BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF027G16

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011074127.1|  PREDICTED: uncharacterized protein OsI_02794...    206   5e-63   Sesamum indicum [beniseed]
ref|XP_009785922.1|  PREDICTED: uncharacterized protein OsI_02794...    202   1e-61   Nicotiana sylvestris
ref|XP_009604975.1|  PREDICTED: uncharacterized protein OsI_02794...    202   2e-61   Nicotiana tomentosiformis
ref|XP_009604976.1|  PREDICTED: uncharacterized protein OsI_02794...    202   3e-61   Nicotiana tomentosiformis
gb|AIL30486.1|  ripening regulated protein DDTFR8                       201   3e-61   Nicotiana tabacum [American tobacco]
ref|NP_001234685.1|  ripening regulated protein DDTFR8                  199   2e-60   
ref|XP_006360297.1|  PREDICTED: uncharacterized protein Os08g0359...    199   3e-60   Solanum tuberosum [potatoes]
ref|XP_004252558.1|  PREDICTED: uncharacterized protein OsI_02794...    197   9e-60   Solanum lycopersicum
ref|XP_010314468.1|  PREDICTED: uncharacterized protein OsI_02794...    197   1e-59   Solanum lycopersicum
ref|XP_006359015.1|  PREDICTED: uncharacterized protein OsI_02794...    194   2e-58   Solanum tuberosum [potatoes]
ref|NP_001237326.1|  uncharacterized protein LOC100527783               192   2e-57   Glycine max [soybeans]
gb|KHN32820.1|  Hypothetical protein glysoja_024179                     192   2e-57   Glycine soja [wild soybean]
gb|EYU36540.1|  hypothetical protein MIMGU_mgv1a018670mg                190   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_006574773.1|  PREDICTED: uncharacterized protein OsI_02794...    191   4e-57   Glycine max [soybeans]
ref|XP_002893745.1|  hypothetical protein ARALYDRAFT_336372             187   1e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_010243328.1|  PREDICTED: uncharacterized protein OsI_02794...    186   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_008780776.1|  PREDICTED: uncharacterized protein Os08g0359...    186   4e-55   Phoenix dactylifera
emb|CDP01142.1|  unnamed protein product                                186   4e-55   Coffea canephora [robusta coffee]
ref|XP_006434560.1|  hypothetical protein CICLE_v10002611mg             185   8e-55   Citrus clementina [clementine]
ref|XP_010926229.1|  PREDICTED: uncharacterized protein Os08g0359...    185   1e-54   Elaeis guineensis
ref|XP_007020190.1|  HSP20-like chaperones superfamily protein          184   1e-54   Theobroma cacao [chocolate]
ref|XP_008811572.1|  PREDICTED: uncharacterized protein Os08g0359...    184   3e-54   Phoenix dactylifera
ref|XP_006473157.1|  PREDICTED: uncharacterized protein OsI_02794...    183   4e-54   Citrus sinensis [apfelsine]
ref|XP_010916995.1|  PREDICTED: uncharacterized protein OsI_02794...    182   1e-53   Elaeis guineensis
ref|XP_006434559.1|  hypothetical protein CICLE_v10002611mg             182   1e-53   
ref|XP_006434561.1|  hypothetical protein CICLE_v10002611mg             180   1e-53   
ref|XP_011044819.1|  PREDICTED: uncharacterized protein OsI_02794...    181   4e-53   Populus euphratica
ref|XP_010461085.1|  PREDICTED: uncharacterized protein OsI_02794...    180   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010461088.1|  PREDICTED: uncharacterized protein OsI_02794...    180   7e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010461086.1|  PREDICTED: uncharacterized protein OsI_02794...    179   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007151931.1|  hypothetical protein PHAVU_004G088000g             179   2e-52   Phaseolus vulgaris [French bean]
ref|XP_008237430.1|  PREDICTED: uncharacterized protein Os08g0359...    181   2e-52   Prunus mume [ume]
ref|XP_008237431.1|  PREDICTED: uncharacterized protein Os08g0359...    181   2e-52   
ref|XP_010478707.1|  PREDICTED: uncharacterized protein OsI_02794...    179   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010478705.1|  PREDICTED: uncharacterized protein OsI_02794...    179   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007201255.1|  hypothetical protein PRUPE_ppa010769mg             180   2e-52   Prunus persica
ref|XP_007201254.1|  hypothetical protein PRUPE_ppa010769mg             180   3e-52   Prunus persica
ref|XP_002300889.2|  hypothetical protein POPTR_0002s06240g             177   7e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010461087.1|  PREDICTED: uncharacterized protein OsI_02794...    176   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010499806.1|  PREDICTED: uncharacterized protein OsI_02794...    176   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002265220.1|  PREDICTED: uncharacterized protein OsI_02794...    176   3e-51   Vitis vinifera
ref|XP_010499808.1|  PREDICTED: uncharacterized protein OsI_02794...    176   3e-51   
ref|XP_010478706.1|  PREDICTED: uncharacterized protein OsI_02794...    175   7e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009409147.1|  PREDICTED: uncharacterized protein OsI_02794...    175   7e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001050241.1|  Os03g0381300                                       174   9e-51   
ref|XP_004140943.1|  PREDICTED: uncharacterized protein OsI_02794...    175   1e-50   Cucumis sativus [cucumbers]
gb|EAY90254.1|  hypothetical protein OsI_11826                          174   1e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_011458453.1|  PREDICTED: uncharacterized protein OsI_02794...    174   1e-50   Fragaria vesca subsp. vesca
ref|XP_002307531.2|  hypothetical protein POPTR_0005s22140g             174   2e-50   
gb|ABF96271.1|  expressed protein                                       173   2e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004159475.1|  PREDICTED: uncharacterized protein OsI_02794...    174   2e-50   
ref|XP_003619026.1|  Ripening regulated protein DDTFR8                  174   2e-50   Medicago truncatula
emb|CBI29341.3|  unnamed protein product                                174   3e-50   Vitis vinifera
ref|XP_009380995.1|  PREDICTED: uncharacterized protein At3g03773...    172   6e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010499807.1|  PREDICTED: uncharacterized protein OsI_02794...    172   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006434558.1|  hypothetical protein CICLE_v10002611mg             171   2e-49   
ref|XP_011026295.1|  PREDICTED: uncharacterized protein OsI_02794...    171   2e-49   Populus euphratica
gb|KJB59532.1|  hypothetical protein B456_009G259900                    171   3e-49   Gossypium raimondii
ref|XP_008456697.1|  PREDICTED: uncharacterized protein At3g03773...    171   5e-49   Cucumis melo [Oriental melon]
gb|KHF97613.1|  hypothetical protein F383_14672                         170   5e-49   Gossypium arboreum [tree cotton]
ref|XP_006651444.1|  PREDICTED: uncharacterized protein OsI_02794...    169   9e-49   Oryza brachyantha
gb|AAG41763.1|AF153128_1  p23                                           168   2e-48   Brassica napus [oilseed rape]
ref|XP_008381044.1|  PREDICTED: uncharacterized protein OsI_02794...    170   2e-48   Malus domestica [apple tree]
ref|XP_008381045.1|  PREDICTED: uncharacterized protein OsI_02794...    169   2e-48   Malus domestica [apple tree]
ref|XP_008456698.1|  PREDICTED: uncharacterized protein At3g03773...    166   2e-47   Cucumis melo [Oriental melon]
ref|XP_003557812.1|  PREDICTED: uncharacterized protein OsI_02794...    165   3e-47   Brachypodium distachyon [annual false brome]
emb|CDY04790.1|  BnaC05g17990D                                          166   4e-47   
ref|XP_010251769.1|  PREDICTED: uncharacterized protein Os08g0359...    165   4e-47   Nelumbo nucifera [Indian lotus]
emb|CDY21385.1|  BnaA09g30420D                                          165   6e-47   Brassica napus [oilseed rape]
ref|XP_002277004.1|  PREDICTED: uncharacterized protein OsI_02794...    163   2e-46   Vitis vinifera
gb|AFK43711.1|  unknown                                                 164   2e-46   Lotus japonicus
ref|XP_002276982.1|  PREDICTED: uncharacterized protein OsI_02794...    163   2e-46   Vitis vinifera
ref|XP_002525582.1|  HSP90 co-chaperone, putative                       162   2e-46   Ricinus communis
ref|XP_004984205.1|  PREDICTED: uncharacterized protein OsI_02794...    162   4e-46   Setaria italica
