BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF027I20

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            151   5e-39   Nicotiana sylvestris
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       149   4e-38   Nicotiana tomentosiformis
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     142   1e-35   Eucalyptus grandis [rose gum]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    142   1e-35   Eucalyptus grandis [rose gum]
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       138   3e-34   Solanum tuberosum [potatoes]
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      137   5e-34   Gossypium arboreum [tree cotton]
gb|KJB65824.1|  hypothetical protein B456_010G114900                    137   5e-34   Gossypium raimondii
gb|KJB65823.1|  hypothetical protein B456_010G114900                    137   8e-34   Gossypium raimondii
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             136   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       135   3e-33   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       135   3e-33   Populus euphratica
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       135   4e-33   Vitis vinifera
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  134   5e-33   Cucumis sativus [cucumbers]
gb|KJB82811.1|  hypothetical protein B456_013G215000                    134   6e-33   Gossypium raimondii
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             133   1e-32   
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      133   2e-32   Gossypium arboreum [tree cotton]
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       133   2e-32   Populus euphratica
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       132   4e-32   Sesamum indicum [beniseed]
emb|CBI21043.3|  unnamed protein product                                131   5e-32   Vitis vinifera
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    131   6e-32   
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             131   7e-32   Citrus clementina [clementine]
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             131   1e-31   Phaseolus vulgaris [French bean]
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         130   2e-31   Jatropha curcas
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    130   2e-31   Glycine max [soybeans]
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       130   3e-31   
gb|KHN33913.1|  EIN3-binding F-box protein 1                            129   4e-31   Glycine soja [wild soybean]
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       128   1e-30   Citrus sinensis [apfelsine]
ref|XP_002524506.1|  grr1, plant, putative                              128   2e-30   Ricinus communis
gb|KJB55011.1|  hypothetical protein B456_009G058000                    128   2e-30   Gossypium raimondii
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                127   4e-30   Erythranthe guttata [common monkey flower]
ref|XP_002308665.2|  grr1 family protein                                126   5e-30   
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   6e-30   
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   8e-30   Populus euphratica
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       124   2e-29   Fragaria vesca subsp. vesca
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       124   2e-29   Populus euphratica
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       122   2e-28   
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       122   3e-28   Nelumbo nucifera [Indian lotus]
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       121   3e-28   Vitis vinifera
emb|CAN82790.1|  hypothetical protein VITISV_030601                     122   3e-28   Vitis vinifera
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            121   3e-28   Cucumis melo [Oriental melon]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   6e-28   Cucumis sativus [cucumbers]
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   8e-28   
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   9e-28   Nelumbo nucifera [Indian lotus]
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   1e-27   Cucumis sativus [cucumbers]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            119   1e-27   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI28209.3|  unnamed protein product                                118   2e-27   Vitis vinifera
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       119   2e-27   Cucumis melo [Oriental melon]
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       119   2e-27   Cicer arietinum [garbanzo]
ref|XP_007011864.1|  EIN3-binding F box protein 1                       119   3e-27   
ref|XP_002515516.1|  grr1, plant, putative                              118   4e-27   Ricinus communis
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    118   4e-27   Glycine max [soybeans]
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             118   5e-27   
ref|XP_003588766.1|  Ein3-binding f-box protein                         118   5e-27   Medicago truncatula
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             117   7e-27   Prunus persica
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       117   8e-27   Camelina sativa [gold-of-pleasure]
gb|KJB27084.1|  hypothetical protein B456_004G276800                    117   1e-26   Gossypium raimondii
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       117   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       117   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            117   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    117   2e-26   
ref|XP_002880682.1|  ein3-binding F box protein 1                       116   2e-26   
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             115   3e-26   Capsella rubella
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      115   3e-26   Gossypium arboreum [tree cotton]
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    115   4e-26   Prunus mume [ume]
ref|NP_565597.1|  EIN3-binding F-box protein 1                          115   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         115   5e-26   Jatropha curcas
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   6e-26   
gb|KJB54023.1|  hypothetical protein B456_009G017100                    114   8e-26   Gossypium raimondii
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       114   9e-26   
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            114   1e-25   Camelina sativa [gold-of-pleasure]
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    112   5e-25   Arabis alpina [alpine rockcress]
ref|XP_008347724.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   6e-25   
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       112   9e-25   
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    111   1e-24   
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   1e-24   Pyrus x bretschneideri [bai li]
gb|AFT92041.1|  EIN3 binding F-box 1                                    111   1e-24   Malus domestica [apple tree]
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    111   1e-24   
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   1e-24   
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            111   2e-24   Sesamum indicum [beniseed]
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             110   2e-24   Phaseolus vulgaris [French bean]
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             110   2e-24   Phaseolus vulgaris [French bean]
gb|KHN07078.1|  EIN3-binding F-box protein 1                            109   5e-24   Glycine soja [wild soybean]
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          108   2e-23   Amborella trichopoda
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       107   3e-23   Solanum tuberosum [potatoes]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like       107   4e-23   Tarenaya hassleriana [spider flower]
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg             107   4e-23   Eutrema salsugineum [saltwater cress]
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       106   7e-23   Pyrus x bretschneideri [bai li]
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       106   7e-23   Tarenaya hassleriana [spider flower]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       105   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   2e-22   Solanum lycopersicum
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             105   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   2e-22   Eucalyptus grandis [rose gum]
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   2e-22   Glycine max [soybeans]
ref|XP_010086585.1|  hypothetical protein L484_002248                   104   3e-22   Morus notabilis
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       104   3e-22   Glycine max [soybeans]
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             104   3e-22   Phaseolus vulgaris [French bean]
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       103   7e-22   Cicer arietinum [garbanzo]
gb|EPS63879.1|  f-box family protein                                    101   3e-21   Genlisea aurea
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg             100   5e-21   Capsella rubella
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   6e-21   Sesamum indicum [beniseed]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   6e-21   Eucalyptus grandis [rose gum]
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    100   6e-21   
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    100   6e-21   
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   6e-21   Nicotiana tomentosiformis
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like       100   9e-21   Brassica rapa
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2          99.8    1e-20   Tarenaya hassleriana [spider flower]
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg              99.8    1e-20   Erythranthe guttata [common monkey flower]
emb|CDY19807.1|  BnaA09g04600D                                        99.8    1e-20   Brassica napus [oilseed rape]
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.8    2e-20   Nicotiana sylvestris
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g           99.0    2e-20   Phaseolus vulgaris [French bean]
emb|CDX76980.1|  BnaC04g37750D                                        97.8    5e-20   
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                   96.7    1e-19   Eucalyptus grandis [rose gum]
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.1    1e-19   Phoenix dactylifera
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like     96.7    2e-19   Camelina sativa [gold-of-pleasure]
emb|CDY35358.1|  BnaA04g14890D                                        96.7    2e-19   Brassica napus [oilseed rape]
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1          96.7    2e-19   Brassica rapa
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like     96.7    2e-19   Solanum tuberosum [potatoes]
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like     96.7    2e-19   Elaeis guineensis
ref|NP_001234858.1|  EIN3-binding F-box protein 1                     96.3    2e-19   Solanum lycopersicum
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like     96.3    2e-19   Elaeis guineensis
emb|CDP10419.1|  unnamed protein product                              96.3    2e-19   Coffea canephora [robusta coffee]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2          95.9    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.9    3e-19   Glycine max [soybeans]
gb|KJB07737.1|  hypothetical protein B456_001G042600                  95.9    3e-19   Gossypium raimondii
emb|CAN83761.1|  hypothetical protein VITISV_043743                   95.9    4e-19   Vitis vinifera
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                    95.1    6e-19   Gossypium arboreum [tree cotton]
emb|CDX87090.1|  BnaC09g04050D                                        94.7    8e-19   
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like     94.0    2e-18   Nicotiana tomentosiformis
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.8    4e-18   Cucumis sativus [cucumbers]
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.8    4e-18   Phoenix dactylifera
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.8    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES73649.2|  EIN3-binding F-box-like protein                       92.4    4e-18   Medicago truncatula
ref|XP_003603398.1|  Ein3-binding f-box protein                       92.4    5e-18   
ref|XP_002874252.1|  ein3-binding F box protein 2                     92.0    6e-18   
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.0    7e-18   
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg           92.0    7e-18   
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like     91.7    9e-18   Nicotiana sylvestris
gb|ACB59221.1|  F-box protein                                         91.7    1e-17   Brassica oleracea
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.9    1e-17   Cucumis melo [Oriental melon]
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.5    2e-17   
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.5    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.1    3e-17   Fragaria vesca subsp. vesca
gb|AFU61111.1|  F-box protein                                         89.7    4e-17   Capsicum annuum
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                 88.2    1e-16   Citrus sinensis [apfelsine]
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg           88.2    1e-16   
emb|CDX88173.1|  BnaA06g27640D                                        88.2    1e-16   
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2          88.2    1e-16   Brassica rapa
ref|NP_197917.1|  EIN3-binding F-box protein 2                        88.2    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like     88.2    1e-16   
gb|KEH32122.1|  EIN3-binding F-box-like protein                       87.8    2e-16   Medicago truncatula
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like     87.4    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like     87.0    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like     85.1    1e-15   Camelina sativa [gold-of-pleasure]
emb|CDP13515.1|  unnamed protein product                              80.9    1e-15   Coffea canephora [robusta coffee]
emb|CDX80503.1|  BnaC07g29410D                                        85.1    2e-15   
gb|AES91540.2|  EIN3-binding F-box-like protein                       84.7    2e-15   Medicago truncatula
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like     84.3    2e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH32121.1|  EIN3-binding F-box-like protein                       84.0    4e-15   Medicago truncatula
gb|ABK25485.1|  unknown                                               83.6    4e-15   Picea sitchensis
gb|KJB07621.1|  hypothetical protein B456_001G033400                  83.6    4e-15   Gossypium raimondii
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg              83.2    7e-15   Erythranthe guttata [common monkey flower]
ref|XP_003609344.1|  Ein3-binding f-box protein                       83.2    8e-15   
dbj|BAH20224.1|  AT2G25490                                            82.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AEK81539.1|  EIN3 binding F-box 1                                  81.6    2e-14   Dianthus caryophyllus [carnation]
ref|XP_003609343.1|  Ein3-binding f-box protein                       80.9    5e-14   
gb|EPS63568.1|  ein3-binding f-box protein 3                          73.6    1e-11   Genlisea aurea
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like     71.2    6e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like     67.4    1e-09   Tarenaya hassleriana [spider flower]
ref|NP_001237471.1|  grr1 protein                                     65.5    4e-09   
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like     65.1    6e-09   Tarenaya hassleriana [spider flower]
dbj|BAD15849.1|  putative F-box protein                               63.9    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like     62.4    4e-08   Brachypodium distachyon [annual false brome]
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1          61.6    7e-08   Brachypodium distachyon [annual false brome]
gb|EMT19526.1|  hypothetical protein F775_07091                       62.0    7e-08   
dbj|BAJ88579.1|  predicted protein                                    61.6    9e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY84905.1|  hypothetical protein OsI_06273                        61.2    9e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like     61.2    1e-07   Setaria italica
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                  57.4    2e-06   
ref|NP_001147557.1|  LOC100281166                                     54.7    1e-05   Zea mays [maize]
gb|EAZ01599.1|  hypothetical protein OsI_23635                        53.5    3e-05   Oryza sativa Indica Group [Indian rice]
dbj|BAD35544.1|  putative F-box protein Fbl2                          53.5    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1        52.8    7e-05   
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like     51.2    2e-04   Oryza brachyantha
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like     50.1    5e-04   Nelumbo nucifera [Indian lotus]



