILGLTVEIVEGDITIPETLTAQVMSDITAVV  122



>ref|WP_042154417.1| NADH:ubiquinone oxidoreductase [Planktothrix agardhii]
 gb|KEI67346.1| NmrA-like protein [Planktothrix agardhii NIVA-CYA 126/8]
Length=489

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 11/123 (9%)
 Frame = +2

Query  266  QSGQQPWDFGRFLSTLYYFNGPP--SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
            Q GQ  WD GRFL TL YF   P      + + L+   +     KP        IILV G
Sbjct  5    QKGQ--WDGGRFLKTLAYFGVVPFIGNISWIQNLLRMGTKQPQQKP-------NIILVVG  55

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVV  L+ +G++VR LVR+ ++AR + G  V+LI  D+T + TL    FK V 
Sbjct  56   ATGGVGKRVVKRLQQRGITVRCLVRDIKRARTILGNTVELIEADLTISETLTSAIFKDVT  115

Query  620  KVI  628
             +I
Sbjct  116  AII  118



>ref|WP_027250028.1| NADH:ubiquinone oxidoreductase [Planktothrix agardhii]
Length=489

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 11/123 (9%)
 Frame = +2

Query  266  QSGQQPWDFGRFLSTLYYFNGPP--SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
            Q GQ  WD GRFL TL YF   P      + + L+   +     KP        IILV G
Sbjct  5    QKGQ--WDGGRFLKTLAYFGVVPFIGNISWIQNLLRMGTKQPQQKP-------NIILVVG  55

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVV  L+ +G++VR LVR+ ++AR + G  V+LI  D+T + TL    FK V 
Sbjct  56   ATGGVGKRVVKRLQQRGITVRCLVRDIKRARTILGNTVELIEADLTISETLTSAIFKDVT  115

Query  620  KVI  628
             +I
Sbjct  116  AII  118



>ref|WP_041235904.1| NADH:ubiquinone oxidoreductase [Dactylococcopsis salina]
Length=493

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 9/124 (7%)
 Frame = +2

Query  269  SGQQPWDFGRFLSTLYYFNGPPSPSKF---FEFLIEKLSGPSPS-KPVKSMDSSGIILva  436
            S Q+ W+  RFL TL YF+  P  +      E ++ + S   PS  P K     G ILVA
Sbjct  2    SQQKSWEITRFLKTLTYFDVIPFLNNIPVIKEMILGQESIAQPSFSPQK-----GTILVA  56

Query  437  gatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGV  616
            GATGGVG+RVV  L+ +  SVR LVR+ +++R + GE++D   GDIT + +L PE  K V
Sbjct  57   GATGGVGKRVVQRLQQQNYSVRVLVRSIDRSRSIVGENLDFYEGDITISDSLKPELMKNV  116

Query  617  RKVI  628
              +I
Sbjct  117  TGII  120



>ref|WP_015143937.1| NmrA-like family protein [Pleurocapsa minor]
 gb|AFY77634.1| NmrA-like family protein [Pleurocapsa sp. PCC 7327]
Length=491

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 68/132 (52%), Gaps = 2/132 (2%)
 Frame = +2

Query  260  FAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
              +  + PW+ GRF  TL YF+  P          E+ S  + ++  K +   G ILV G
Sbjct  1    MTEKTRSPWNVGRFFETLTYFDAIPFIGCLKRLFAERASEETATREGKKI--VGTILVVG  58

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVV  L  K   VRALVR+ ++AR++ G+ V+L   D+T   TL  +    + 
Sbjct  59   ATGGVGKRVVRRLLEKNYQVRALVRDAKRARELLGDKVELFEADLTIPETLTSKLADRIS  118

Query  620  KVINAVSVIXGP  655
             VI    V   P
Sbjct  119  AVICCSGVRVQP  130



>ref|WP_044137683.1| NADH:ubiquinone oxidoreductase [Trichodesmium erythraeum]
Length=498

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 9/117 (8%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPP--SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvg  457
            W   +   TL YF   P     K+ E L  K +   P       D+S ++LV GA GGVG
Sbjct  9    WKPSKLFQTLGYFGVIPFIGSVKWLEKLFGKKTLLPP-------DTSEVVLVVGANGGVG  61