gb|AGT16170.1|  hypothetical protein SHCRBa_024_F14_R_20                161   1e-45   Saccharum hybrid cultivar R570
gb|ABA60373.1|  p23                                                     161   2e-45   Dactylis glomerata [cocksfoot]
ref|XP_002465200.1|  hypothetical protein SORBIDRAFT_01g033940          160   3e-45   Sorghum bicolor [broomcorn]
ref|XP_010922128.1|  PREDICTED: uncharacterized protein At3g03773...    159   4e-45   Elaeis guineensis
ref|XP_010694670.1|  PREDICTED: uncharacterized protein OsI_02794...    160   4e-45   
ref|XP_010694667.1|  PREDICTED: uncharacterized protein At3g03773...    160   5e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694668.1|  PREDICTED: uncharacterized protein At3g03773...    160   5e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694666.1|  PREDICTED: uncharacterized protein At3g03773...    160   6e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009115602.1|  PREDICTED: uncharacterized protein OsI_02794...    159   7e-45   Brassica rapa
emb|CAN64654.1|  hypothetical protein VITISV_015756                     159   1e-44   Vitis vinifera
ref|XP_008792419.1|  PREDICTED: uncharacterized protein OsI_02794...    157   4e-44   
gb|EMT32541.1|  hypothetical protein F775_31652                         157   8e-44   
ref|NP_001148600.1|  prostaglandin E synthase 3                         156   1e-43   Zea mays [maize]
dbj|BAE92292.1|  putative p23 co-chaperone                              154   3e-42   Cryptomeria japonica
ref|XP_008792417.1|  PREDICTED: uncharacterized protein OsI_02794...    153   4e-42   
ref|XP_008792416.1|  PREDICTED: uncharacterized protein At3g03773...    153   6e-42   
gb|ABK26701.1|  unknown                                                 153   1e-41   Picea sitchensis
gb|KDP28144.1|  hypothetical protein JCGZ_13915                         149   1e-40   Jatropha curcas
gb|AFK39090.1|  unknown                                                 149   2e-40   Lotus japonicus
ref|XP_007050893.1|  HSP20-like chaperones superfamily protein is...    146   9e-40   Theobroma cacao [chocolate]
ref|XP_007050895.1|  HSP20-like chaperones superfamily protein is...    146   1e-39   
ref|XP_004290784.1|  PREDICTED: uncharacterized protein Os08g0359...    147   1e-39   Fragaria vesca subsp. vesca
gb|AES61800.2|  CS domain protein                                       146   1e-39   Medicago truncatula
ref|XP_011458724.1|  PREDICTED: uncharacterized protein Os08g0359...    147   1e-39   Fragaria vesca subsp. vesca
ref|XP_004290783.1|  PREDICTED: uncharacterized protein Os08g0359...    147   1e-39   Fragaria vesca subsp. vesca
ref|XP_011458723.1|  PREDICTED: uncharacterized protein Os08g0359...    147   2e-39   Fragaria vesca subsp. vesca
ref|NP_001241395.1|  uncharacterized protein LOC100796372               145   3e-39   Glycine max [soybeans]
ref|XP_006444305.1|  hypothetical protein CICLE_v10022431mg             144   5e-39   Citrus clementina [clementine]
ref|XP_011458722.1|  PREDICTED: uncharacterized protein OsI_02794...    147   5e-39   Fragaria vesca subsp. vesca
ref|XP_006304541.1|  hypothetical protein CARUB_v10011509mg             143   6e-39   
ref|XP_011458721.1|  PREDICTED: uncharacterized protein OsI_02794...    147   6e-39   Fragaria vesca subsp. vesca
ref|XP_006444304.1|  hypothetical protein CICLE_v10022431mg             144   7e-39   
ref|XP_007050896.1|  HSP20-like chaperones superfamily protein is...    144   7e-39   
gb|KJB22493.1|  hypothetical protein B456_004G052400                    144   1e-38   Gossypium raimondii
ref|XP_008451590.1|  PREDICTED: uncharacterized protein OsI_027940      144   1e-38   Cucumis melo [Oriental melon]
ref|NP_001236771.1|  uncharacterized protein LOC100499842               143   1e-38   
ref|XP_004136034.1|  PREDICTED: uncharacterized protein OsI_02794...    144   2e-38   Cucumis sativus [cucumbers]
gb|KJB22494.1|  hypothetical protein B456_004G052400                    142   2e-38   Gossypium raimondii
ref|XP_004495968.1|  PREDICTED: uncharacterized protein OsI_02794...    143   2e-38   Cicer arietinum [garbanzo]
gb|KHG16575.1|  hypothetical protein F383_01113                         143   2e-38   Gossypium arboreum [tree cotton]
gb|KJB49925.1|  hypothetical protein B456_008G146000                    143   3e-38   Gossypium raimondii
gb|KJB49923.1|  hypothetical protein B456_008G146000                    143   3e-38   Gossypium raimondii
gb|KJB49924.1|  hypothetical protein B456_008G146000                    143   3e-38   Gossypium raimondii
ref|XP_003591549.1|  hypothetical protein MTR_1g088700                  143   3e-38   
ref|XP_009342102.1|  PREDICTED: uncharacterized protein OsI_02794...    142   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_010652179.1|  PREDICTED: uncharacterized protein OsI_02794...    142   4e-38   Vitis vinifera
ref|XP_009342103.1|  PREDICTED: uncharacterized protein OsI_02794...    142   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_002264898.1|  PREDICTED: uncharacterized protein OsI_02794...    142   4e-38   Vitis vinifera
gb|ADE76546.1|  unknown                                                 142   8e-38   Picea sitchensis
ref|XP_008386666.1|  PREDICTED: uncharacterized protein OsI_02794...    141   8e-38   
ref|XP_008386667.1|  PREDICTED: uncharacterized protein OsI_02794...    141   9e-38   
gb|ADE76981.1|  unknown                                                 142   9e-38   Picea sitchensis
emb|CBI36840.3|  unnamed protein product                                142   1e-37   Vitis vinifera
ref|XP_006840547.1|  hypothetical protein AMTR_s00045p00215950          141   2e-37   Amborella trichopoda
ref|XP_008235058.1|  PREDICTED: uncharacterized protein OsI_027940      140   2e-37   Prunus mume [ume]
ref|XP_007201343.1|  hypothetical protein PRUPE_ppa011992mg             140   2e-37   Prunus persica
ref|XP_010038204.1|  PREDICTED: uncharacterized protein Os08g0359500    140   3e-37   Eucalyptus grandis [rose gum]
ref|XP_010684508.1|  PREDICTED: uncharacterized protein OsI_027940      140   3e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009342150.1|  PREDICTED: uncharacterized protein OsI_02794...    140   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_009342151.1|  PREDICTED: uncharacterized protein OsI_02794...    140   4e-37   Pyrus x bretschneideri [bai li]
ref|XP_007050894.1|  HSP20-like chaperones superfamily protein is...    138   1e-36   
gb|KHN20406.1|  Hypothetical protein glysoja_039704                     139   4e-36   Glycine soja [wild soybean]
emb|CDX89935.1|  BnaA10g01470D                                          137   9e-36   
ref|XP_006659323.1|  PREDICTED: uncharacterized protein Os08g0359...    136   1e-35   Oryza brachyantha
ref|XP_001768873.1|  predicted protein                                  133   1e-35   
ref|XP_003573778.1|  PREDICTED: uncharacterized protein Os08g0359500    135   4e-35   Brachypodium distachyon [annual false brome]
sp|P0C8Z0.2|Y8359_ORYSI  RecName: Full=Uncharacterized protein Os...    134   9e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001061631.1|  Os08g0359500                                       134   9e-35   
gb|KHN43515.1|  Hypothetical protein glysoja_002098                     141   9e-35   Glycine soja [wild soybean]
gb|EEC83453.1|  hypothetical protein OsI_28951                          135   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_010481284.1|  PREDICTED: uncharacterized protein OsI_02794...    133   1e-34   Camelina sativa [gold-of-pleasure]
emb|CDP03502.1|  unnamed protein product                                135   1e-34   Coffea canephora [robusta coffee]
ref|XP_009799463.1|  PREDICTED: uncharacterized protein OsI_027940      132   2e-34   Nicotiana sylvestris
ref|XP_009414713.1|  PREDICTED: uncharacterized protein OsI_02794...    132   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFX67021.1|  putative p23 co-chaperone                               133   4e-34   Solanum tuberosum [potatoes]
ref|XP_009385408.1|  PREDICTED: uncharacterized protein OsI_02794...    131   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414711.1|  PREDICTED: uncharacterized protein OsI_02794...    131   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004494372.1|  PREDICTED: uncharacterized protein Os08g0359...    132   4e-34   Cicer arietinum [garbanzo]