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   151 bits (382),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F FSG + F PGG +YPS K+S  FLSL   VD YFPPCKR+RV  P++  E  + 
Sbjct  1    MSKVFNFSGDDAFCPGGALYPSPKESSLFLSLGHHVDVYFPPCKRSRVTAPIIFTE--KQ  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            KK P+I+VLPDECLFEV RRV DGKERSACAC SKRWLMLLSS+R
Sbjct  59   KKLPSIDVLPDECLFEVLRRVSDGKERSACACVSKRWLMLLSSIR  103



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   149 bits (376),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 70/105 (67%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F FSG   F PG  +YPS K+S  FLSL   VD YFPPCKR+R+  P++  E  + 
Sbjct  1    MSKVFNFSGDEAFCPGRALYPSPKESSLFLSLGHHVDVYFPPCKRSRITAPIIFTE--KQ  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            KK P+I+VLPDECLFEVFRRV DGKERSACAC SKRWLMLLSS+R
Sbjct  59   KKLPSIDVLPDECLFEVFRRVSDGKERSACACVSKRWLMLLSSIR  103



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   142 bits (358),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MSK+FEF+G  +F PGG +YP+ K++  FLSL   VD YFP CKR+R+  P V + + L+
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             KKK +I+VLPDECLFE+FRR+  G+ERSACAC SKRWLMLLS++R
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIR  106



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   142 bits (358),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MSK+FEF+G  +F PGG +YP+ K++  FLSL   VD YFP CKR+R+  P V + + L+
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             KKK +I+VLPDECLFE+FRR+  G+ERSACAC SKRWLMLLS++R
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIR  106



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   138 bits (348),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 66/104 (63%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F FSG + F+ GG +YPS K+S  FLSL   VD YFPPCKR+RV  P V  E  + 
Sbjct  1    MSKVFNFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTE--KK  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            +K  +I+VLPDECLFEV RR+ DGKERSA AC SKRWLMLLSS+
Sbjct  59   QKLSSIDVLPDECLFEVLRRLSDGKERSASACVSKRWLMLLSSI  102



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   137 bits (346),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F FSG ++F PGG +YP+ K+S  F   +P  D YFPPCKR RV +P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNRKESSLFF--YPNQDVYFPPCKRCRVSSPFVFAGGKFE  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +KKP+IE+LPDECLFE+FRR+  G+ERS CAC SKRWL L+S++RR
Sbjct  59   QKKPSIEILPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRR  104



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   137 bits (346),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F FSG ++F PGG +YP+ K+S  FL  +P  D YFPPCKR R+  P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFL--YPNQDVYFPPCKRYRISAPFVFAGGKFE  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +KKP+IEVLPDECLFE+FRR+  G+ERS CAC SKRWL L+S++RR
Sbjct  59   QKKPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRR  104



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   137 bits (345),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F FSG ++F PGG +YP+ K+S  FL  +P  D YFPPCKR R+  P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFL--YPNQDVYFPPCKRYRISAPFVFAGGKFE  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +KKP+IEVLPDECLFE+FRR+  G+ERS CAC SKRWL L+S++RR
Sbjct  59   QKKPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRR  104



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MSK+FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSKVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL+LLSS+ R
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICR  107



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   135 bits (340),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 64/107 (60%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MS++FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL+LLSS+ R
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICR  107



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   135 bits (340),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  473
            MS++FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL+LLSS+ R
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICR  107



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   135 bits (339),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 61/107 (57%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  473
            MSK+F+++G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             K++ +I+VLPDECLFE+ RR+ +G+E+SACAC SKRWLMLLSS++R
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQR  107



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   134 bits (338),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 64/105 (61%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MSK+F FSG  +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             K   +IE+LPDECLFE+FRR+ DGKERSACA  SKRWLMLLS++
Sbjct  61   SKANVSIEILPDECLFEIFRRLSDGKERSACATVSKRWLMLLSNI  105



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   134 bits (338),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 60/106 (57%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F FSG + FFPGG +YP+ K+S  F SL   VD YFP  KR+R+  P+V       
Sbjct  1    MSKLFSFSGSDNFFPGGSIYPNPKESSLFFSLGHHVDVYFPHHKRSRISPPIVCSGERVE  60

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            KK P+IE+LPDECLFE+FRR+  G+ERS+CAC SKRWL L+S++ R
Sbjct  61   KKNPSIEILPDECLFEIFRRLPGGQERSSCACVSKRWLTLVSNIHR  106



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            M  +  +SG +E + GG +Y +S D G   S+  RVD Y P CKRAR+  P +    G E
Sbjct  1    MPALVNYSGDDEIYSGGSLYANSSDLGRLYSIGSRVDVYSPACKRARISAPFLFGSSGFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K+P+IEVLPDECLFE+FRRV +GKERS+CAC SK+WLMLLSS+RR
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRR  107



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F FSG ++F PGG MYP+ K+S  FLSL   VD YFP  KR+R+  P V       
Sbjct  1    MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            +KKP+IEVLPDECLFE+FRR+  G+ERS+CAC SKRWL ++S++R
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIR  105



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            M  +  +SG +E + GG  Y +S D G   S+ PRVD Y P CKRAR+  P +    G E
Sbjct  1    MPALVNYSGDDEIYSGGSFYANSSDLGRLYSIGPRVDVYSPACKRARISAPFLFGSSGFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
               +P+IEVLPDECLFE+FRRV +GKERS+CAC SK+WLMLLSS+RR
Sbjct  61   QNTRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRR  107



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   132 bits (333),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F+F G ++F PGG +Y + K++G FL L   VD YFPP KR+R+  P V   G+  
Sbjct  1    MSKVFDFGGDSDFCPGGFLYQNPKEAGLFLPLGSHVDVYFPPRKRSRISAPFVV-SGV-A  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            K++P+IE+LPDECLFEVFRR+  G ERSACAC SKRWLMLLSS+ R
Sbjct  59   KQQPSIEILPDECLFEVFRRLPGGHERSACACVSKRWLMLLSSIYR  104



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  473
            MSK+F+++G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             K++ +I+VLPDECLFE+ RR+ +G+E+SACAC SKRWLMLLSS++R
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQR  107



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   131 bits (330),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MSK+F FSG  +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             K   +IE+LPDECLFE+FRR+  GKERSACA  SKRWLMLLS++
Sbjct  61   SKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNI  105



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   131 bits (330),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F  SG ++F PGGP+YP+ K+SG  L L P VD YF   KR+R+  P V  E    
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDIYFRARKRSRISAPFVYSEERFE  60

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL LLS++ R
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACACVSKRWLSLLSNIHR  106



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   131 bits (329),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MSK+  FSG ++F PGG +Y + K++  FL L P+VD YFPP KR+RV  P V   E  E
Sbjct  1    MSKVLGFSGGDDFCPGGSLYANPKEASFFLPLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             K+K +IE LPDECLFE+FRR+  G++RSACAC SKRWLMLLSS+
Sbjct  61   QKQKTSIESLPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSI  105



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/107 (57%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  473
            MSK+F F+G ++F PGGP+Y + K++   LSL   VD YFP  KR+R+  P V+  E  E
Sbjct  1    MSKLFGFAGDDDFCPGGPIYANPKEASLLLSLGRHVDVYFPSRKRSRISAPFVLVGERFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL LLS++ R
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLALLSNMSR  107



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MSK+  FSG ++F P G +Y + K++  FLSL P+VD YFPP KR+RV  P V   E  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLSLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             K+K +IE LPDECLFE+FRR+  G++RSACAC SKRWLMLLSS+
Sbjct  61   QKQKTSIEALPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSI  105



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   130 bits (327),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 65/105 (62%), Positives = 76/105 (72%), Gaps = 6/105 (6%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F FSG +    GG +YPS K+S  FLSL   VD YFPPCKR+RV  P V  E  + 
Sbjct  1    MSKVFNFSGDH----GGTVYPSPKESSLFLSLRNHVDVYFPPCKRSRVAVPFVFSE--KK  54

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             K  +I+VLPDECLFEV RR+ DGK+RSA AC SKRWLMLLSS+R
Sbjct  55   HKLSSIDVLPDECLFEVLRRLSDGKDRSASACVSKRWLMLLSSIR  99



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   129 bits (325),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MSK+  FSG ++F P G +Y + K++  FL L P+VD YFPP KR+RV TP V   E  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLPLGPQVDVYFPPRKRSRVNTPFVFDGEWFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             K K ++E LPDECLFE+FRR+  G++RSACAC SKRWLMLLSS+
Sbjct  61   QKPKTSVEALPDECLFEIFRRLPSGEDRSACACVSKRWLMLLSSI  105



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   128 bits (321),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F  SG ++F PGGP+YP+ K+SG  L L P VD YF   KR+R+  P V  E    
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDVYFRARKRSRISAPFVYSEERFE  60

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +IEVLPDECLFE+FRR+  G+ERSACA  SKRWL LLS++ R
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACASVSKRWLSLLSNIHR  106



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   128 bits (321),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/107 (53%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            M  +  +SG +EF+ GG +  +  D G + S+   VD Y PPCKRAR+ +P +      E
Sbjct  1    MPALVNYSGDDEFYSGGSLCANPMDLGRYYSIGSHVDAYSPPCKRARISSPFLFGSSEFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K+P+I+VLPDECLFE+FRR+  GKERSACAC SKRWL LLSS+RR
Sbjct  61   QNKQPSIDVLPDECLFEIFRRIPGGKERSACACVSKRWLTLLSSIRR  107



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   128 bits (321),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+F FSG ++F PGG +Y + K+S  FLSL   VD YFP  KR+R+  P V       
Sbjct  1    MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            +KKP+IEVLPDECLFE+FRR+  G+ERS+CAC SKRWL ++S++R
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIR  105