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            +RVV  L  +G  VR+LVR+ +KA+++ G DV+++  DIT+  TL PE FK V K+I
Sbjct  62   KRVVPRLLKQGYQVRSLVRDAKKAQEVLGNDVEIVTADITQPETLTPEIFKDVSKII  118



>ref|WP_006618043.1| NmrA-like protein [Arthrospira platensis]
 dbj|BAI92491.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR54347.1| NADH:ubiquinone oxidoreductase [Arthrospira platensis str. Paraca]
Length=493

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 71/124 (57%), Gaps = 9/124 (7%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPP--SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILva  436
             ++ + PWD  RF+ TL YF   P     ++ + L    + P PS P      S ++LV 
Sbjct  3    TENQKAPWDISRFVKTLNYFGVIPFLGSCRWLQKLFGGEAKP-PSPP------SEVVLVV  55

Query  437  gatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGV  616
            GATGGVG+RVV  L+ +G+ VRALVR+ ++  ++ G  VD+I  D+T   TL P+  + V
Sbjct  56   GATGGVGKRVVKRLQQQGIKVRALVRDRKRGLEILGNKVDIIEADLTIPETLTPQVMQDV  115

Query  617  RKVI  628
              +I
Sbjct  116  TAII  119



>gb|ABG52549.1| NmrA-like [Trichodesmium erythraeum IMS101]
Length=500

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 9/117 (8%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPP--SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvg  457
            W   +   TL YF   P     K+ E L  K +   P       D+S ++LV GA GGVG
Sbjct  11   WKPSKLFQTLGYFGVIPFIGSVKWLEKLFGKKTLLPP-------DTSEVVLVVGANGGVG  63

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            +RVV  L  +G  VR+LVR+ +KA+++ G DV+++  DIT+  TL PE FK V K+I
Sbjct  64   KRVVPRLLKQGYQVRSLVRDAKKAQEVLGNDVEIVTADITQPETLTPEIFKDVSKII  120



>ref|WP_026795424.1| MULTISPECIES: NADH:ubiquinone oxidoreductase [Planktothrix]
Length=489

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 68/123 (55%), Gaps = 11/123 (9%)
 Frame = +2

Query  266  QSGQQPWDFGRFLSTLYYFNGPP--SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvag  439
            Q GQ  WD GRFL TL YF   P      + + L+   +     KP        IILV G
Sbjct  5    QKGQ--WDGGRFLKTLAYFGVVPFIGNISWIQNLLRMGTKQPQQKP-------NIILVVG  55

Query  440  atggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVR  619
            ATGGVG+RVV  L+ +G++VR LVR+ ++AR + G  V+LI  D+T   TL    FK V 
Sbjct  56   ATGGVGKRVVKRLQQRGITVRCLVRDIKRARTILGNTVELIEADLTIPETLTSAIFKDVT  115

Query  620  KVI  628
             +I
Sbjct  116  AII  118



>ref|WP_013325168.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7822]
 gb|ADN17130.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7822]
Length=494

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 65/125 (52%), Gaps = 5/125 (4%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVK-SMDSSGIILvagatggvgr  460
            WD GRF  TL YF   P    FF        G   ++ V     + G ILVAGATGGVG+
Sbjct  9    WDAGRFFETLNYFEVIP----FFSCWQRLFRGHQQTQTVNLGKKNMGTILVAGATGGVGK  64

Query  461  rvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVS  640
            RVV  L      VRALVR+ +KAR++ G+ V+L   D+T   TL P+  + V  +I    
Sbjct  65   RVVRRLLDNKYPVRALVRDSQKAREILGDKVELFEADLTLKETLTPKLMENVAAIICCTG  124

Query  641  VIXGP  655
            V   P
Sbjct  125  VRVQP  129



>ref|WP_002792198.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI21667.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
Length=353

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 65/122 (53%), Gaps = 14/122 (11%)
 Frame = +2

Query  269  SGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGI--ILvaga  442
            +G + WDF RF  TL YF+  P  S      ++KL G    K ++  +  G+  ILV G 
Sbjct  2    AGSKNWDFQRFWQTLDYFDSIPLWS-----CLQKLLGFGEDKKIQLTNEQGMKTILVIGG  56

Query  443  tggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRK  622
               +GR+V+  L+ +   +RALV N E AR++F E+VDL   +        P+ F G+ +
Sbjct  57   ENAIGRKVIAQLQQQNYQIRALVDNIESARQLFAENVDLFTLET-------PQLFMGIDE  109