gb|AFX66984.1|  putative p23 co-chaperone                               133   5e-34   Solanum tuberosum [potatoes]
gb|KEH24379.1|  CS domain protein                                       132   5e-34   Medicago truncatula
ref|XP_009386345.1|  PREDICTED: uncharacterized protein OsI_02794...    131   6e-34   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY15271.1|  BnaC05g01500D                                          134   6e-34   Brassica napus [oilseed rape]
ref|XP_010269540.1|  PREDICTED: uncharacterized protein OsI_027940      130   8e-34   Nelumbo nucifera [Indian lotus]
gb|AFK43198.1|  unknown                                                 132   1e-33   Medicago truncatula
ref|XP_006418294.1|  hypothetical protein EUTSA_v10008755mg             131   1e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006359384.1|  PREDICTED: uncharacterized protein Os08g0359...    132   1e-33   
ref|XP_008775907.1|  PREDICTED: uncharacterized protein OsI_02794...    130   1e-33   Phoenix dactylifera
ref|XP_010474870.1|  PREDICTED: uncharacterized protein OsI_02794...    131   1e-33   Camelina sativa [gold-of-pleasure]
gb|KEH24381.1|  CS domain protein                                       130   2e-33   Medicago truncatula
ref|XP_002964192.1|  hypothetical protein SELMODRAFT_81672              128   2e-33   
ref|XP_009769849.1|  PREDICTED: uncharacterized protein OsI_02794...    130   2e-33   Nicotiana sylvestris
ref|XP_009119603.1|  PREDICTED: uncharacterized protein Os08g0359...    131   2e-33   Brassica rapa
ref|XP_009586785.1|  PREDICTED: uncharacterized protein OsI_02794...    130   3e-33   Nicotiana tomentosiformis
ref|XP_010922352.1|  PREDICTED: uncharacterized protein OsI_02794...    129   3e-33   Elaeis guineensis
dbj|BAJ94677.1|  predicted protein                                      130   3e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010522788.1|  PREDICTED: uncharacterized protein OsI_027940      130   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_002988870.1|  hypothetical protein SELMODRAFT_128863             128   3e-33   
ref|XP_004247428.1|  PREDICTED: uncharacterized protein OsI_027940      130   4e-33   Solanum lycopersicum
ref|XP_009769848.1|  PREDICTED: uncharacterized protein OsI_02794...    130   4e-33   Nicotiana sylvestris
ref|XP_010556743.1|  PREDICTED: uncharacterized protein OsI_02794...    129   5e-33   Tarenaya hassleriana [spider flower]
ref|XP_010556742.1|  PREDICTED: uncharacterized protein OsI_02794...    129   7e-33   Tarenaya hassleriana [spider flower]
ref|XP_002992410.1|  hypothetical protein SELMODRAFT_186712             128   9e-33   Selaginella moellendorffii
gb|EMS68218.1|  hypothetical protein TRIUR3_30845                       129   9e-33   Triticum urartu
ref|XP_011082475.1|  PREDICTED: uncharacterized protein OsI_02794...    128   1e-32   Sesamum indicum [beniseed]
ref|XP_009598042.1|  PREDICTED: uncharacterized protein OsI_02794...    128   1e-32   Nicotiana tomentosiformis
ref|XP_003625928.1|  RING finger protein 113A                           132   1e-32   
ref|XP_009598041.1|  PREDICTED: uncharacterized protein OsI_02794...    128   1e-32   Nicotiana tomentosiformis
ref|XP_002968013.1|  hypothetical protein SELMODRAFT_145227             127   1e-32   Selaginella moellendorffii
ref|XP_003628460.1|  Zinc finger CCCH domain-containing protein         132   1e-32   
ref|XP_007163102.1|  hypothetical protein PHAVU_001G206400g             127   2e-32   Phaseolus vulgaris [French bean]
gb|ACJ83262.1|  unknown                                                 128   2e-32   Medicago truncatula
ref|XP_009598040.1|  PREDICTED: uncharacterized protein OsI_02794...    128   3e-32   Nicotiana tomentosiformis
gb|KEH24380.1|  CS domain protein                                       128   3e-32   Medicago truncatula
ref|XP_010906988.1|  PREDICTED: uncharacterized protein OsI_02794...    126   5e-32   Elaeis guineensis
gb|AGV54501.1|  zinc finger CCCH domain-containing protein              126   5e-32   Phaseolus vulgaris [French bean]
gb|ABR17014.1|  unknown                                                 125   7e-32   Picea sitchensis
ref|XP_002892131.1|  predicted protein                                  126   9e-32   
gb|ACN34684.1|  unknown                                                 125   2e-31   Zea mays [maize]
gb|ACN35583.1|  unknown                                                 123   2e-31   Zea mays [maize]
gb|ACF88149.1|  unknown                                                 125   2e-31   Zea mays [maize]
tpg|DAA49201.1|  TPA: hypothetical protein ZEAMMB73_435161              122   2e-31   
gb|KFK30837.1|  hypothetical protein AALP_AA6G032100                    125   3e-31   Arabis alpina [alpine rockcress]
ref|XP_010456028.1|  PREDICTED: uncharacterized protein Os08g0359...    125   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010429707.1|  PREDICTED: uncharacterized protein Os08g0359...    125   5e-31   Camelina sativa [gold-of-pleasure]
ref|NP_001241744.1|  co-chaperone protein SBA1                          123   8e-31   
ref|NP_001148972.1|  LOC100282592                                       123   1e-30   
gb|ACR38464.1|  unknown                                                 123   1e-30   Zea mays [maize]
ref|XP_011079678.1|  PREDICTED: uncharacterized protein Os08g0359500    122   1e-30   Sesamum indicum [beniseed]
ref|XP_006288563.1|  hypothetical protein CARUB_v10001852mg             124   2e-30   Capsella rubella
ref|XP_006396454.1|  hypothetical protein EUTSA_v10028946mg             123   2e-30   Eutrema salsugineum [saltwater cress]
gb|EMT10253.1|  hypothetical protein F775_29406                         125   2e-30   
ref|XP_010422586.1|  PREDICTED: uncharacterized protein Os08g0359...    123   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008792885.1|  PREDICTED: uncharacterized protein OsI_02794...    122   3e-30   
ref|XP_009134431.1|  PREDICTED: uncharacterized protein OsI_02794...    122   4e-30   Brassica rapa
ref|XP_010259596.1|  PREDICTED: uncharacterized protein OsI_02794...    120   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_002444216.1|  hypothetical protein SORBIDRAFT_07g015140          120   1e-29   Sorghum bicolor [broomcorn]
ref|XP_009144563.1|  PREDICTED: uncharacterized protein Os08g0359...    120   1e-29   Brassica rapa
tpg|DAA49203.1|  TPA: hypothetical protein ZEAMMB73_435161              120   1e-29   
ref|NP_001150702.1|  co-chaperone protein SBA1                          120   1e-29   Zea mays [maize]
emb|CDX90937.1|  BnaA03g26170D                                          121   2e-29   
ref|NP_001154201.1|  HSP20-like chaperone                               120   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192154.2|  HSP20-like chaperone                                  120   4e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CAC16575.1|  p23 co-chaperone                                       119   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872836.1|  predicted protein                                  120   8e-29   
ref|XP_009134430.1|  PREDICTED: uncharacterized protein OsI_02794...    119   9e-29   Brassica rapa
emb|CDY18019.1|  BnaC03g30910D                                          120   1e-28   Brassica napus [oilseed rape]
ref|XP_007202648.1|  hypothetical protein PRUPE_ppa012211mg             117   2e-28   
gb|AAT68744.1|  hypothetical protein At3g03773                          114   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151769.1|  hypothetical protein PHAVU_004G073200g             114   5e-28   Phaseolus vulgaris [French bean]
ref|NP_683525.2|  p23 co-chaperone protein                              114   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001763304.1|  predicted protein                                  114   5e-28   
ref|XP_004973281.1|  PREDICTED: uncharacterized protein Os08g0359...    116   7e-28   Setaria italica
emb|CDX97265.1|  BnaA02g20560D                                          122   7e-28   
emb|CDX91318.1|  BnaC02g27290D                                          122   7e-28   