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   127 bits (318),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 2/104 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS++ +FSG N F P   +Y + K+S  FLSL   V+ YF P KR+R+  P +     EP
Sbjct  1    MSQVVDFSGDNSFCPSAFLYQNPKESSQFLSLGSHVNVYFTPRKRSRITAPFIVSG--EP  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            K+KP+IE+LPDECLFEVFRR+  G+ERSACA  SKRWLMLLSS+
Sbjct  59   KQKPSIEILPDECLFEVFRRLEGGQERSACASVSKRWLMLLSSI  102



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   126 bits (317),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  473
            MSK+F F+G N+F PGGP+Y + K+   FLS+   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             KK+ +IE LPDECLFE+FRR+  G ER ACAC SKRWL LLS++
Sbjct  61   QKKQASIEFLPDECLFEIFRRLPGGDERGACACVSKRWLSLLSNI  105



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   126 bits (316),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL-E  473
            MSK+  F+G  +F+ G  +Y S K++  FLSL   VD YFPP KR+R+  P V  E L E
Sbjct  1    MSKVLRFTGGEDFYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSEDLFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             K++ TIEVLPDECLFE+FRR+  G+ERSACAC SKRWL LLS++
Sbjct  61   QKRQDTIEVLPDECLFEIFRRLPGGQERSACACVSKRWLNLLSNI  105



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   126 bits (316),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  473
            MSK+F F+G N+F PGGP+Y + K+   FLS+   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             KK+ +IEVLPDECLFE+FRR+  G ER ACAC SK WL LLS++
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGNERGACACVSKHWLSLLSNI  105



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   124 bits (312),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MSK+F F+G ++F PGG +Y + K++G FLSL  RVD Y+PP KR+R   P V   E  E
Sbjct  1    MSKLFGFAGSDDFCPGGSIYENPKEAGRFLSLGRRVDLYYPPSKRSRNSAPFVFNQESFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K+ +I+VLP+ECLFE+F+R+  G+ERSACAC SK+WL LLS++ R
Sbjct  61   QNKQVSIDVLPEECLFEIFKRLPGGEERSACACVSKKWLSLLSNIHR  107



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   124 bits (312),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            M  +  +SG +E + GG  Y +  D G   S+   VD Y P CKRAR+ TP +    G E
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISTPFLFESSGFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K+P+IEVLPDECLFE+FRRV +GKERS+CA  SK+WLMLLSS+RR
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRR  107



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   122 bits (305),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  473
            M  +  +SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQFASGRSDFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              KKP+I+VLPDECLFE+FRR++ GKERS+CA  SK+WLMLLSS+R+
Sbjct  61   QVKKPSIDVLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSVRK  107



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   122 bits (305),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/107 (53%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            M  +  ++G  +F  GG +Y +  DS   LSL P VD Y PP KR+R+  P V  C+  E
Sbjct  1    MPTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRISAPFVFRCDKFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             +K+ +IEVLPDECLFE+FRR+  G+ERSACA  SKRWL+LLSS+RR
Sbjct  61   QQKQSSIEVLPDECLFEIFRRLPGGQERSACASVSKRWLVLLSSIRR  107



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   121 bits (304),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = +3

Query  291  IPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-  467
            +PMS +  +SG ++F+PGG  Y +  DSG  +S+   +D Y PP KR+R+  P +  E  
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  468  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            LE +K+P+I+VLPDECLFE+ RR+  G+ERS+CA  SKRWLMLLSS+RR
Sbjct  61   LELEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRR  109



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   122 bits (305),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 76/99 (77%), Gaps = 1/99 (1%)
 Frame = +3

Query  321  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIE  497
            G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E K++ +I+
Sbjct  109  GNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFEQKEQVSID  168

Query  498  VLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            VLPDECLFE+ RR+ +G+E+SACAC SKRWLMLLSS++R
Sbjct  169  VLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQR  207



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   121 bits (304),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 3/106 (3%)
 Frame = +3

Query  297  MSKIFEFS--GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL  470
            M+KIF F+     +FFP  P+YP+ KD+  FLSL P VD Y+P  KR+RV  P V    +
Sbjct  1    MAKIFGFTLKESEDFFPA-PIYPNPKDTSLFLSLGPHVDVYYPLRKRSRVSAPYVPSGEI  59

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
              KK+ +IEVLPDECLFE+F+R+ D + RS CAC SKRWLMLLSS+
Sbjct  60   LKKKEASIEVLPDECLFEIFKRLPDRETRSLCACVSKRWLMLLSSI  105



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   120 bits (302),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 59/106 (56%), Positives = 76/106 (72%), Gaps = 3/106 (3%)
 Frame = +3

Query  297  MSKIFEFS--GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL  470
            M+KIF F+     +FFPG P+YP+ KD+  FLSL  +VD Y+P  KR+RV  P V   G 
Sbjct  1    MAKIFGFTLTESEDFFPGAPIYPNPKDTSLFLSLGRQVDVYYPLRKRSRVSAPFVP-SGE  59

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
              KK+ +IEVLPDECLFE+F+R+ + + RS CAC SKRWLMLLSS+
Sbjct  60   ILKKEASIEVLPDECLFEIFKRLPERETRSLCACVSKRWLMLLSSI  105



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   120 bits (300),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +3

Query  330  EFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLEPKKKPTIEVLP  506
            +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E K   +IE+LP
Sbjct  3    DFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEILP  62

Query  507  DECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            DECLFE+FRR+ DGKERSACA  SKRWLMLLS++
Sbjct  63   DECLFEIFRRLSDGKERSACATVSKRWLMLLSNI  96



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   120 bits (301),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 57/107 (53%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            M  +  ++G  +F  GG +Y +  DS   LSL P VD Y PP KR+R+  P V   +  E
Sbjct  1    MRTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRITAPFVFRGDKFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             KK+ +IEVLPDECLFE+FRR+  G+ERS CAC SKRWL LLSS+RR
Sbjct  61   QKKQSSIEVLPDECLFEIFRRLPGGQERSICACVSKRWLFLLSSIRR  107



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   120 bits (300),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            M  +  + G +E++PGG  Y S  D  +FL     VD YF P KRAR+G+PVV      E
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFHPSKRARIGSPVVFGGREFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             +  P+IE LPDECLFE+FR +H  +ERS+CA  SKRWLMLLS++R+
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRK  107



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   119 bits (299),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLH--PRVDGYFPPCKRARVGTPVV-ACEG  467
            MS+IF+FSG+ EF+ GG +Y + K++GSFLSL     VD YFP  KRAR+  P+V   E 
Sbjct  1    MSQIFDFSGNEEFYHGGSIYSNPKEAGSFLSLGIVNHVDVYFPN-KRARISAPLVPGGES  59

Query  468  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            LE KK+ +++VLPDECL+E+ RR+   +ERS+CA  SKRWLMLLSS+
Sbjct  60   LEQKKQVSLDVLPDECLYEILRRLPGDQERSSCASVSKRWLMLLSSI  106



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = +3

Query  291  IPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-  467
            +PMS +  +SG ++F+PGG  Y +  DSG  +S+   +D Y PP KR+R+  P +  E  
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  468  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            LE +K+P+I+VLPDECLFE+ RR+  G+ERS+CA  SKRWLMLLSS+RR
Sbjct  61   LELEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRR  109



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   119 bits (298),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            M  +  + G +E++PGG  Y S  D  +FL     VD YF P KRAR+G PVV      E
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFRPSKRARIGAPVVFGGREFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             +  P+IE LPDECLFE+FR +H  +ERS+CA  SKRWLMLLS++R+
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRK  107



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   119 bits (297),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 2/105 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MS++F FSG N F P G +Y + K++  F SL  +VD YFPP KR+RV  P V   E   
Sbjct  1    MSQVFGFSGDN-FCPSGSIYTNPKEASFFPSLGHQVDAYFPPQKRSRVSVPFVFDGEWFT  59

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             K+K +IE LPDECLFE+FRR+  G+ERS+CAC SKRWLMLLS++
Sbjct  60   QKQKTSIESLPDECLFEIFRRLPVGEERSSCACVSKRWLMLLSNI  104



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   119 bits (297),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  321  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEV  500
            G ++F PGG +YP+ K+S  FLSL   VD YFP  K++R+  P V       +KKP+I+V
Sbjct  56   GSDDFCPGGSIYPNPKESSHFLSLGHHVDVYFPLRKKSRISAPFVFSGERFEQKKPSIDV  115

Query  501  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            LPDECLFE+FRR+  G+ERSACAC SKRWL L+S++R+
Sbjct  116  LPDECLFEIFRRLPGGQERSACACVSKRWLTLVSNIRK  153



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   118 bits (296),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  473
            MSK+  F+G ++F PGG +Y + K+ G FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRKRSRINAPFVFSGERFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             KK+ +IEVLPDECLFE+FRR+  G+ERSACA  SKRWL LLS+L R
Sbjct  61   KKKQASIEVLPDECLFEIFRRL-PGEERSACAGVSKRWLGLLSNLSR  106



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   118 bits (295),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 56/105 (53%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGLE  473
            MSK+F F+G+++F+ GGP+YP+ K+   FLSL  +VD Y P  KR+R   P  ++ E  E
Sbjct  1    MSKVFSFTGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             K K +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+
Sbjct  61   QKPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSI  105



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            M  +  +SG +E + GG  Y +  D G   S+   VD Y P CKRAR+  P +    G E
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISAPFLFESSGFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
               +P+IEVLPDECLFE+FRRV +GKERS+CA  SK+WLMLLSS+RR
Sbjct  61   QNMRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRR  107



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   118 bits (295),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MS++F FSG N  F  G +Y + K++  FLSL P+VD Y+PP KR+RV  P V   E  E
Sbjct  1    MSQVFGFSGDN--FCHGGLYTNPKEANFFLSLGPQVDVYYPPQKRSRVSVPFVFDGEWFE  58

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             K+K +IE LPDECLFE+FRR+  G+ERSA AC SKRWLMLLS++
Sbjct  59   QKQKTSIESLPDECLFEIFRRLPVGEERSASACVSKRWLMLLSNI  103



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   117 bits (294),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            MSK+  F+G+++F PGG +Y + K+   FLS     D +F P KR+R+  P V + EG E
Sbjct  1    MSKLLGFAGNDDFCPGGSIYTNPKEPSLFLSRGNHADVFFTPRKRSRISGPFVFSEEGFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             KK  +I+VLPDECLFE+F+R+  G+ERSACAC SKRWL LLS++ R
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKRWLTLLSNIHR  107



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   117 bits (293),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 56/106 (53%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P       E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTTVFSAFE-  59

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            KK  + +VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+
Sbjct  60   KKPVSFDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQ  105