Query  623  VI  628
            +I
Sbjct  110  II  111



>ref|WP_002767146.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI01725.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9443]
Length=355

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 16/121 (13%)
 Frame = +2

Query  278  QPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGI----ILvagat  445
            + WDF RF  TL YF+  P  S      ++KL G    K  +  +  GI    ILV G  
Sbjct  5    KSWDFQRFWQTLDYFDSIPLWS-----CLQKLLGFGEDKKNQLTNEQGIGMKTILVIGGE  59

Query  446  ggvgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKV  625
              +GR+V+  L+ +   +RALV N E AR++FGE+VDL        +   PE F G+ ++
Sbjct  60   NAIGRKVIPQLQQQNYQIRALVDNIESARQLFGENVDLF-------ALQTPELFTGIERI  112

Query  626  I  628
            I
Sbjct  113  I  113



>ref|WP_008198923.1| hypothetical protein [Microcystis sp. T1-4]
 emb|CCI31355.1| conserved hypothetical protein [Microcystis sp. T1-4]
Length=353

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 62/117 (53%), Gaps = 14/117 (12%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGI--ILvagatggvg  457
            WDF RF  TL YF+  P  S      ++KL G    K ++  +  G+  ILV G    + 
Sbjct  7    WDFQRFWQTLDYFDSIPLWS-----CLQKLLGFGEDKKIQLTNEQGMKTILVIGGENAIV  61

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            R+V+  L+ +   +RALV N + AR++FGE+VDL        +   P+ F G+ ++I
Sbjct  62   RKVIAQLQQQNYQIRALVDNIDDARQLFGENVDLF-------ALQTPQLFTGIDEII  111



>ref|WP_027255199.1| NADH:ubiquinone oxidoreductase [Planktothrix agardhii]
Length=489

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 9/117 (8%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPP--SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvg  457
            WD GRFL TL YF   P      + + L+   +     KP        IILV GATGGVG
Sbjct  9    WDGGRFLKTLAYFGVVPFIGNISWIQNLLRMGTKQPQQKP-------NIILVVGATGGVG  61

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            +RVV  L+ +G++VR LVR+ ++AR + G  V+LI  D+T   TL    FK V  +I
Sbjct  62   KRVVKRLQQRGITVRCLVRDIKRARTILGNTVELIEADLTIPETLTSAIFKDVTAII  118



>ref|WP_026796563.1| NADH:ubiquinone oxidoreductase [Planktothrix prolifica]
Length=489

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 9/117 (8%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPP--SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvg  457
            WD GRFL TL YF   P      + + L+   +     KP        IILV GATGGVG
Sbjct  9    WDGGRFLKTLAYFGVVPFIGNISWIQNLLRMGTKQPQQKP-------NIILVVGATGGVG  61

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            +RVV  L+ +G++VR LVR+ ++AR + G  V+LI  D+T   TL    FK V  +I
Sbjct  62   KRVVKRLQQRGITVRCLVRDIKRARTILGNTVELIEADLTIPETLTSAIFKDVTAII  118



>ref|WP_026787787.1| NADH:ubiquinone oxidoreductase [Planktothrix rubescens]
Length=489

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 9/117 (8%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPP--SPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvg  457
            WD GRFL TL YF   P      + + L+   +     KP        IILV GATGGVG
Sbjct  9    WDGGRFLKTLAYFGVVPFIGNISWIQNLLRMGTKQPQQKP-------NIILVVGATGGVG  61

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            +RVV  L+ +G++VR LVR+ ++AR + G  V+LI  D+T   TL    FK V  +I
Sbjct  62   KRVVKRLQQRGITVRCLVRDIKRARTILGNTVELIEADLTIPETLTSAIFKDVTAII  118



>ref|WP_007356111.1| MULTISPECIES: NmrA-like [Kamptonema]
 emb|CBN56906.1| NmrA-like [ [[Oscillatoria] sp. PCC 6506]
Length=472

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 66/115 (57%), Gaps = 5/115 (4%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GRF +TL YF   P         +++L G     P +    S +ILVAGATGGVG+R
Sbjct  9    WDAGRFFNTLVYFGVIPFIGSIN--WLQQLFGGEAKTPKQK---SKLILVAGATGGVGKR  63