ref|XP_004489674.1|  PREDICTED: uncharacterized protein At3g03773...    114   1e-27   Cicer arietinum [garbanzo]
ref|XP_008244127.1|  PREDICTED: uncharacterized protein At3g03773...    112   2e-27   Prunus mume [ume]
gb|AFK42085.1|  unknown                                                 113   2e-27   Lotus japonicus
ref|XP_002882306.1|  predicted protein                                  112   3e-27   Arabidopsis lyrata subsp. lyrata
gb|AAC19287.1|  T14P8.5                                                 115   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386859.1|  PREDICTED: uncharacterized protein At3g03773       112   3e-27   Malus domestica [apple tree]
gb|EPS74301.1|  hypothetical protein M569_00457                         113   4e-27   Genlisea aurea
gb|KJB80743.1|  hypothetical protein B456_013G113500                    112   4e-27   Gossypium raimondii
ref|XP_006298626.1|  hypothetical protein CARUB_v10014713mg             113   4e-27   
pdb|2KMW|A  Chain A, Solution Structure Of At3g03773.1 Protein Fr...    112   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KHG15374.1|  hypothetical protein F383_20155                         112   5e-27   Gossypium arboreum [tree cotton]
ref|XP_009366492.1|  PREDICTED: uncharacterized protein At3g03773...    112   6e-27   
gb|KJB80742.1|  hypothetical protein B456_013G113500                    112   6e-27   Gossypium raimondii
ref|XP_010514039.1|  PREDICTED: uncharacterized protein At3g03773...    112   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004973280.1|  PREDICTED: uncharacterized protein Os08g0359...    113   8e-27   Setaria italica
ref|NP_001236575.1|  uncharacterized protein LOC100527476               111   9e-27   Glycine max [soybeans]
ref|XP_006443478.1|  hypothetical protein CICLE_v10022696mg             110   2e-26   Citrus clementina [clementine]
ref|NP_001154589.1|  p23 co-chaperone protein                           112   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KDO66094.1|  hypothetical protein CISIN_1g031955mg                   110   2e-26   Citrus sinensis [apfelsine]
ref|XP_002325859.2|  hypothetical protein POPTR_0019s05470g             110   2e-26   
ref|XP_003550100.1|  PREDICTED: uncharacterized protein At3g03773...    110   2e-26   Glycine max [soybeans]
gb|EEE59155.1|  hypothetical protein OsJ_11066                          110   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006826339.1|  hypothetical protein AMTR_s00004p00112630          109   5e-26   
ref|XP_002525703.1|  HSP90 co-chaperone, putative                       109   6e-26   
ref|XP_010922358.1|  PREDICTED: uncharacterized protein OsI_02794...    109   6e-26   Elaeis guineensis
ref|XP_009102082.1|  PREDICTED: uncharacterized protein At3g03773       109   6e-26   Brassica rapa
gb|KHN43783.1|  Hypothetical protein glysoja_035394                     110   8e-26   Glycine soja [wild soybean]
ref|XP_006387881.1|  hypothetical protein POPTR_0502s00200g             110   8e-26   
ref|XP_010249748.1|  PREDICTED: uncharacterized protein At3g03773       109   9e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010910290.1|  PREDICTED: uncharacterized protein At3g03773       108   1e-25   Elaeis guineensis
ref|XP_006375912.1|  hypothetical protein POPTR_0013s05920g             108   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_002319181.2|  hypothetical protein POPTR_0013s05920g             107   1e-25   
emb|CDY21163.1|  BnaA01g33940D                                          109   2e-25   Brassica napus [oilseed rape]
ref|XP_009420684.1|  PREDICTED: uncharacterized protein At3g03773...    108   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004136663.1|  PREDICTED: uncharacterized protein At3g03773...    107   2e-25   Cucumis sativus [cucumbers]
ref|XP_007030017.1|  HSP20-like chaperones superfamily protein is...    109   2e-25   
emb|CDY29960.1|  BnaC01g40480D                                          108   2e-25   Brassica napus [oilseed rape]
ref|XP_008443309.1|  PREDICTED: uncharacterized protein At3g03773...    107   3e-25   
ref|XP_006408265.1|  hypothetical protein EUTSA_v10021254mg             110   3e-25   
ref|XP_008443308.1|  PREDICTED: uncharacterized protein At3g03773...    107   4e-25   Cucumis melo [Oriental melon]
ref|XP_009406560.1|  PREDICTED: uncharacterized protein At3g03773       107   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY50383.1|  BnaCnng19150D                                          114   5e-25   Brassica napus [oilseed rape]
gb|KFK37810.1|  hypothetical protein AALP_AA3G032300                    107   5e-25   Arabis alpina [alpine rockcress]
gb|KFK42641.1|  hypothetical protein AALP_AA1G021600                    110   5e-25   Arabis alpina [alpine rockcress]
ref|XP_010036247.1|  PREDICTED: uncharacterized protein At3g03773       106   6e-25   Eucalyptus grandis [rose gum]
gb|KDP39664.1|  hypothetical protein JCGZ_02684                         106   6e-25   Jatropha curcas
ref|XP_011034312.1|  PREDICTED: uncharacterized protein At3g03773...    106   9e-25   Populus euphratica
ref|XP_011001701.1|  PREDICTED: uncharacterized protein At3g03773       106   9e-25   Populus euphratica
ref|XP_007030016.1|  HSP20-like chaperones superfamily protein is...    107   1e-24   
ref|XP_010524994.1|  PREDICTED: uncharacterized protein At3g03773       105   2e-24   Tarenaya hassleriana [spider flower]
gb|EEC75850.1|  hypothetical protein OsI_12851                          104   2e-24   Oryza sativa Indica Group [Indian rice]
gb|AAT78841.1|  putative ripening regulated protein                     104   3e-24   
ref|XP_008784543.1|  PREDICTED: uncharacterized protein At3g03773       103   6e-24   
ref|XP_006651649.1|  PREDICTED: uncharacterized protein At3g03773...    103   7e-24   
ref|XP_011467366.1|  PREDICTED: uncharacterized protein At3g03773       103   9e-24   
ref|XP_011077748.1|  PREDICTED: uncharacterized protein At3g03773       103   1e-23   
ref|XP_008244126.1|  PREDICTED: uncharacterized protein At3g03773...    103   1e-23   
gb|EYU38733.1|  hypothetical protein MIMGU_mgv1a015568mg                103   1e-23   
gb|EEE59618.1|  hypothetical protein OsJ_11950                          103   2e-23   
ref|XP_010111789.1|  hypothetical protein L484_008793                   105   2e-23   
gb|KEH25572.1|  HSP20-like chaperone superfamily protein                102   2e-23   
ref|XP_004982271.1|  PREDICTED: uncharacterized protein At3g03773...    101   4e-23   
ref|XP_001751416.1|  predicted protein                                  100   5e-23   
gb|KJB49926.1|  hypothetical protein B456_008G146000                    102   6e-23   
ref|XP_006339212.1|  PREDICTED: uncharacterized protein At3g03773...    100   2e-22   
ref|XP_003550101.1|  PREDICTED: uncharacterized protein At3g03773...  99.4    2e-22   
emb|CBI29165.3|  unnamed protein product                              99.4    3e-22   
ref|XP_003561651.1|  PREDICTED: uncharacterized protein At3g03773...  99.4    4e-22   
gb|EMS50884.1|  hypothetical protein TRIUR3_00736                     99.4    4e-22   
ref|NP_001149029.1|  LOC100282649                                     99.0    6e-22   
tpg|DAA50638.1|  TPA: hypothetical protein ZEAMMB73_821193            99.4    1e-21   
ref|XP_008676642.1|  PREDICTED: LOC100282649 isoform X1               99.0    1e-21   
ref|XP_004249362.1|  PREDICTED: uncharacterized protein At3g03773...  97.1    3e-21   
gb|EMT28462.1|  hypothetical protein F775_24500                       98.2    6e-21   
emb|CDP16487.1|  unnamed protein product                              97.1    6e-21   
ref|XP_010312189.1|  PREDICTED: uncharacterized protein At3g03773...  95.9    6e-21   
ref|XP_009614071.1|  PREDICTED: uncharacterized protein At3g03773...  94.7    2e-20   
ref|XP_009759595.1|  PREDICTED: uncharacterized protein At3g03773...  94.7    2e-20   
ref|XP_006579379.1|  PREDICTED: uncharacterized protein LOC100527...  94.7    2e-20   
ref|XP_006405244.1|  hypothetical protein EUTSA_v10000448mg           95.1    2e-20   
ref|XP_010677802.1|  PREDICTED: uncharacterized protein At3g03773     94.4    2e-20   
ref|XP_002466731.1|  hypothetical protein SORBIDRAFT_01g013010        94.0    2e-20   