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   117 bits (293),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/107 (50%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL-E  473
            M  +  + G ++F+ GG  Y +S D G   S+  +VD Y+PP KRAR+  P V  E L E
Sbjct  1    MPALVNYGGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYYPPRKRARITAPFVVGETLFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K+ +I+VLPDECLFE+F+R+  G+ERS+CAC SK WLMLL S+R+
Sbjct  61   QSKQASIDVLPDECLFEIFKRLPGGRERSSCACVSKHWLMLLISIRK  107



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   117 bits (293),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  473
            M  +   SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNSSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K P+I VLPDECLFE+FRR+  GKERS+CA  SK+WLMLLSS+R+
Sbjct  61   QVKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLLSSIRK  107



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   117 bits (292),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC-EGLE  473
            M  +  + G ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYCGDDDFYPGGSFYSNPMDLGCLLSMGAHVDVYCPPSKRARISSQFASGGSDFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              KKP+I+ LPDECLFE+FRR++ GKERS+CA  SK+WLMLLSS+R+
Sbjct  61   QVKKPSIDDLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSIRK  107



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   117 bits (292),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V     E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEE-  59

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             K+ +I+VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+
Sbjct  60   -KQVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQ  104



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   117 bits (292),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 59/108 (55%), Positives = 72/108 (67%), Gaps = 8/108 (7%)
 Frame = +3

Query  288  PIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACE  464
            P P+S         +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E
Sbjct  55   PFPVSS-------EDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGE  107

Query  465  GLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             +E K   +IE+LPDECLFE+FRR+  GKERSACA  SKRWLMLLS++
Sbjct  108  EVESKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNI  155



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   116 bits (291),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+I+ F+G N+F+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V   G E 
Sbjct  1    MSQIYSFAGENDFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVF-SGFE-  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            KK  +I+VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+
Sbjct  59   KKPVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLKLVSSIRQ  104



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   115 bits (289),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V       
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSSF---  57

Query  477  KKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +KKP +I+VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+
Sbjct  58   EKKPVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQ  104



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   115 bits (289),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  473
            M  +  +SG ++F+ GG  Y +S D G   S+  +VD Y PP KR R+  P    E  +E
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISSQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K+P+I+VLPDECL E+F+R+  GKERS+CAC SK WLMLL+S+R+
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRK  107



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   115 bits (289),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/106 (52%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE  59

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            KK+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ R
Sbjct  60   KKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDR  105



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   115 bits (289),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV-GTPVVACEGLE  473
            MSK+    G+++F PGG +Y + K+   FLSL    D +F P KR+R+ GT V + EG E
Sbjct  1    MSKLLGLPGNDDFCPGGSIYTNPKEPSLFLSLGNHADVFFTPRKRSRISGTFVFSEEGFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             KK  +I+VLPDECLFE+F+R+  G+ERSACAC SK WL LLS++ R
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKHWLTLLSNIHR  107



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   115 bits (288),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 56/106 (53%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+IF F+G N+F+  G +YP+ KD+   LSL    D YFPP KR+RV  P +     E 
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIF-SAFE-  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            KK  +I+VLPDECLFE+FRR+   +ERSACA  SK+WL L+SS+R+
Sbjct  59   KKPVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTLVSSIRQ  104



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   115 bits (288),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  473
            M  +  +SG +EF+ GG +  +S       S+   VD Y PPCKRAR  +P +      E
Sbjct  1    MPTLVNYSGDDEFYAGGSLCTNSM----LYSIGSLVDIYSPPCKRARTSSPFLFGSSDFE  56

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K+P+I+VLPDECLFE+FRR+  GKERS+CAC SKRWL+LLSS++R
Sbjct  57   QNKQPSIDVLPDECLFEIFRRIPGGKERSSCACVSKRWLLLLSSIKR  103



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   115 bits (287),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  473
            M  +  +SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
              K P+I VLPDECLFE+FRR+  GKERS+CA  SK+WLML+SS+
Sbjct  61   QIKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLISSI  105



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   114 bits (286),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  473
            M  +  +SG ++F+ GG  Y +S D G   S+  +VD Y PP KR R+  P    E  +E
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISFQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K+P+I+VLPDECL E+F+R+  GKERS+CAC SK WLMLL+S+R+
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRK  107



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   114 bits (286),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +3

Query  324  HNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIEV  500
            +++F PGGP+Y + KDS  FLSL   VD YFP  KR+R+  P V + E L+ KKK +I+V
Sbjct  59   NDDFCPGGPIYSNPKDSSLFLSLGNHVDVYFPSRKRSRISAPFVFSEERLQKKKKASIDV  118

Query  501  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            LPDECLFE+FRR+   +ERSA AC SKRWLMLLS++R+
Sbjct  119  LPDECLFEIFRRL-PAEERSASACVSKRWLMLLSNIRQ  155



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/106 (53%), Positives = 73/106 (69%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V     E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEE-  59

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             K  +I+VLPDECLFE+FRR+   +ERS+CA  SK WL L+SS+R+
Sbjct  60   -KPVSIDVLPDECLFEIFRRLPGPQERSSCAFVSKHWLTLVSSIRQ  104



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   112 bits (280),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 54/106 (51%), Positives = 71/106 (67%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+IF FSG N+F+  G  YP+ KD    LSL   VD YFPPCKR+RV  P       E 
Sbjct  1    MSQIFSFSGENDFYRRGVTYPNPKDVNLLLSLGSLVDCYFPPCKRSRVVAPSRYSAFEE-  59

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             K  +I+VLP+ECLFE+FRR+   +ER+ACA  S+ WL L++S+R+
Sbjct  60   -KPVSIDVLPEECLFEIFRRLSGSQERTACASVSRHWLTLVTSIRQ  104



>ref|XP_008347724.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=150

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGY-F  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ R
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINR  104



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   112 bits (279),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 51/100 (51%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +3

Query  318  SGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTI  494
            SG ++F+ GG  Y +S D G   S+  +VD Y PP KRAR+  P +  E   E  K+P+I
Sbjct  55   SGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYCPPRKRARICAPFLFGETEFEQNKQPSI  114

Query  495  EVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +VLP+ECLFE+F+R+  G+ERS+CAC SK WLMLL+S+R+
Sbjct  115  DVLPEECLFEIFKRLPGGRERSSCACVSKHWLMLLTSIRK  154



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 54/106 (51%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ R
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINR  104



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 75/104 (72%), Gaps = 2/104 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+  FSG ++F PGG +Y + K++G FLSL    D  FPP KR+R+  P V   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGG-RF  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            +K+ +I+VLPDECLFE+F+R+  G+ERSACAC S+RWL +LS++
Sbjct  59   EKEVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNI  102



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 54/106 (51%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ R
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINR  104



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 54/106 (51%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ R
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINR  104



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   111 bits (277),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 75/104 (72%), Gaps = 2/104 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+  FSG ++F PGG +Y + K++G FLSL    D  FPP KR+R+  P V   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGG-RF  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            +K+ +I+VLPDECLFE+F+R+  G+ERSACAC S+RWL +LS++
Sbjct  59   EKEVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNI  102



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS++F+F    +F PGG    + K S  FL L   VD YF P KR+R+  P V     EP
Sbjct  1    MSEVFDFKAVGKFCPGG-FLTNPKVSSLFLPLGNHVDVYFLPRKRSRISAPFVVSG--EP  57

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +++P+I+VLPDECLFEVFRR+  G+ERSACAC SKRWLML+SS+ R
Sbjct  58   EQQPSIDVLPDECLFEVFRRLPGGQERSACACVSKRWLMLMSSIAR  103



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 3/106 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGL-  470
            MS++F FSG+++F PGG +YP+ K+   FLSL   VD YFP  KR+RV     +  E   
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFPLQKRSRVSVSFDINREWFD  59

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            EPK+K +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+
Sbjct  60   EPKQKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSI  105



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/105 (50%), Positives = 71/105 (68%), Gaps = 3/105 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLS-LHPRVDGYFPPCKRARVGTPVVACEGLE  473
            M  +  +SG +E +PGG   PS  + G   S +   +D Y+PP KR+R  + + A EG +
Sbjct  1    MPALVNYSGDDELYPGGSFCPSPMELGRLYSTIGSNLDLYYPPNKRSR--SILEAIEGEQ  58

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
              ++P IEVLPDECLFE+FRR+  GKERS CAC SKRWLML+SS+
Sbjct  59   HYQEPGIEVLPDECLFEIFRRLPSGKERSLCACVSKRWLMLMSSI  103



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   109 bits (273),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 54/101 (53%), Positives = 72/101 (71%), Gaps = 3/101 (3%)
 Frame = +3

Query  315  FSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGLEPKKKP-  488
            FSG+++F+ GGP+YP+ K+   FLSL  +VD Y P  KR+R   P  ++ E  E K+KP 
Sbjct  4    FSGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFEQKQKPK  63

Query  489  -TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+
Sbjct  64   TSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSI  104



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 54/108 (50%), Positives = 73/108 (68%), Gaps = 4/108 (4%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSS-KDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-L  470
            MS + ++SG +    GGP+Y S   DS  FLSL P +D Y PP KR+RV  P V  E   
Sbjct  1    MSTLVKYSGDDRH--GGPLYSSGLMDSSLFLSLAPNLDVYCPPRKRSRVTAPFVLWENNT  58

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              ++KP+++ LPDECLFE+ RRV+  ++RSACAC SK WLML S+++R
Sbjct  59   NFQRKPSLDNLPDECLFEILRRVNTSRDRSACACVSKHWLMLQSTIKR  106



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   107 bits (267),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 56/105 (53%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS +  +SG NEF+ GG +   S D G  L+L    D Y P  KRAR+  P V     E 
Sbjct  1    MSTLVNYSGDNEFYSGGSL--CSADLGLMLALG-HADIYCPVSKRARISGPFVV---EER  54

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             K P+IEVLP+ECLFE+FRR+  G+ERSA AC SKRWLMLLS++R
Sbjct  55   TKNPSIEVLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMR  99



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score =   107 bits (266),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 2/105 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+IF  +G N F P G +YP+ K++   LSL   VD YFPPCKR RV  P      +  
Sbjct  1    MSEIFSIAGENGFCPRGSIYPNPKEASLLLSLGSLVDAYFPPCKRTRVSAPTAF--SVFE  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            +   +I+VLPDECLFEVFRR+   +ERS CA  SKRWL LLS +R
Sbjct  59   QDPVSIDVLPDECLFEVFRRLPGAQERSVCASVSKRWLNLLSGIR  103