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            VV  L  +G +VRALVR+  + R++ G  ++L+ GDIT   TL  +   GV  +I
Sbjct  64   VVRHLLKRGYTVRALVRDANRGREILGPSIELVEGDITLPETLTQQVTSGVEAII  118



>gb|EWM29347.1| nadh:ubiquinone oxidoreductase complex i intermediate-associated 
protein 30 [Nannochloropsis gaditana]
Length=598

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 72/147 (49%), Gaps = 22/147 (15%)
 Frame = +2

Query  269  SGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEK-------LSGPSPSKPVKSMD---SS  418
            S ++ W  GR L T   FNGP    +F     +K       L+  +   P    D     
Sbjct  59   SSKKGWPVGRALRTFLSFNGP----RFLSGRRKKKTSGGVGLATATTVTPQLGADLPVGH  114

Query  419  GIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF--------GEDVDLIVGDI  574
            GI+LV GATGGVGRRVV +L  KG+ VRAL RNE+KA  M         G  ++++  DI
Sbjct  115  GIVLVTGATGGVGRRVVSLLLEKGIRVRALARNEQKALAMLNGGQKPEPGALLEIVNADI  174

Query  575  TKASTLLPEYFKGVRKVINAVSVIXGP  655
               + L PE  +GV  VI   + I  P
Sbjct  175  RDPAALTPELMEGVTAVIGCTAAIVQP  201



>ref|WP_002732100.1| complex I intermediate-associated 30 family protein [Microcystis 
aeruginosa]
 gb|ELP55720.1| complex I intermediate-associated 30 family protein [Microcystis 
aeruginosa TAIHU98]
Length=353

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 63/119 (53%), Gaps = 14/119 (12%)
 Frame = +2

Query  278  QPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGI--ILvagatgg  451
            + WDF RF  TL YF+  P  S      ++KL G    K ++  +  G+  ILV G    
Sbjct  5    KTWDFQRFWQTLDYFDSIPLWS-----CLQKLLGFGEDKKIQLTNEQGMKTILVIGGENA  59

Query  452  vgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            +GR+V+  L+ +   +RALV N E AR++F E+VDL   +        P+ F G+ ++I
Sbjct  60   IGRKVIAQLQQQNYQIRALVDNIESARQLFAENVDLFTLET-------PQLFMGIDEII  111



>ref|WP_015194049.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Stanieria cyanosphaera]
 gb|AFZ36382.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Stanieria cyanosphaera PCC 7437]
Length=491

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 64/117 (55%), Gaps = 7/117 (6%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDS--SGIILvagatggvg  457
            W+ GR   TL YF   P  SK     I+K+  P  +  V  +     G ILV GATGGVG
Sbjct  9    WEIGRLWKTLTYFEVIPLISK-----IQKILSPLQATKVNQLGQIKMGKILVVGATGGVG  63

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            +RVV  L +   SVRALVR+  +A+K+FGE V+L   D     TL P+  + V  VI
Sbjct  64   KRVVRQLLANDYSVRALVRDINQAQKLFGEQVELFEADFIIPETLTPQLMESVTAVI  120



>ref|WP_023067525.1| short chain dehydrogenase family protein [Lyngbya aestuarii]
 gb|ERT06302.1| short chain dehydrogenase family protein [Lyngbya aestuarii BL 
J]
Length=492

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 5/115 (4%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrr  463
            WD GR L TL YF   P         I++L G   +KP    +   ++LVAGATGGVG+R
Sbjct  9    WDAGRLLKTLGYFGVVPFIGSIS--WIQELFGNKKNKPKPKPE---VVLVAGATGGVGKR  63

Query  464  vvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            VV  L+ +G++VRALVR+ +KA+ + G  V++I  DIT   TL P   K V  +I
Sbjct  64   VVKRLQQRGINVRALVRDAKKAKTILGNTVEMIEADITIPETLTPAVMKDVTAII  118



>ref|WP_016517314.1| Complex I intermediate-associated protein 30 (CIA30) [Microcystis 
aeruginosa]
 gb|EPF16075.1| Complex I intermediate-associated protein 30 (CIA30) [Microcystis 
aeruginosa SPC777]
Length=353