ref|XP_009759593.1|  PREDICTED: uncharacterized protein At3g03773...  92.8    8e-20   
ref|XP_009614070.1|  PREDICTED: uncharacterized protein At3g03773...  92.8    1e-19   
ref|XP_009759594.1|  PREDICTED: uncharacterized protein At3g03773...  92.0    2e-19   
ref|XP_009759592.1|  PREDICTED: uncharacterized protein At3g03773...  90.5    6e-19   
gb|AEO14616.1|  p23-like protein                                      90.9    1e-18   
ref|XP_003561652.1|  PREDICTED: uncharacterized protein At3g03773...  89.7    1e-18   
gb|EJY64547.1|  hypothetical protein OXYTRI_15424                     89.7    3e-18   
emb|CDW90495.1|  UNKNOWN                                              86.3    5e-17   
gb|KIP08515.1|  hypothetical protein PHLGIDRAFT_104152                85.5    1e-16   
ref|XP_005703152.1|  hypothetical protein Gasu_57530                  83.6    3e-16   
ref|XP_007402477.1|  hypothetical protein PHACADRAFT_107836           84.0    3e-16   
emb|CEP11024.1|  hypothetical protein                                 79.3    8e-15   
ref|XP_009063023.1|  hypothetical protein LOTGIDRAFT_167297           79.7    9e-15   
gb|EGO02826.1|  hypothetical protein SERLA73DRAFT_176232              80.1    9e-15   
ref|XP_002505589.1|  predicted protein                                79.0    1e-14   
gb|EMD41447.1|  hypothetical protein CERSUDRAFT_90011                 78.6    3e-14   
ref|XP_007763196.1|  HSP20-like chaperone                             78.6    3e-14   
ref|NP_594586.1|  p23 chaperone protein wos2                          78.2    3e-14   
gb|KIO07430.1|  hypothetical protein M404DRAFT_23943                  77.4    4e-14   
ref|XP_001417418.1|  predicted protein                                76.3    5e-14   
ref|XP_002490155.1|  Co-chaperone that binds to and regulates Hsp...  77.4    6e-14   
ref|XP_011395585.1|  Uncharacterized protein F751_6760                77.4    6e-14   
emb|CAX72392.1|  Conserved hypothetical protein                       77.0    7e-14   
ref|XP_003737019.1|  PREDICTED: prostaglandin E synthase 3-like       77.0    7e-14   
gb|ELT99588.1|  hypothetical protein CAPTEDRAFT_175529                76.6    1e-13   
gb|KDD75545.1|  hypothetical protein H632_c624p0                      75.9    2e-13   
gb|KFA60902.1|  hypothetical protein S40285_04863                     75.1    2e-13   
emb|CAX79533.1|  Conserved hypothetical protein                       75.5    2e-13   
emb|CAX79556.1|  Conserved hypothetical protein                       75.5    2e-13   
gb|AAW26530.1|  SJCHGC02843 protein                                   75.5    2e-13   
emb|CAX79528.1|  Conserved hypothetical protein                       75.5    2e-13   
emb|CAD98707.1|  p23 co-chaperone, probable                           75.5    3e-13   
gb|KIK97887.1|  hypothetical protein PAXRUDRAFT_824469                75.9    3e-13   
gb|KIN01266.1|  hypothetical protein OIDMADRAFT_180102                75.5    3e-13   
gb|KIJ21402.1|  hypothetical protein PAXINDRAFT_64441                 75.9    3e-13   
emb|CDH60308.1|  hypothetical protein RO3G_03344                      74.7    3e-13   
ref|XP_666939.1|  p23 co-chaperone                                    75.1    3e-13   
gb|AFW60898.1|  hypothetical protein ZEAMMB73_488396                  73.6    3e-13   
ref|XP_011146741.1|  PREDICTED: prostaglandin E synthase 3 isofor...  74.7    4e-13   
gb|EPB88551.1|  hypothetical protein HMPREF1544_04664                 74.3    4e-13   
ref|XP_627530.1|  p23; HSP20-like chaperones fold                     75.1    4e-13   
gb|KIY03930.1|  hypothetical protein Z520_00622                       75.1    5e-13   
ref|XP_007805406.1|  hypothetical protein EPUS_08181                  75.1    5e-13   
dbj|GAN11316.1|  conserved hypothetical protein                       74.3    5e-13   
ref|XP_002951829.1|  hypothetical protein VOLCADRAFT_75159            74.7    5e-13   
gb|KEF55504.1|  hypothetical protein A1O9_08254                       75.1    5e-13   
gb|KIW33587.1|  hypothetical protein PV07_00424                       74.7    5e-13   
gb|KDP27514.1|  hypothetical protein JCGZ_20154                       73.2    5e-13   
gb|KIK47968.1|  hypothetical protein CY34DRAFT_798829                 75.1    5e-13   
ref|XP_005649882.1|  HSP20-like chaperone                             74.7    5e-13   
emb|CDS09429.1|  hypothetical protein LRAMOSA10789                    74.3    5e-13   
gb|KIW86178.1|  hypothetical protein Z517_01573                       74.7    5e-13   
gb|KEY66933.1|  hypothetical protein S7711_06882                      74.7    5e-13   
ref|XP_011301796.1|  PREDICTED: prostaglandin E synthase 3 isofor...  74.3    6e-13   
gb|KIX04374.1|  hypothetical protein Z518_05242                       74.3    7e-13   
ref|XP_001692528.1|  p23 co-chaperone of HSP90 system                 72.8    8e-13   
emb|CAX72397.1|  Conserved hypothetical protein                       73.9    8e-13   
ref|XP_007733594.1|  hypothetical protein A1O3_05279                  74.3    8e-13   
ref|XP_001828956.1|  wos2                                             74.3    8e-13   
ref|XP_011301791.1|  PREDICTED: prostaglandin E synthase 3 isofor...  73.6    9e-13   
gb|KIW64432.1|  hypothetical protein PV04_09365                       73.9    9e-13   
emb|CEF97421.1|  HSP20-like chaperone                                 73.9    9e-13   
ref|XP_008730292.1|  hypothetical protein G647_07758                  73.9    1e-12   
gb|EIE78640.1|  hypothetical protein RO3G_03344                       72.8    1e-12   
dbj|GAM85028.1|  hypothetical protein ANO11243_030310                 73.6    2e-12   
ref|XP_002628714.1|  conserved hypothetical protein                   73.2    2e-12   
ref|XP_001745103.1|  hypothetical protein                             73.9    2e-12   
ref|XP_007740106.1|  hypothetical protein A1O5_01297                  72.8    2e-12   
ref|XP_009227308.1|  hypothetical protein GGTG_11164                  72.8    2e-12   
emb|CDX96489.1|  BnaA07g31000D                                        72.0    3e-12   
gb|KEQ59873.1|  HSP20-like chaperone                                  72.0    3e-12   
ref|XP_001596171.1|  hypothetical protein SS1G_02387                  72.8    3e-12   
ref|XP_001692527.1|  p23 co-chaperone of HSP90 system                 72.8    3e-12   
ref|XP_009540362.1|  hypothetical protein HETIRDRAFT_42374            72.8    3e-12   
gb|KIV93686.1|  hypothetical protein PV10_04881                       72.4    3e-12   
ref|XP_011055805.1|  PREDICTED: prostaglandin E synthase 3-like       72.0    3e-12   
ref|XP_007721804.1|  hypothetical protein A1O1_02704                  72.4    3e-12   
gb|KIW90779.1|  hypothetical protein Z519_08562                       72.4    4e-12   
ref|XP_003666918.1|  hypothetical protein MYCTH_2312065               71.2    4e-12   
gb|ABA28992.1|  p23                                                   71.6    4e-12   
gb|KHJ33705.1|  putative hsp90 associated co-chaperone                73.2    4e-12   
ref|XP_007314723.1|  hypothetical protein SERLADRAFT_380296           72.4    4e-12   
ref|XP_002545188.1|  conserved hypothetical protein                   72.0    5e-12   
gb|KER00863.1|  hypothetical protein AUEXF2481DRAFT_164090            71.2    5e-12   
ref|XP_008087002.1|  HSP20-like chaperone                             72.0    5e-12   
gb|EHK97651.1|  putative protein wos2                                 72.0    5e-12   
ref|XP_502241.1|  YALI0D00429p                                        72.4    5e-12   
ref|XP_009261552.1|  hypothetical protein FPSE_10160                  72.0    5e-12   
gb|EPS99586.1|  hypothetical protein FOMPIDRAFT_1024083               72.0    6e-12   
ref|XP_005098826.1|  PREDICTED: uncharacterized protein ZC395.10-...  70.9    6e-12   
ref|XP_011146742.1|  PREDICTED: prostaglandin E synthase 3 isofor...  70.9    7e-12   
ref|XP_005098825.1|  PREDICTED: uncharacterized protein ZC395.10-...  70.9    7e-12   
gb|ADV40360.1|  putative p23-like protein                             70.9    7e-12   
ref|XP_010730004.1|  PREDICTED: prostaglandin E synthase 3            70.9    7e-12   
gb|KFM61744.1|  Protein wos2                                          70.9    7e-12   