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score =   107 bits (266),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 51/107 (48%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDG-YFPPCKRARVGTPVVACEGLE  473
            MS+IF F+G N+F+  G +YP+ K++   LSL   VD  Y+PPCKR+RV     +     
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKEANLLLSLTSLVDCCYYPPCKRSRVVATAPSLFSAF  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K  +I+VLPDECLFE+FRR+   +ERSACA  SK WL L++S+++
Sbjct  61   EAKPVSIDVLPDECLFEIFRRLPGPQERSACASVSKHWLTLVTSIKQ  107



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   106 bits (264),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 50/102 (49%), Positives = 70/102 (69%), Gaps = 1/102 (1%)
 Frame = +3

Query  309  FEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKP  488
            +  +G ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   KK+ 
Sbjct  9    YWLAGKDDFCPGG-IYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKKEV  67

Query  489  TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ R
Sbjct  68   SINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDR  109



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   106 bits (264),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 55/106 (52%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+IF F+G ++F P G +YP+ K++   LSL   VD YFPP K++RV  P+VA    E 
Sbjct  1    MSEIFSFAGESDFCPRGSIYPNPKETSLLLSLGSLVDVYFPPRKKSRVSAPLVA-RAFE-  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            ++  +I+VLPDECLFE+FRR+   +ER ACA  SKRWL LLSS+ +
Sbjct  59   QEPVSIDVLPDECLFEIFRRMPGAQERCACASVSKRWLNLLSSIHQ  104



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   105 bits (262),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 70/105 (67%), Gaps = 11/105 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS +F FSG  +FFPGG +Y         LS   ++D Y+P  KR+R+  P +   G E 
Sbjct  1    MSGLFRFSGDEDFFPGGSLY---------LSPGSQIDVYYPAHKRSRIAAPAIF-SGFE-  49

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            + + +I+VLPDECLFE+FR +  G+ERSACAC SKRWL LLS++R
Sbjct  50   QNQVSIDVLPDECLFEIFRCLPSGQERSACACVSKRWLGLLSNIR  94



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS +  +SG NEF+ GG +   S D G  L+L    D Y P  KRAR+  P +     E 
Sbjct  1    MSTLVNYSGDNEFYSGGSL--CSADLGLILALG-HADIYCPVSKRARISGPFIV---EER  54

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             K P+IE+LP+ECLFE+FRR+  G+ERSA AC SKRWLMLLS++R
Sbjct  55   TKNPSIELLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMR  99



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 57/106 (54%), Positives = 67/106 (63%), Gaps = 11/106 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS IF FSG  +FFPGG M+ S           P V  YFP  KR R+  P V   G E 
Sbjct  1    MSGIFRFSGDEDFFPGGSMHLSPGSC-------PGV--YFPARKRLRIAAPSVQI-GFE-  49

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +IEVLPDECLFE+ RR+  G+ERSACAC SK WL LLSS+ R
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISR  95



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  473
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLDRLYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  60

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             ++  +I  LPDECLFE+FRR+  G+ERSACAC SK WL LLSS+RR
Sbjct  61   GERPSSIGELPDECLFEIFRRLPGGRERSACACVSKHWLFLLSSMRR  107



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 49/105 (47%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGS-FLSLHPRVDGYFPPCKRARVGTPVVACEGLE  473
            M  +  +SG +E +PGG   P+  + G  + ++   +D Y+PP KR R  +   A E  +
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPMELGRLYTTIGSNLDMYYPPTKRPR--SIFEAIEREQ  58

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
              + P IEVLPDECLFE+FRR+  GKERS+CAC SKRWLML+S++
Sbjct  59   YYQDPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTI  103



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 54/108 (50%), Positives = 67/108 (62%), Gaps = 11/108 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG--L  470
            M  +  +SG +EF+ GG   P         S+   VD Y PP KRAR+  P  A EG   
Sbjct  1    MPTLVNYSGDDEFYSGGSCSP--------YSIASHVDLYCPPSKRARISAPF-ALEGSFF  51

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            E  +KP+I+VLPDECLFE+ R V  GKER + AC SKRWLML+SS+RR
Sbjct  52   EQAEKPSIDVLPDECLFEILRHVQGGKERISSACVSKRWLMLMSSIRR  99



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/105 (47%), Positives = 70/105 (67%), Gaps = 3/105 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGS-FLSLHPRVDGYFPPCKRARVGTPVVACEGLE  473
            M  +  +SG +E +PGG   P+  + G  + ++   +D Y+PP KR R  +   A E  +
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPVELGRLYTTIGSNLDVYYPPTKRPR--SIFEAIEREQ  58

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
              ++P IEVLPDECLFE+FRR+  GKERS+CAC SKRWLML+S++
Sbjct  59   YYQEPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTI  103



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYF-PPCKRARVGTP-VVACEGL  470
            M  +  +SG +E +PG     +  D G   +L   V+GY+  P KRAR+  P +     L
Sbjct  1    MPALVNYSGDDELYPGASFGQNLIDLGRMCTLGSSVEGYYCTPNKRARINAPDIFETLRL  60

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
               +KP IEVLP+ECLFE+FRR+  GKERS+C+C SKRWLML+S +
Sbjct  61   RKDQKPAIEVLPNECLFEIFRRLSSGKERSSCSCVSKRWLMLMSRI  106



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   103 bits (257),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 7/108 (6%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            M  +   SG +E +PGG M       G   ++   VD Y  P KRAR+  P      +E 
Sbjct  1    MPALVNSSGDDEMYPGGSM----DLGGCLYTISSNVDVYCSPTKRARISAPFTF-GAVEH  55

Query  477  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            K+  KP++E+LPDECLFE+FRR+  GKERS+CAC SKRWLML+S++ +
Sbjct  56   KQDHKPSVEILPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTISK  103



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 66/106 (62%), Gaps = 3/106 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MSK+  + G  E    G ++P S  S +F       + Y    KR R+  P VA  G E 
Sbjct  14   MSKVLGYGGVCEH-QAGMLFPRSDYSDTFFPFGNHFESYSLQRKRCRISAPFVA--GREV  70

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            K  P+IE+LPDECLFE+FRR+H  KE+S CAC SKRWLMLLSS+R+
Sbjct  71   KLLPSIEILPDECLFEIFRRLHGNKEKSVCACVSKRWLMLLSSIRK  116



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score =   100 bits (250),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 56/106 (53%), Positives = 66/106 (62%), Gaps = 11/106 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS IF FSG  +FF GG MY S           P V  YFP  KR R+  P V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMYLSPGSC-------PGV--YFPAHKRLRIAAPSVF-SGFE-  49

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +I+VLPDECLFE+ RR+  G+ERSACAC SK WL LLSS+ R
Sbjct  50   QKQTSIDVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISR  95



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   100 bits (250),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 68/106 (64%), Gaps = 3/106 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFP-GGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLE  473
            M  +    G ++F+  GG +   S DSG   S+   V+ Y PP KR+R+  P +    L 
Sbjct  1    MPALVNIRGDDDFYSEGGSL--CSGDSGVVFSISSHVEIYCPPRKRSRISGPYIVSRNLF  58

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
              K+P+I+VLPDECLFE+FRR+  G+ERSA AC SKRWL +LSS+R
Sbjct  59   EDKRPSIDVLPDECLFEIFRRLPGGRERSASACVSKRWLTVLSSVR  104



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   100 bits (250),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  473
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  57

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             +   +I  LPDECLFE+FRR+  G+ERSACAC SK WL LLSS+RR
Sbjct  58   GEHPSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRR  104



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   100 bits (250),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 9/119 (8%)
 Frame = +3

Query  258  FRI*PAPDLPPIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRAR  437
            F + P       P+SK       ++F PGG +Y + K++G  LSL    D  FPP KR+R
Sbjct  43   FELHPCQSYLASPVSK-------DDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSR  94

Query  438  VGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +  P +   G   +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ R
Sbjct  95   ISAPFIFSGGYF-EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINR  152



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   100 bits (250),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 9/119 (8%)
 Frame = +3

Query  258  FRI*PAPDLPPIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRAR  437
            F + P       P+SK       ++F PGG +Y + K++G  LSL    D  FPP KR+R
Sbjct  43   FELHPCQSYLASPVSK-------DDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSR  94

Query  438  VGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +  P +   G   +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ R
Sbjct  95   ISAPFIFSGGYF-EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINR  152



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   100 bits (250),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  473
            M  +  +SG +EF+ GG +   S D G  LSL H +V  Y P  K+AR+  P V     E
Sbjct  1    MPTLVNYSGDDEFYSGGSL--CSADLGLMLSLGHAQV--YCPLRKKARISGPFVV---EE  53

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
              K P+IE+LPDECLFE+FRR+  G+ERSA AC SKRWLML S++R
Sbjct  54   RTKNPSIEILPDECLFEIFRRLQGGRERSAAACVSKRWLMLSSNVR  99



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 62/105 (59%), Gaps = 11/105 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS IF FSG  EFF GG MY S+               Y PP KR RV  P +       
Sbjct  1    MSGIFSFSGDEEFFNGGSMYLSTGSCSGV---------YLPPRKRLRVAAPSLYSSF--N  49

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC SK WL  L+S++
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIK  94



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 11/106 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS +F FSG   +FPGG M          LS    +  Y+P  KR+R+  P +   G E 
Sbjct  1    MSGLFRFSGDEGYFPGGSM---------CLSPGSNIGVYYPARKRSRISAPSLF-SGFE-  49

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            + + +IEVLPDECLFE+FRR+  G+ERS CAC SK+WL LLS++RR
Sbjct  50   RNQASIEVLPDECLFEIFRRLPSGQERSVCACVSKQWLGLLSNIRR  95



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 71/106 (67%), Gaps = 8/106 (8%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS++F+FS  + F       P+SKDS    +L  RVD YF   KR+R+  P +A  G + 
Sbjct  1    MSEVFDFSDVHTF------CPNSKDSNLSFTLGSRVDMYFLQRKRSRISAPFIA--GKKS  52

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            K + +IE LPDECLFE+ RR+  G+E +ACAC SKRWLMLLSS+++
Sbjct  53   KMQSSIEALPDECLFEILRRLPRGRETNACACVSKRWLMLLSSMKK  98



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 62/105 (59%), Gaps = 11/105 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS IF F+G  EFF GG MY S                Y PP KR RV TP +       
Sbjct  1    MSGIFSFNGDEEFFNGGSMYLSPGSCSGV---------YLPPRKRLRVSTPSLYSSF--N  49

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC SK WL  L+S++
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIK  94



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  473
            M  +  +SG +EF+ GG +   S D G  LSL H +V  Y P  KRAR+  P +     E
Sbjct  1    MPTLVNYSGDDEFYSGGSL--CSADLGLMLSLGHAQV--YCPLRKRARISGPFII---EE  53