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 62/117 (53%), Gaps = 14/117 (12%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGI--ILvagatggvg  457
            WDF RF  TL YF+  P  S      ++KL G    K ++  +  G+  ILV G    +G
Sbjct  7    WDFQRFWQTLDYFDSIPLWS-----CLQKLLGFGEDKKIQLTNEQGMKTILVIGGENAIG  61

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            R+V+  L+ +   +RALV N E AR++F E+VDL   +        P+ F G+ ++I
Sbjct  62   RKVIAQLQQQNYQIRALVDNIESARQLFAENVDLFTLET-------PQLFMGIDEII  111



>ref|WP_002775482.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI05963.1| conserved hypothetical protein [Microcystis aeruginosa PCC 7941]
Length=353

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 63/119 (53%), Gaps = 14/119 (12%)
 Frame = +2

Query  278  QPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGI--ILvagatgg  451
            + WDF RF  TL YF+  P  S      ++KL G    K ++  +  G+  ILV G    
Sbjct  5    KTWDFQRFWQTLDYFDSIPLWS-----CLQKLLGFGEDKKIQLTNEQGMKTILVIGGENA  59

Query  452  vgrrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            +GR+V+  L+ +   +RALV N E AR++F E+VDL   +        P+ F G+ ++I
Sbjct  60   IGRKVIAQLQQQNYQIRALVDNIESARQLFAENVDLFTLET-------PQLFMGIDEII  111



>gb|AHJ26864.1| hypothetical protein NSP_5140 [Nodularia spumigena CCY9414]
Length=474

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  476  LRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            L  +G  VRALVR+ +KAR + G+DVDL+ GDITK  TL       ++ VI   SV   P
Sbjct  46   LVERGEKVRALVRDIDKARSILGDDVDLVAGDITKPETLNSLVMANIQAVICCTSVRVQP  105



>ref|WP_004158103.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH94867.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9432]
Length=353

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 62/117 (53%), Gaps = 14/117 (12%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGI--ILvagatggvg  457
            WDF RF  TL YF+  P  S      ++KL G    K ++  +  G+  ILV G    +G
Sbjct  7    WDFQRFWQTLDYFDSIPLWS-----CLQKLLGFGEDKKIQLTNEQGMKTILVIGGENAIG  61

Query  458  rrvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            R+V+  L+ +   +RALV N E AR++F E+VDL   +        P+ F G+ ++I
Sbjct  62   RKVIAQLQQQNYQIRALVDNIESARQLFAENVDLFTLET-------PQLFMGIDEII  111



>ref|WP_039754165.1| NADH:ubiquinone oxidoreductase, partial [Hassallia byssoidea]
Length=448

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  476  LRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            LR KG  V+ LVR+ +KAR + G DVDLIV DITK  TL       +  V+   +V   P
Sbjct  25   LREKGYKVQCLVRDIDKARSILGNDVDLIVADITKPETLTSLVMSNIEAVVCCTAVRVQP  84



>ref|XP_005855477.1| nadh:ubiquinone oxidoreductase complex i intermediate-associated 
protein 30 [Nannochloropsis gaditana CCMP526]
 gb|EKU20879.1| nadh:ubiquinone oxidoreductase complex i intermediate-associated 
protein 30 [Nannochloropsis gaditana CCMP526]
Length=1014

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 55/149 (37%), Positives = 73/149 (49%), Gaps = 22/149 (15%)
 Frame = +2

Query  263  AQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEK-------LSGPSPSKPVKSMD---  412
            + S ++ W  GR L T   FNGP    +F     +K       L+  +   P    D   
Sbjct  57   SSSSKKGWPVGRALRTFLSFNGP----RFLSGRRKKKTSGGVGLATATTVTPQLGADLPV  112

Query  413  SSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMF--------GEDVDLIVG  568
              GI+LV GATGGVGRRVV +L  KG+ VRAL RNE+KA  M         G  ++++  
Sbjct  113  GHGIVLVTGATGGVGRRVVSLLLEKGIRVRALARNEQKALAMLNGGQKPEPGALLEIVNA  172

Query  569  DITKASTLLPEYFKGVRKVINAVSVIXGP  655
            DI   + L PE  +GV  VI   + I  P
Sbjct  173  DIRDPAALTPELMEGVTAVIGCTAAIVQP  201