gb|AFV74662.1|  progesterone-like protein 2                           71.2    7e-12   
ref|XP_005755520.1|  PREDICTED: very-long-chain (3R)-3-hydroxyacy...  70.9    7e-12   
gb|ESZ90227.1|  CS domain-containing protein                          71.6    7e-12   
gb|KIY98474.1|  hypothetical protein MNEG_9489                        71.6    8e-12   
ref|XP_011155371.1|  PREDICTED: prostaglandin E synthase 3 isofor...  71.2    8e-12   
emb|CEF68121.1|  CS domain and HSP20-like chaperone domain-contai...  70.9    9e-12   
gb|KJA29359.1|  hypothetical protein HYPSUDRAFT_127652                71.6    9e-12   
gb|KIV87240.1|  hypothetical protein PV11_02798                       71.2    9e-12   
gb|KIO31180.1|  hypothetical protein M407DRAFT_241886                 71.2    9e-12   
ref|XP_007760963.1|  hypothetical protein A1O7_08784                  70.9    1e-11   
ref|XP_011155372.1|  PREDICTED: prostaglandin E synthase 3 isofor...  70.9    1e-11   
ref|XP_001824269.1|  Hsp90 binding co-chaperone (Sba1)                70.9    1e-11   
ref|XP_002381379.1|  Hsp90 binding co-chaperone (Sba1), putative      71.2    1e-11   
emb|CCD59100.1|  hsp90 co-chaperone (tebp), putative                  70.5    1e-11   
gb|KDQ30366.1|  hypothetical protein PLEOSDRAFT_1088350               70.9    1e-11   
gb|KEQ73539.1|  HSP20-like chaperone                                  70.1    1e-11   
emb|CCF35904.1|  Wos2                                                 70.5    1e-11   
gb|EPS32670.1|  hypothetical protein PDE_07630                        70.5    1e-11   
emb|CCM01278.1|  predicted protein                                    70.9    2e-11   
emb|CDO70896.1|  hypothetical protein BN946_scf184829.g4              70.5    2e-11   
gb|EUC65580.1|  CS domain protein                                     70.5    2e-11   
ref|XP_005538124.1|  hsp90 co-chaperone p23                           70.5    2e-11   
gb|KEP52150.1|  CS domain protein                                     70.5    2e-11   
ref|XP_011340388.1|  PREDICTED: prostaglandin E synthase 3 isofor...  69.3    2e-11   
ref|XP_007368799.1|  HSP20-like chaperone                             70.1    2e-11   
ref|XP_011325563.1|  hypothetical protein FGSG_10831                  70.1    2e-11   
ref|XP_011340387.1|  PREDICTED: prostaglandin E synthase 3 isofor...  69.3    2e-11   
gb|KIW06655.1|  hypothetical protein PV09_02363                       69.7    2e-11   
gb|KFH43429.1|  hypothetical protein ACRE_058210                      68.6    3e-11   
gb|KEQ87580.1|  HSP20-like chaperone                                  70.5    3e-11   
gb|EZA53333.1|  Prostaglandin E synthase                              68.9    3e-11   
ref|XP_002642797.1|  Hypothetical protein CBG21192                    69.3    3e-11   
ref|XP_007851749.1|  wos2 protein                                     69.7    3e-11   
ref|XP_003709374.1|  hypothetical protein MGG_06669                   69.7    3e-11   
ref|XP_003835711.1|  hypothetical protein LEMA_P050520.1              69.7    3e-11   
gb|ACG46061.1|  hypothetical protein                                  67.8    4e-11   
emb|CAP38028.2|  Protein CBG21192                                     69.3    4e-11   
gb|KIW44022.1|  hypothetical protein PV06_05065                       68.9    4e-11   
gb|KIW11856.1|  hypothetical protein PV08_09129                       68.9    5e-11   
ref|XP_005458956.1|  PREDICTED: very-long-chain (3R)-3-hydroxyacy...  70.9    6e-11   
ref|XP_002732671.1|  PREDICTED: uncharacterized protein ZC395.10-...  68.2    6e-11   
gb|EME40800.1|  hypothetical protein DOTSEDRAFT_74381                 68.9    6e-11   
ref|XP_008716482.1|  hypothetical protein HMPREF1541_03912            68.6    7e-11   
ref|XP_007297430.1|  hsp90-binding co-chaperone                       68.6    7e-11   
dbj|GAD93137.1|  Hsp90 binding co-chaperone (Sba1), putative          68.6    7e-11   
gb|KIL70578.1|  hypothetical protein M378DRAFT_155513                 68.6    8e-11   
ref|XP_001453905.1|  hypothetical protein                             67.8    8e-11   
gb|EUN29802.1|  hypothetical protein COCVIDRAFT_35427                 68.6    8e-11   
gb|EEH05143.1|  cell cycle regulator p21 protein                      68.2    8e-11   
gb|EMF09545.1|  HSP20-like chaperone                                  68.6    8e-11   
gb|EYC15162.1|  hypothetical protein Y032_0038g3663                   68.2    9e-11   
ref|XP_004366018.1|  CS domain-containing protein                     68.2    9e-11   
gb|EMG50117.1|  Co-chaperone protein, putative                        68.6    1e-10   
gb|EGT45536.1|  hypothetical protein CAEBREN_16802                    67.8    1e-10   
emb|CDS14405.1|  hypothetical protein LRAMOSA06574                    67.4    1e-10   
ref|XP_008596946.1|  Hsp90 associated co-chaperone                    67.8    1e-10   
emb|CDH56868.1|  hypothetical protein RO3G_03344                      67.4    1e-10   
ref|XP_009153341.1|  hypothetical protein HMPREF1120_01086            67.8    1e-10   
emb|CDK28392.1|  unnamed protein product                              67.8    1e-10   
ref|XP_001555275.1|  hypothetical protein BC1G_05980                  67.8    1e-10   
ref|XP_007793716.1|  putative hsp90 associated co-chaperone protein   67.8    1e-10   
gb|KIW60525.1|  hypothetical protein PV05_00737                       67.8    1e-10   
gb|KGQ04193.1|  Protein wos2                                          67.4    2e-10   
ref|XP_001951884.1|  PREDICTED: uncharacterized protein ZC395.10      67.8    2e-10   
ref|XP_002900407.1|  conserved hypothetical protein                   67.0    2e-10   
gb|EUB61926.1|  hypothetical protein EGR_03199                        67.0    2e-10   
gb|KIM52342.1|  hypothetical protein SCLCIDRAFT_1223825               67.4    2e-10   
gb|KIY45251.1|  HSP20-like chaperone                                  67.4    2e-10   
gb|AFJ11394.1|  cytosolic prostaglandin E synthase                    66.6    2e-10   
gb|EPE06267.1|  hsp90 associated co-chaperone                         67.4    2e-10   
ref|XP_003350804.1|  hypothetical protein SMAC_02474                  67.4    2e-10   
gb|ERS96320.1|  hypothetical protein HMPREF1624_07230                 67.4    2e-10   
gb|KDR11450.1|  Prostaglandin E synthase 3                            66.6    2e-10   
ref|XP_001524089.1|  conserved hypothetical protein                   67.8    2e-10   
ref|XP_001450701.1|  hypothetical protein                             67.0    2e-10   
ref|XP_001313131.1|  hypothetical protein                             66.6    2e-10   
gb|KIH95193.1|  protein wos2                                          67.4    2e-10   
ref|XP_007716764.1|  hypothetical protein COCCADRAFT_8792             67.4    2e-10   
ref|XP_005855276.1|  wos2 protein                                     65.9    2e-10   
ref|XP_006796566.1|  PREDICTED: prostaglandin E synthase 3-like       66.2    2e-10   
ref|XP_003069101.1|  protein wos2, putative                           66.6    3e-10   
dbj|BAH70783.1|  ACYPI001190                                          65.9    3e-10   
gb|EPY28834.1|  hypothetical protein AGDE_10259                       66.2    3e-10   
ref|XP_002111187.1|  hypothetical protein TRIADDRAFT_54888            65.9    3e-10   
ref|XP_003439023.1|  PREDICTED: prostaglandin E synthase 3-like       66.2    3e-10   
gb|ETW33751.1|  hypothetical protein, variant 2                       67.8    3e-10   
ref|XP_009025602.1|  hypothetical protein HELRODRAFT_163501           66.2    3e-10   
dbj|BAN20316.1|  conserved hypothetical protein                       66.2    3e-10   
ref|XP_004546275.1|  PREDICTED: prostaglandin E synthase 3-like       66.2    3e-10   
ref|XP_001240168.1|  hypothetical protein CIMG_09789                  66.6    3e-10   
ref|XP_006691093.1|  putative Co-chaperone protein                    67.0    3e-10   
gb|ETW33750.1|  hypothetical protein, variant 1                       67.8    3e-10   
emb|CDO67001.1|  co-chaperone p23                                     67.8    3e-10   
ref|XP_006960850.1|  HSP20-like chaperone                             66.2    3e-10   
gb|ETW33749.1|  hypothetical protein PFTANZ_05513                     67.8    3e-10   