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
              K P+IE+LPDECLFE+FRR+  G++RSA AC SKRWLML S++R
Sbjct  54   RTKNPSIEILPDECLFEIFRRLQGGRQRSAAACVSKRWLMLSSNVR  99



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 73/106 (69%), Gaps = 3/106 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGL-  470
            MS++F FSG+++F PGG +YP+ K+   FLSL   VD YF   KR+RV     +  E   
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFSLQKRSRVSVSFDINREWFD  59

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            E K++ +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+
Sbjct  60   EQKQEISIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSI  105



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 71/106 (67%), Gaps = 3/106 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV          E 
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSLGSLVDCYYPPCKRSRVVAAPSLFSAFEE  57

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K  +I+VLPDECLFE+FRR+   +ER+ACA  SK WL L++S+R+
Sbjct  58   EKPVSIDVLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQ  103



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  473
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  57

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             +   +I  LPDECLFE+FRR+  G+ERSACAC SK WL LLSS+RR
Sbjct  58   GEHPSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRR  104



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 5/110 (5%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            M  + ++ G ++  P GP++ +  DS   LSL P VD + PP KR+RV  P V   G + 
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFVFKGGEKG  60

Query  477  KKKP-----TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             +KP     +I+VLPDECLFE+ RR+   +ERS  AC SKRWLMLLSS+R
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRRLPGSRERSNSACVSKRWLMLLSSIR  110



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 55/106 (52%), Positives = 66/106 (62%), Gaps = 10/106 (9%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS IF FSG  +FF GG M+  S  S       P V  YFP  KR R+    V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHNLSPGSC------PGV--YFPARKRLRIAATSVF-SGFE-  50

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +I+VLPDECLFE+ RR+  GKERSACAC SK WL LL+S+ R
Sbjct  51   QKQTSIDVLPDECLFEILRRLPSGKERSACACVSKHWLHLLTSITR  96



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 73/108 (68%), Gaps = 8/108 (7%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV--GTPVVACEGL  470
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV    P +     
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE  54

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            E +K  +I++LPDECLFE+FRR+   +ER+ACA  SK WL L++S+R+
Sbjct  55   EEEKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQ  102



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 73/108 (68%), Gaps = 8/108 (7%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV--GTPVVACEGL  470
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV    P +     
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE  54

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            E +K  +I++LPDECLFE+FRR+   +ER+ACA  SK WL L++S+R+
Sbjct  55   EEEKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQ  102



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            M  +  +SG +EF+ GG     S D G  LSL    D Y PP KRAR+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGSF--CSADLGLMLSLG-HADVYCPPRKRARISGPFVV---EDR  54

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             K P++E+LPDECLFE+ RR+  G+ER A AC SKRWL +LSS+R
Sbjct  55   SKDPSLEILPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVR  99



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/111 (46%), Positives = 68/111 (61%), Gaps = 6/111 (5%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV----ACE  464
            M  +  + G ++    GP+  +  DS   LSL P VD + PP KR+RV  P +      +
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKK  60

Query  465  GLEPKKKP--TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            G E +K+   +I+VLPDECLFE+ RR+   KERS  AC SKRWLMLLSS+R
Sbjct  61   GAEKQKQQPCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIR  111



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            M  +  +SG +EF+ GG     S D G  LSL    D Y PP KRAR+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGSF--CSADLGLMLSLG-HADVYCPPRKRARISGPFVV---EDR  54

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             K P++EVLPDECLFE+ RR+  G+ER A AC SKRWL +LSS++
Sbjct  55   SKDPSLEVLPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVK  99



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 6/111 (5%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV----ACE  464
            M  +  + G ++    GP+  +  DS   LSL P VD + PP KR+RV  P +      +
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKQ  60

Query  465  GLEPKKKPT--IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            G E +K+ +  I+VLPDECLFE+ RR+   KERS  AC SKRWLMLLS++R
Sbjct  61   GAEKQKQQSCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSTIR  111



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 66/106 (62%), Gaps = 6/106 (6%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  473
            M  +  + G ++F+ G  +   S DSG  LS+    D Y PP KR+RV  P  V      
Sbjct  1    MPALVNYGGDDDFYTGRSI--CSADSGLVLSI---ADVYCPPRKRSRVSAPYAVDSRLFN  55

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             ++ P+IE LPDECLFE+FRR+   +ERSA AC SKRWLMLLSS+R
Sbjct  56   KERNPSIETLPDECLFEIFRRLPGAQERSASACVSKRWLMLLSSVR  101



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 55/106 (52%), Positives = 66/106 (62%), Gaps = 10/106 (9%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS IF FSG  +FF GG M+  S  S       P V  YFP  KR R+    V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHNLSPGSC------PGV--YFPARKRLRIAATSVF-SGFE-  50

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +I+VLPDECLFE+ RR+  GKERSACAC SK WL LL+S+ R
Sbjct  51   EKQTSIDVLPDECLFEILRRLPSGKERSACACVSKHWLNLLTSITR  96



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYF-PPCKRARVGTPVVACE--G  467
            M  +  +SG +E + GG    +  D G   +    VD Y+  P KRAR+   + A E  G
Sbjct  1    MPTLVNYSGDDELYHGGSFCQNPIDLGRLCTYGSIVDEYYYTPSKRARINA-LDAFEFLG  59

Query  468  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
             E  +KPTI+VLPDECLFEVFR +  GKERS+CA  SKRWLML+SS+
Sbjct  60   REQDQKPTIDVLPDECLFEVFRWLSSGKERSSCAYVSKRWLMLMSSI  106



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 67/107 (63%), Gaps = 5/107 (5%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACE-GLE  473
            M  +  +SG +EFF    +  +S + G   S+  + D Y+PP KR R+  P +  E   E
Sbjct  1    MPALVNYSGDDEFF----IRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFE  56

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K+P+I  LP EC+FE+F+R+  G+ERS CAC SKRWL LLSS+R+
Sbjct  57   QNKQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRK  103



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +3

Query  369  DSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHD  545
            DSG  +S+   +D Y PP KR+R+  P +  E  LE +K+P+I+VLPDECLFE+ RR+  
Sbjct  2    DSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLELEKRPSIDVLPDECLFEILRRLPG  61

Query  546  GKERSACACTSKRWLMLLSSLRR  614
            G+ERS+CA  SKRWLMLLSS+RR
Sbjct  62   GQERSSCARVSKRWLMLLSSIRR  84



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 46/107 (43%), Positives = 67/107 (63%), Gaps = 5/107 (5%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACE-GLE  473
            M  +  +SG ++FF    +  +S + G   S+  + D Y+PP KR R+  P +  E   E
Sbjct  1    MPALVNYSGDDDFF----IRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFE  56

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              K+P+I  LP EC+FE+F+R+  G+ERS CAC SKRWL LLSS+R+
Sbjct  57   QNKQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRK  103



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 63/105 (60%), Gaps = 11/105 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS IF FSG  +FF GG M+ S           P V  Y PP KR RV  P  +      
Sbjct  1    MSGIFSFSGDEDFFNGGTMHLSPGSC-------PGV--YLPPRKRLRVAAP--SPYSAFN  49

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC SK WL  L+S++
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIK  94



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/105 (47%), Positives = 63/105 (60%), Gaps = 17/105 (16%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            M  +  +SG +EF+ GGP          F S     + Y PP KR R+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGP----------FCS----AEVYCPPRKRVRISGPFVV---EDR  43

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             K P++E+LPDECLFE+ RR+  G+ERSA AC SKRWLMLLSS+R
Sbjct  44   SKDPSLEILPDECLFEILRRLPGGRERSAAACVSKRWLMLLSSVR  88



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            M  +  ++G +EF P      S +D   FL +  R++  F P KR R    +     L  
Sbjct  1    MPTLLNYTGDDEFHP-----TSMEDFPCFLPISSRINVCFQPNKRFRTNLKI---PFLGD  52

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
              KP+I+ LPDECLFE+F+R+ +GK +S+CAC SKRWLMLLSS+R
Sbjct  53   DTKPSIDDLPDECLFEIFKRLDNGKSKSSCACVSKRWLMLLSSIR  97



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 68/110 (62%), Gaps = 5/110 (5%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            M  + ++ G ++  P GP++ +  DS   LSL P VD + PP KR+RV  P +   G   
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFIFKGGENG  60

Query  477  KKKP-----TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             +KP     +I+VLPDECLFE+ R +   +ERS  AC SKRWLMLLSS+R
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRWLPGSRERSNSACVSKRWLMLLSSIR  110



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 71/109 (65%), Gaps = 5/109 (5%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG---  467
            M+ + ++ G+++  PG P Y +  DS   LSL  + D Y PPCKR RV  P++   G   
Sbjct  1    MAALVKYGGNDDICPG-PFYSNLTDSSLLLSLGQKADVYGPPCKRYRVTAPLIFRAGEKV  59

Query  468  LEPKKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            ++ +K+P +I+ LPDECLFE+ RR+   KERS  AC SK WLML+SS+R
Sbjct  60   IDEEKQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKHWLMLVSSIR  108



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV--VACEGL  470
            MSK+  F+G ++F  G  MY + K++  FLSL  +   Y P  KR+R   P      +  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            + K + +IE LPDECLFE+ RR+ +G++RS CA  SKRWL LLSS+ +
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISK  108



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV--VACEGL  470
            MSK+  F+G ++F  G  MY + K++  FLSL  +   Y P  KR+R   P      +  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            + K + +IE LPDECLFE+ RR+ +G++RS CA  SKRWL LLSS+ +
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISK  108



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 66/107 (62%), Gaps = 12/107 (11%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGP-MYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLE  473
            MS IF FSG  +FF GG  MY S           P V  YFP  KR R+  P V   G E
Sbjct  1    MSGIFRFSGDEDFFLGGSSMYLSPGSC-------PGV--YFPARKRLRIAAPSVF-SGFE  50

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
             +K+ +I+VLPDECLFE+ RR+  G+ERSACAC SK WL LLSS+ R
Sbjct  51   -EKQTSIDVLPDECLFEILRRLPSGEERSACACVSKHWLNLLSSISR  96



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 48/102 (47%), Positives = 65/102 (64%), Gaps = 5/102 (5%)
 Frame = +3

Query  321  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV---ACEGLEPKKKP-  488
            G ++    GP+  +  DS   LS+   VD +FPP KR+R+  P +     +G E +K+  
Sbjct  21   GTDDLCSVGPLISNLMDSSCLLSIASNVDVFFPPRKRSRITAPFIFKGGEKGAEKQKQQP  80

Query  489  -TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             +I+VLPDECLFE+ RR+   KERS  AC SKRWLMLLSS+R
Sbjct  81   CSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIR  122