>ref|XP_002982038.1| hypothetical protein SELMODRAFT_445069 [Selaginella moellendorffii]
 gb|EFJ16706.1| hypothetical protein SELMODRAFT_445069 [Selaginella moellendorffii]
Length=324

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  476  LRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            L  KG+ VRAL+RN EKAR +FG+ + ++VGD       +P  F+GV  V+        P
Sbjct  95   LLEKGVEVRALLRNAEKARSLFGDKLQVVVGDTRNPEDFVPSMFEGVTHVLCCTGTTAFP  154



>ref|XP_002966481.1| hypothetical protein SELMODRAFT_439518 [Selaginella moellendorffii]
 gb|EFJ32508.1| hypothetical protein SELMODRAFT_439518 [Selaginella moellendorffii]
Length=325

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  476  LRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            L  KG+ VRAL+RN EKAR +FG+ + ++VGD       +P  F+GV  V+
Sbjct  94   LLEKGVEVRALLRNAEKARSLFGDKLQVVVGDTRNPEDFVPSMFEGVTHVL  144



>ref|WP_006530839.1| NmrA-like family protein [Gloeocapsa sp. PCC 73106]
 gb|ELR96214.1| NmrA-like family protein [Gloeocapsa sp. PCC 73106]
Length=473

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 67/123 (54%), Gaps = 11/123 (9%)
 Frame = +2

Query  287  DFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMDSSGIILvagatggvgrrv  466
            +  R   TL YF   P        LI  L  P+ +  +++M   G+ILV GATGGVG+RV
Sbjct  2    NLKRLWQTLNYFEVIP--------LISILKRPTTNYQLQTM---GLILVTGATGGVGKRV  50

Query  467  vDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVINAVSVI  646
            V+ L      VR LVR+ +KAR+MF + V++  GD+T A TL P+  + V  VI    V 
Sbjct  51   VETLLKANYRVRVLVRDGQKAREMFSDRVEIWEGDLTIAETLNPKLLQDVSAVICCTGVK  110

Query  647  XGP  655
              P
Sbjct  111  VRP  113



>ref|XP_005709172.1| hypothetical protein Gasu_00240 [Galdieria sulphuraria]
 gb|EME32652.1| hypothetical protein Gasu_00240 [Galdieria sulphuraria]
Length=830

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 79/155 (51%), Gaps = 25/155 (16%)
 Frame = +2

Query  251  KGPFAQSGQQPWDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVKSMD------  412
            +G   ++ ++PW FGRF+ T  +FN  P    F + +    S P P   V+S+       
Sbjct  35   QGTKKKTTRKPWPFGRFVKTFLFFN--PIARAFSQEVAVSGSLPDPGVRVRSLRLQLLTR  92

Query  413  --------SSGIILvagatggvgrrvvDILRSKGLSVRALVRNEEKARKMFGED------  550
                    S  ++LV GATG VGR+++  L+  G  VRALVR+E +A  +  E+      
Sbjct  93   LEKDMSPLSGRVVLVIGATGRVGRQLIVKLQHSGCKVRALVRDENRAIAILKEEGAQVDK  152

Query  551  VDLIVGDITKASTLLPEYFKGVRKVINAVSVIXGP  655
            ++LI GD+    +L+PE+F+ V  V   + V   P
Sbjct  153  LELITGDL---HSLVPEHFRLVYAVFCVMGVALQP  184



>ref|WP_040943935.1| NADH:ubiquinone oxidoreductase [Prochloron didemni]
Length=496

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  284  WDFGRFLSTLYYFNGPPSPSKFFEFLIEKLSGPSPSKPVK-SMDSSGIILvagatggvgr  460
            W  GR   TL +F   P    F   L    +G       + + ++ GIILV GATGGVG+
Sbjct  9    WKSGRLWQTLTFFEVIP----FLNCLQRLFTGKKQQSTNQLASNNMGIILVVGATGGVGK  64

Query  461  rvvDILRSKGLSVRALVRNEEKARKMFGEDVDLIVGDITKASTLLPEYFKGVRKVI  628
            RVV  L  +G  VRALVR+  KA+ + GE V+L   DIT   TL P   + V  +I
Sbjct  65   RVVRQLSDRGYGVRALVRDAAKAKTILGEKVELFEADITIPKTLTPPLMESVSAII  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875