>ref|XP_011074127.1| PREDICTED: uncharacterized protein OsI_027940-like [Sesamum indicum]
Length=180

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ SDKLFITVELPDAKNVK  L+PEGKF+F+A +GADNTP+E+  +L+DK
Sbjct  1    MSRHPLVKWAQRSDKLFITVELPDAKNVKLNLDPEGKFFFSATSGADNTPYEIDIDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
            VDVNESK S TSR ICYLVKKA++KWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK
Sbjct  61   VDVNESKASFTSRSICYLVKKADNKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  117



>ref|XP_009785922.1| PREDICTED: uncharacterized protein OsI_027940-like [Nicotiana 
sylvestris]
Length=184

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDKLFITVELPDAKNVK KLEPEGKF+F+A AGADN P+EV  +LFDK
Sbjct  1    MSRHPAVKWAQRSDKLFITVELPDAKNVKLKLEPEGKFFFSATAGADNVPYEVDLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  439
            ++V+ESK STTSR I YLVKKAEDKWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  61   INVDESKTSTTSRSIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKP  118



>ref|XP_009604975.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Nicotiana tomentosiformis]
Length=190

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDKLFITVELPDAKNVK KLEPEGKF+F+A AGADN P+EV  +LFDK
Sbjct  1    MSRHPAVKWAQRSDKLFITVELPDAKNVKLKLEPEGKFFFSAIAGADNVPYEVDLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  439
            ++V+ESK STTSR I YLVKKAEDKWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  61   INVDESKTSTTSRSIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKP  118



>ref|XP_009604976.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Nicotiana tomentosiformis]
Length=184

 Score =   202 bits (513),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDKLFITVELPDAKNVK KLEPEGKF+F+A AGADN P+EV  +LFDK
Sbjct  1    MSRHPAVKWAQRSDKLFITVELPDAKNVKLKLEPEGKFFFSAIAGADNVPYEVDLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  439
            ++V+ESK STTSR I YLVKKAEDKWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  61   INVDESKTSTTSRSIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKP  118



>gb|AIL30486.1| ripening regulated protein DDTFR8 [Nicotiana tabacum]
Length=184

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDKLFITVELPDAKNVK KLEPEGKF+F+A AGADN P+EV  +LFDK
Sbjct  1    MSRHPAVKWAQRSDKLFITVELPDAKNVKLKLEPEGKFFFSAIAGADNVPYEVDLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  439
            ++V+ESK STTSR I YLVKKAEDKWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  61   INVDESKTSTTSRSIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKP  118



>ref|NP_001234685.1| ripening regulated protein DDTFR8 [Solanum lycopersicum]
 gb|AAG49030.1|AF204783_1 ripening regulated protein DDTFR8 [Solanum lycopersicum]
Length=179

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP++KWAQ SDKLFITVELPDAKNVK KLEPEGKF F+A AGADN P+EV  +LFDK
Sbjct  1    MSRHPTIKWAQMSDKLFITVELPDAKNVKLKLEPEGKFLFSATAGADNVPYEVDLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  439
            ++V+ESK STTSR I YLVKKAEDKWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  61   INVDESKSSTTSRSIVYLVKKAEDKWWSRLVKQEGLRPVFLKVDWDKWVDEDEEDSKP  118



>ref|XP_006360297.1| PREDICTED: uncharacterized protein Os08g0359500-like [Solanum 
tuberosum]
Length=182

 Score =   199 bits (506),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP++KWAQ SDK+FITVELPDAKNVK KLEPEGKF F+A AGADN P+EV  +LFDK
Sbjct  1    MSRHPTIKWAQRSDKVFITVELPDAKNVKQKLEPEGKFSFSATAGADNVPYEVVLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  439
            +DV+ESK S TSR ICYLVKKAED WWSRL+KQEGK P FLK DWDKW+DEDEQD +P
Sbjct  61   IDVDESKSSITSRNICYLVKKAEDNWWSRLIKQEGKSPTFLKADWDKWIDEDEQDSEP  118



>ref|XP_004252558.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Solanum 
lycopersicum]
Length=180

 Score =   197 bits (502),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPS+KWAQ SDK+FITVELPDAKNVK KLEPEGKF F+A AGADN P+EV  +LFDK
Sbjct  1    MSRHPSIKWAQRSDKVFITVELPDAKNVKQKLEPEGKFSFSATAGADNVPYEVVLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  439
            +DV+ES+ S TSR ICYLVKKAED WWSRL+KQEGK P FLK DWDKWVDEDEQD +P
Sbjct  61   IDVDESQSSITSRNICYLVKKAEDNWWSRLIKQEGKSPTFLKADWDKWVDEDEQDGEP  118



>ref|XP_010314468.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Solanum 
lycopersicum]
Length=179

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPS+KWAQ SDK+FITVELPDAKNVK KLEPEGKF F+A AGADN P+EV  +LFDK
Sbjct  1    MSRHPSIKWAQRSDKVFITVELPDAKNVKQKLEPEGKFSFSATAGADNVPYEVVLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  439
            +DV+ES+ S TSR ICYLVKKAED WWSRL+KQEGK P FLK DWDKWVDEDEQD +P
Sbjct  61   IDVDESQSSITSRNICYLVKKAEDNWWSRLIKQEGKSPTFLKADWDKWVDEDEQDGEP  118



>ref|XP_006359015.1| PREDICTED: uncharacterized protein OsI_027940-like [Solanum tuberosum]
Length=180

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP++KWAQ SDKLFITVELPDAKNVK KLEPEGKF F+A AG DN P+EV  +LFDK
Sbjct  1    MSRHPTIKWAQRSDKLFITVELPDAKNVKLKLEPEGKFLFSATAGDDNVPYEVDLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  439
            ++V+ESK STTSR I YLVKKAE+KWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  61   INVDESKSSTTSRSIVYLVKKAEEKWWSRLIKQEGLRPVFLKVDWDKWVDEDEEDGKP  118



>ref|NP_001237326.1| uncharacterized protein LOC100527783 [Glycine max]
 gb|ACU16956.1| unknown [Glycine max]
Length=189