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 60/84 (71%), Gaps = 6/84 (7%)
 Frame = +3

Query  369  DSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG--LEPKKKPTIEVLPDECLFEVFRRVH  542
            D G  LS+      Y+PP KRAR  +   A EG   E  +KP+IEVLPDECLFE+FRR+ 
Sbjct  2    DLGCLLSIGSV---YYPPSKRARKDSQF-AFEGSDFEQVRKPSIEVLPDECLFEIFRRLD  57

Query  543  DGKERSACACTSKRWLMLLSSLRR  614
             GKERS+CAC SK+WLMLLSS+R+
Sbjct  58   GGKERSSCACVSKKWLMLLSSIRK  81



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 62/105 (59%), Gaps = 17/105 (16%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            M  +   SG +EF+ GGP          F S     + Y PP KR R+ +P V     + 
Sbjct  1    MPTLVNHSGDDEFYSGGP----------FCS----AEVYCPPRKRVRISSPFVV---EDR  43

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             K P++E+LPDECLFE+ RR+  G+ERSA AC SK WLMLLSS+R
Sbjct  44   SKDPSLEILPDECLFEILRRLSGGRERSAAACVSKHWLMLLSSVR  88



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS+IF F+    F  G     + KD+   LSL    D YFPP KR RV  P +     E 
Sbjct  1    MSQIFSFAVKTIFTVGAQYTRNPKDASLLLSLISFGDVYFPPSKRQRVVLPTLF-SAFE-  58

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            KK  +I+VLPDECLFE+FRR+   +ERSACA  SK+WL  +SS+R+
Sbjct  59   KKPVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTTVSSIRQ  104



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 16/109 (15%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            M  +  ++G +EF P      S +D   FL +  R++  F P KR R    +       P
Sbjct  1    MPTLLNYTGDDEFHP-----TSMEDFPCFLPVSSRINVCFQPNKRVRANLKI-------P  48

Query  477  KKK----PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             ++    P+I+ LPDECLFE+F+R+++GK +S+CAC SKRWLMLLSS+R
Sbjct  49   FRRDDTNPSIDDLPDECLFEIFKRLYNGKSKSSCACVSKRWLMLLSSIR  97



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +3

Query  354  YPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFR  533
            YP+S+ S  FLS     +  FPP KR  V T   A +  E +  P+IE+L DECLF+VF+
Sbjct  6    YPTSRQSSLFLSRGQNRNVNFPPRKRICVTT---ASKNFEQRNHPSIEILLDECLFKVFK  62

Query  534  RVHDGKERSACACTSKRWLMLLSSLRR  614
             +  GKERS CAC SKRWL LLSS+R+
Sbjct  63   HLPSGKERSVCACVSKRWLTLLSSIRK  89



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 3/108 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG---  467
            M+ +    G+++  PGGP++ +  DS   LSL   VD Y PP KR RV  P++   G   
Sbjct  1    MAALVNRRGNDDICPGGPLFSNLVDSSLLLSLTRNVDVYCPPRKRPRVTAPLIFRAGEKI  60

Query  468  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
             + K + +I+ LP+ECLFE+ RR+   KERS  AC SKRWLMLLSS+R
Sbjct  61   ADEKLQRSIDTLPEECLFEILRRLPGDKERSNSACVSKRWLMLLSSIR  108



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 68/112 (61%), Gaps = 15/112 (13%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGG------PMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-V  455
            M  +  +SG +EF+ GG      PM     D G  LS+       +PP KRAR+ +   +
Sbjct  1    MPTLVNYSGDDEFYSGGSCYSSSPM-----DLGCLLSVGSNA---YPPSKRARISSQFDI  52

Query  456  ACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
                 E +KK +IEVLP+ECLFE+FRR+H GKER  CA  SK+WLMLLSS+R
Sbjct  53   RGSSFEQEKKASIEVLPEECLFEIFRRLHGGKERITCASVSKKWLMLLSSIR  104



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 65/106 (61%), Gaps = 8/106 (8%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  473
            M  +  +SG +E + GG     S D G  LSL H  V  Y PP KR+R+  P V     +
Sbjct  1    MPALVNYSGDDELYSGGSF--CSADLGLMLSLGHAEV--YCPPRKRSRISGPFVV---ED  53

Query  474  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
              K P+++ LPDECLFE+ RR+  G+ER A +C SKRWLMLLSS+R
Sbjct  54   RSKGPSLDDLPDECLFEILRRLPGGRERGAASCLSKRWLMLLSSVR  99



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  381  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  557
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  11   LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  70

Query  558  SACACTSKRWLMLLSSLRR  614
            S  AC SK+WLM+L+S+R+
Sbjct  71   SFAACVSKKWLMMLTSIRK  89



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  381  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  557
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  12   LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  71

Query  558  SACACTSKRWLMLLSSLRR  614
            S  AC SK+WLM+L+S+R+
Sbjct  72   SFAACVSKKWLMMLTSIRK  90



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 51/109 (47%), Positives = 63/109 (58%), Gaps = 11/109 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHP-RVDG-YFPPCKRARVGTPVVACEGL  470
            MS IF  SG +EFF GG         GS + L P    G Y P  KR RV     +    
Sbjct  1    MSGIFRVSGDDEFFTGG--------GGSSMHLSPGSCPGVYLPARKRLRVTAAATSFYSS  52

Query  471  EPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSKRWLMLLSSLRR  614
              +K+ +I+VLPDECLFE+ RR+   G+ERSACAC SK WL +LSS+ R
Sbjct  53   FEEKQASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITR  101



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 51/109 (47%), Positives = 63/109 (58%), Gaps = 11/109 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHP-RVDG-YFPPCKRARVGTPVVACEGL  470
            MS IF  SG +EFF GG         GS + L P    G Y P  KR RV     +    
Sbjct  1    MSGIFRVSGDDEFFTGG--------GGSSMHLSPGSCPGVYLPARKRLRVTAAATSFYSS  52

Query  471  EPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSKRWLMLLSSLRR  614
              +K+ +I+VLPDECLFE+ RR+   G+ERSACAC SK WL +LSS+ R
Sbjct  53   FEEKQASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITR  101



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 62/106 (58%), Gaps = 11/106 (10%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS IF FSG  +   GG MY S           P V  Y+P  KR RV        G E 
Sbjct  1    MSGIFRFSGDEDCLLGGSMYLSPGSC-------PGV--YYPARKRLRVAATSFY-SGFE-  49

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +K+ +I+VLP+ECLFE+ RR+  G+ERSACAC SK WL LLSS+ R
Sbjct  50   EKQTSIDVLPEECLFEILRRLPSGQERSACACVSKHWLNLLSSISR  95



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  381  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  557
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  109  LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  168

Query  558  SACACTSKRWLMLLSSLRR  614
            S  AC SK+WLM+L+S+R+
Sbjct  169  SFAACVSKKWLMMLTSIRK  187



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 49/101 (49%), Positives = 64/101 (63%), Gaps = 10/101 (10%)
 Frame = +3

Query  312  EFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK--K  485
            +F G  E +PGG M     D+G    ++   D +  P KR R+  P  +   LE ++  K
Sbjct  2    DFPGDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEHEQDLK  53

Query  486  PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            PTIEVL DECLFE+FRR+  GKERS+ AC SKRWLML+SS+
Sbjct  54   PTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSI  94



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 60/97 (62%), Gaps = 15/97 (15%)
 Frame = +3

Query  348  PMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV---------VACEGLEPKKKPTIEV  500
            P++P S     FLS    VD Y PP KRARV  P+         VA E  +P+   +I+ 
Sbjct  15   PLFPGSS---RFLSPGRNVDVYCPPRKRARVIAPLGFSFRGREEVAAEKQQPR---SIDT  68

Query  501  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            LPDECLFE+ RR+   KERS+CAC SKRWLMLL S+R
Sbjct  69   LPDECLFEILRRLPGEKERSSCACVSKRWLMLLISIR  105



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 3/108 (3%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC--EGL  470
            M+ +   +G+++  PGGP++ +  DS   LSL    D Y PP KR R+ + +     +  
Sbjct  1    MAALVNCAGNDDIGPGGPLFSNLMDSSLLLSLTYNFDAYCPPSKRYRITSLICKAGEKTA  60

Query  471  EPKKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            + K++P +I+ LPDECLFE+ RR+   KERS  AC SKRWLMLL S+R
Sbjct  61   DEKQQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKRWLMLLCSIR  108



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 60/98 (61%), Gaps = 10/98 (10%)
 Frame = +3

Query  321  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEV  500
            G  +FF GG M+  S  S       P V  YFP  KR R+    V   G E +K+ +I+V
Sbjct  5    GDEDFFLGGSMHNLSPGSC------PGV--YFPARKRLRIAATSVF-SGFE-QKQTSIDV  54

Query  501  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            LPDECLFE+ RR+  GKERSACAC SK WL LL+S+ R
Sbjct  55   LPDECLFEILRRLPSGKERSACACVSKHWLNLLTSITR  92



>emb|CDP13515.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +1

Query  298  CLKSLNSVVTMSFSQGGLCTPVPRTRVPFCPFILVWMGIFLLARGLESVPLLLHVKDLSR  477
            CLK L SVVT +FS GG  T +PR+++ F P  L+WM  F LARGL S+P +  V+    
Sbjct  44   CLKCLISVVTRTFSLGGRYTQIPRSQICFYPLDLMWMCFFHLARGLVSMPHMFLVEKSLS  103

Query  478  RRSLQLKSFQMNASLRYSDVFMMAKKEVPVLVRPSVG  588
              S  LK FQMNASLR S V M  +++VPVLV  + G
Sbjct  104  GSSPPLKFFQMNASLRSSGVCMGVQRKVPVLVYLNAG  140



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/111 (47%), Positives = 64/111 (58%), Gaps = 15/111 (14%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHP-RVDG-YFPPCKRARVGTPVVAC--E  464
            MS IF  SG +EFF GG         GS + L P    G Y P  KR RV +        
Sbjct  1    MSGIFRISGDDEFFTGG---------GSSMHLSPGSCPGVYLPARKRLRVASAAATSFYS  51

Query  465  GLEPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSKRWLMLLSSLRR  614
              E +K+ +I+VLPDECLFE+ RR+   G+ERSACAC SK WL +LSS+ R
Sbjct  52   SFE-EKQTSIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSIAR  101



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 61/106 (58%), Gaps = 19/106 (18%)
 Frame = +3

Query  318  SGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK-----  482
            SG++E  PG   Y  S +          VD +  P KR R+  P     G  P+      
Sbjct  8    SGNDELHPGCRGYTISSN----------VDVHCSPTKRTRISAPFTF--GPLPRALEHGQ  55

Query  483  --KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
              KP+IE LPDECLFE+FRR+  GKERS+ AC SKRWLML+SS+R+
Sbjct  56   DLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRK  101



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 2/69 (3%)
 Frame = +3

Query  411  YFPPCKRARVGTP-VVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRW  587
            ++P CKRAR+  P V+  +  E +K+ +I VLPDECLFE+FR +  G+ERS CAC SK W
Sbjct  19   FYPSCKRARINAPFVLWGQESEQEKRSSINVLPDECLFEIFRHL-PGQERSNCACVSKHW  77

Query  588  LMLLSSLRR  614
            L LLSS+RR
Sbjct  78   LTLLSSIRR  86



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 64/106 (60%), Gaps = 10/106 (9%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS     S   E +PGG M     D+G    ++   D +  P KR R+  P  +   LE 
Sbjct  1    MSGRVNQSSDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEH  52

Query  477  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            ++  KPTIEVL DECLFE+FRR+  GKERS+ AC SKRWLML+SS+
Sbjct  53   EQDLKPTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSI  98



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 64/108 (59%), Gaps = 5/108 (5%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            M  +  F G  +F  GGP +    D+  FLSL PR++   PP KR R G   +     +P
Sbjct  1    MPTLVSFRGDEDF--GGPKFSGRVDTDLFLSLAPRMEVLCPPRKRLR-GNVTIPFRETKP  57

Query  477  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            K+  K  I +LPDECLFE+FR +   ++RS  AC SKRWLML SS+RR
Sbjct  58   KQEQKDLISMLPDECLFEIFRCLPAARDRSVSACVSKRWLMLQSSMRR  105



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 52/69 (75%), Gaps = 4/69 (6%)
 Frame = +3

Query  402  VDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSK  581
            +D YFP  KR+R      + E  E +KKP+IEVLPDECLFE+FR +  G+ERS+CAC SK
Sbjct  1    MDVYFPLSKRSRTSA---SGEKFE-QKKPSIEVLPDECLFEIFRWLRGGRERSSCACVSK  56

Query  582  RWLMLLSSL  608
            RWL+L+S++
Sbjct  57   RWLILVSNI  65



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +3

Query  363  SKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIEVLPDECLFEVFRRV  539
            S DSG   S+    + Y PP KR+R+  P  +    L   K P+I+ LPDECLFE+F  +
Sbjct  21   SGDSGLVFSIGSHAEVYCPPRKRSRIAGPCTLGATLLADDKTPSIDTLPDECLFEIFTHL  80

Query  540  HDGKERSACACTSKRWLMLLSSLR  611
             +G+ERS  AC SKRWL +LSS+R
Sbjct  81   SNGRERSTSACVSKRWLSVLSSVR  104



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 64/106 (60%), Gaps = 10/106 (9%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  476
            MS     S   E +PGG M     D+G    ++   D +  P KR R+  P  +   LE 
Sbjct  52   MSGRVNQSSDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEH  103

Query  477  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            ++  KPTIEVL DECLFE+FRR+  GKERS+ AC SKRWLML+SS+
Sbjct  104  EQDLKPTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSI  149



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 6/84 (7%)
 Frame = +3

Query  369  DSGSFLSLHPRVDGYFPPCKRARVGTPVV--ACEGLEPKKKPTIEVLPDECLFEVFRRVH  542
            D+   LSL    D YFPP KR+RV  P +  A E    KK  +I+VLPDECLFE+FRR+ 
Sbjct  1    DASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFE----KKPVSIDVLPDECLFEIFRRLS  56

Query  543  DGKERSACACTSKRWLMLLSSLRR  614
              +ERSACA  SK+WL L+SS+R+
Sbjct  57   GPQERSACAFVSKQWLTLVSSIRQ  80



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 60/102 (59%), Gaps = 13/102 (13%)
 Frame = +3

Query  315  FSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK--KP  488
            FSG +E + G    PS+            VD Y PP KR RV  P V   G  P++  + 
Sbjct  8    FSGEDELYGGRSSNPSAMS---------HVDVYGPPNKRQRVNAPFVLW-GSNPEQNTRS  57

Query  489  TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            +I VLPDEC+FEVFRR+   +ERS CAC SK+WL +L+ +RR
Sbjct  58   SINVLPDECMFEVFRRL-PPQERSNCACVSKQWLTILTGIRR  98



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 61/104 (59%), Gaps = 15/104 (14%)
 Frame = +3

Query  318  SGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC---EGLEPKK--  482
            SG++E  PG   Y  S +          VD +  P KR R+  P         LE  +  
Sbjct  8    SGNDELHPGCRGYTISSN----------VDVHCSPTKRTRISAPFTFGPLPRALEHGQDL  57

Query  483  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  614
            KP+IE LPDECLFE+FRR+  GKERS+ AC SKRWLML+SS+R+
Sbjct  58   KPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRK  101



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +3

Query  426  KRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSS  605
            KR RV  P VA    E K  P+I+ LPDECLFE+ RR+    E+SACAC SKRWLMLLSS
Sbjct  7    KRCRVNAPFVASR--EFKLPPSIDALPDECLFEILRRLPGINEKSACACVSKRWLMLLSS  64

Query  606  LRR  614
            + R
Sbjct  65   ISR  67



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 47/112 (42%), Positives = 63/112 (56%), Gaps = 10/112 (9%)
 Frame = +3

Query  297  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-------V  455
            M+ +    G ++   GG ++ +  DS   LSL   VD Y    KR RV  P+       V
Sbjct  1    MAALVNRGGSDDICHGGSLFSNLVDSSLLLSLSRNVDVYCSSRKRPRVTAPLAFRAEKKV  60

Query  456  ACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            A +  +P+   +I+ LPDECLFE+ RR+   KERS  A  SKRWLMLLSS+R
Sbjct  61   AYKKQQPR---SIDSLPDECLFEILRRLPGDKERSNSARVSKRWLMLLSSIR  109



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +3

Query  411  YFPPCKRARVGTPVVACEGL-EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRW  587
            Y+PP KRAR+ + V++ E   E  ++ +IE+LPDECLFE+ RR+   KER    C SKRW
Sbjct  41   YYPPNKRARISSSVLSVESETEVSEQQSIEILPDECLFEILRRLPRVKERCLSLCVSKRW  100

Query  588  LMLLSSLR  611
            L +L+S+R
Sbjct  101  LNVLTSMR  108



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = +3

Query  342  GGPMYPSSKDSGSFLSLHPRVDGYFPPCK-RARVGTPVVACEGLEPKK--KPTIEVLPDE  512
            G P+YP+ K+  S   L  ++   F   +  A V   + A  GL   +  + +IE LPDE
Sbjct  57   GAPIYPNPKEHVSSCLLAVKLMFTFLFRRGLASVFHLISAENGLSRSRSQRTSIESLPDE  116

Query  513  CLFEVFRRVHDGKERSACACTSKRWLMLLSSL  608
            CLFE+ RR+  G++RS CA  SKRWLMLLSS+
Sbjct  117  CLFEILRRLPAGQDRSVCASVSKRWLMLLSSI  148



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 10/100 (10%)
 Frame = +3

Query  321  GHNEFFPG-GPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK--KPT  491
            G  EF    G +  +  + G    +   VD Y+PP KRAR+          EP+   + +
Sbjct  9    GAGEFHNATGSICKTQLNLGKSRFVGNNVDVYYPPGKRARLSES-------EPEATDRSS  61

Query  492  IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            IE+LPDECLFE+ RR+   KER   +C S+RWL +L+ +R
Sbjct  62   IEILPDECLFEILRRLPGVKERCVSSCVSRRWLSVLTMIR  101



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            + ++ P+++ LPDECLFEV RR+  G+ER A AC S+RWL LL S+R
Sbjct  61   QQRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIR  107



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  483  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            +P+++ LPDECLFEV RR+  G+ER+  AC S+RWL LL+S+R
Sbjct  69   QPSLDALPDECLFEVLRRLPGGRERADSACVSRRWLALLASIR  111



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +3

Query  417  PPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLML  596
            PPC  A V     A +  + ++ P+++ LPDECLFE+ RRV   + R A AC S+RWL L
Sbjct  38   PPCVYAAVAAAAAAAKKQKLRETPSLDALPDECLFEILRRVQGARARGASACVSRRWLAL  97

Query  597  LSSLR  611
            L  +R
Sbjct  98   LGGIR  102



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  483  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            +P+++VLPDECLFEV RR+  G+ER+  AC S+RWL LL+S+R
Sbjct  354  QPSLDVLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIR  396



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  483  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            +P+++ LPDECLFEV RR+  G+ER+  AC S+RWL LL+S+R
Sbjct  64   QPSLDGLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIR  106



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            + ++ P+++ LPDECLFEV RR+  G+ER A AC S+RWL LL S+R
Sbjct  53   QQRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIR  99



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            +++P+++ LPDECLFEV RRV   + R A AC S+RWL LL+ +R
Sbjct  42   REEPSLDALPDECLFEVLRRVRGARARCASACVSRRWLALLAGIR  86



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  477  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            + +P+++ +PDECLFEV RRV   + R A AC S+RWL LL+ +R
Sbjct  41   RDEPSLDAVPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIR  85



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  492  IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            ++ LPDECLFEV RRV   + R A AC S+RWL LL+ +R
Sbjct  46   LDALPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIR  85



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  480  KKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            + P+++ LPDECLFE+ RRV   + R A A  S+RWL LL  +R
Sbjct  73   EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIR  116



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  480  KKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            + P+++ LPDECLFE+ RRV   + R A A  S+RWL LL  +R
Sbjct  73   EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIR  116



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +3

Query  471  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            + ++ P+++ LPDECLFE+ RRV     R A AC S+RWL LL S+R
Sbjct  55   KQRQLPSLDALPDECLFEILRRVPG--RRGAAACVSRRWLALLGSIR  99



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = +3

Query  414  FPPCKRARVGTPVVACEGLEPKKK--PTIEVLPDECLFEVFRRVHDGKERSACACTSKRW  587
             PPC  A      V       K++  P+++ LPDECLFE+ RRV   + R A    S+RW
Sbjct  36   VPPCAFAEAVEEEVTAASKRQKRREAPSLDALPDECLFEILRRVKGARARCASGAVSRRW  95

Query  588  LMLLSS  605
            L LL +
Sbjct  96   LALLGA  101



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 6/53 (11%)
 Frame = +3

Query  471  EPKKKPT------IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  611
            EP +K T      I  LPDEC+ E+FR +   ++R +C   SKRWL L +++R
Sbjct  62   EPVRKSTSSNKDLINTLPDECILEIFRFLPSSRDRCSCVTVSKRWLALQATMR  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660