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 101/119 (85%), Gaps = 1/119 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SD L++TVELPDA++VK KLEPEGKFYF+A AGA+  P+EV  +LFDK
Sbjct  1    MSRHPSVKWAQTSDVLYLTVELPDAQDVKLKLEPEGKFYFSATAGAEKIPYEVDIDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED-EQDEKP  439
            +DVN SK S  SR ICYLVKKAE+KWW RLLKQ GK PVFLKVDWDKWVDED EQD KP
Sbjct  61   IDVNNSKASVGSRNICYLVKKAENKWWDRLLKQGGKSPVFLKVDWDKWVDEDEEQDNKP  119



>gb|KHN32820.1| Hypothetical protein glysoja_024179 [Glycine soja]
Length=189

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 101/119 (85%), Gaps = 1/119 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SD L++TVELPDA++VK KLEPEGKFYF+A AGA+  P+EV  +LFDK
Sbjct  1    MSRHPSVKWAQTSDVLYLTVELPDAQDVKLKLEPEGKFYFSATAGAEKIPYEVDIDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED-EQDEKP  439
            +DVN SK S  SR ICYLVKKAE+KWW RLLKQ GK PVFLKVDWDKWVDED EQD KP
Sbjct  61   IDVNNSKASVGSRNICYLVKKAENKWWDRLLKQGGKSPVFLKVDWDKWVDEDEEQDNKP  119



>gb|EYU36540.1| hypothetical protein MIMGU_mgv1a018670mg, partial [Erythranthe 
guttata]
Length=136

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP VKWAQ SDKLF+TVELPDAKNVK  L+PEGKF+F+A  G DN P+E+  +L+DKV 
Sbjct  9    RHPLVKWAQRSDKLFVTVELPDAKNVKLNLDPEGKFFFSATGGVDNVPYEIDIDLYDKVV  68

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
            V+ESK S TSR+ICYLVKKAE KWWSRLLKQ GKPP+FLKVDWDKWVDEDEQDEK
Sbjct  69   VDESKASCTSRHICYLVKKAESKWWSRLLKQGGKPPLFLKVDWDKWVDEDEQDEK  123



>ref|XP_006574773.1| PREDICTED: uncharacterized protein OsI_027940-like [Glycine max]
 gb|KHN00714.1| Hypothetical protein glysoja_000382 [Glycine soja]
Length=191

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 1/119 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SD L++TVELPDA++VK KLEPEGKFYF+A AGA+  P+EV  +LFDK
Sbjct  1    MSRHPSVKWAQTSDVLYLTVELPDAQDVKLKLEPEGKFYFSATAGAEKIPYEVDIDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED-EQDEKP  439
            +DVN SK S  SR+ICYLVKKAE+KWW RLLKQ GK PVFLKVDWDKWVDED EQD KP
Sbjct  61   IDVNNSKASVGSRHICYLVKKAENKWWDRLLKQGGKSPVFLKVDWDKWVDEDEEQDNKP  119



>ref|XP_002893745.1| hypothetical protein ARALYDRAFT_336372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70004.1| hypothetical protein ARALYDRAFT_336372 [Arabidopsis lyrata subsp. 
lyrata]
Length=180

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS+HP+VKWAQ SDK++ITVELPDA++VK KLEP+GKF+F+A +GA  TP+EV  +LFD 
Sbjct  1    MSKHPTVKWAQRSDKVYITVELPDAEDVKLKLEPQGKFFFSATSGASKTPYEVDLDLFDN  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VDVNESK S  SR ICY+VKKAE KWW+RL+KQEGKPPVFLKVDWDKWVDEDE
Sbjct  61   VDVNESKASVNSRCICYMVKKAESKWWNRLIKQEGKPPVFLKVDWDKWVDEDE  113



>ref|XP_010243328.1| PREDICTED: uncharacterized protein OsI_027940-like [Nelumbo nucifera]
Length=175

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            M+RHPSVKWAQ SDK++IT+ELPDAK+V  KLEPEGKF+F+A +GAD TP+E+  +L+DK
Sbjct  1    MNRHPSVKWAQRSDKVYITIELPDAKDVNLKLEPEGKFFFSATSGADKTPYEIDIDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            VDV+ESK S   R ICYLVKK E KWWSR LKQEGKPPVFLKVDWDKWVDEDE+ E
Sbjct  61   VDVDESKASVGLRNICYLVKKVEKKWWSRFLKQEGKPPVFLKVDWDKWVDEDEEQE  116



>ref|XP_008780776.1| PREDICTED: uncharacterized protein Os08g0359500-like [Phoenix 
dactylifera]
Length=182

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+ KWAQ SDK++IT+ELPDAK+VK  L+P+G FYF+A +GADN P+E+ FELFDK
Sbjct  1    MSRHPTTKWAQRSDKVYITIELPDAKDVKLNLQPDGHFYFSAASGADNVPYEIDFELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            V+V ESK S   R ICYLVKKAE KWWSRLLK+EGKPPVFLKVDWDKW+DED+  E
Sbjct  61   VNVEESKASVGLRTICYLVKKAEKKWWSRLLKKEGKPPVFLKVDWDKWIDEDDDTE  116



>emb|CDP01142.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  104  VKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNES  283
            VKWAQ SD+LFITVELPDA NV  KLEPEGKF F+A  G DNTP+EV F+LFDKVD NES
Sbjct  2    VKWAQRSDRLFITVELPDANNVTHKLEPEGKFLFSATTGVDNTPYEVEFDLFDKVDANES  61

Query  284  KGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
            K S TSR ICYLV+KAE+KWW RLLKQ GKPP+FLKVDWDKWVDEDEQDEK
Sbjct  62   KISATSRNICYLVQKAENKWWGRLLKQSGKPPIFLKVDWDKWVDEDEQDEK  112



>ref|XP_006434560.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47800.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|KDO83851.1| hypothetical protein CISIN_1g030007mg [Citrus sinensis]
Length=184

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 136/188 (72%), Gaps = 8/188 (4%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ +D+++IT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L+DK
Sbjct  1    MSRHPTVKWAQRTDRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ--DEKP  439
            VDVNESK S   R I YLVKKAE+KWWSRLLKQ GKPPVFLKVDWDKW+DEDE+  D+KP
Sbjct  61   VDVNESKASVGLRNIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKP  120

Query  440  gagmdfggddfdfSNLSMggpgdfdadaagdddddddsdTEEEGKEIETGAASSEVQAHA  619
             A MDFG  DF   N+            A   D++D+SDTEEE +   T A + E    +
Sbjct  121  PADMDFGDLDFSKMNMG------GLDAEAAGGDENDESDTEEENEVGTTPAGNREAPPPS  174

Query  620  PCSEPETK  643
              SEP+TK
Sbjct  175  TSSEPDTK  182



>ref|XP_010926229.1| PREDICTED: uncharacterized protein Os08g0359500-like [Elaeis 
guineensis]
Length=187

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+ KWAQ SDK++IT+ELPDAK+VK  L+P G FYF+A +GADN P+E+ FELFDK
Sbjct  1    MSRHPTTKWAQRSDKVYITIELPDAKDVKLNLQPGGHFYFSAASGADNVPYEIDFELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            V+V ESK S   R ICYLVKKAE KWWSRLLK+EGKPPVFLKVDWDKW+DED+  E
Sbjct  61   VNVEESKASVGLRTICYLVKKAEKKWWSRLLKKEGKPPVFLKVDWDKWIDEDDDKE  116



>ref|XP_007020190.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
 gb|EOY17415.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
Length=182

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD +FIT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L DK
Sbjct  1    MSRHPTVKWAQRSDVVFITIDLPDAQDVKLKLEPEGKFFFSATSGVDKIPYEVDIDLRDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            VDV ESK S   R ICYLVKKAE+KWWSRLLKQEGKPPVFLKVDWDKWVDEDE+D+
Sbjct  61   VDVAESKASVGKRNICYLVKKAENKWWSRLLKQEGKPPVFLKVDWDKWVDEDEEDQ  116



>ref|XP_008811572.1| PREDICTED: uncharacterized protein Os08g0359500-like [Phoenix 
dactylifera]
Length=186

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+ KWAQ SDK+++T+ELPDAK+VK  L+P+G FYF+A +GADNTP+E+ FEL DK
Sbjct  1    MSRHPTTKWAQRSDKVYLTIELPDAKDVKLNLQPDGHFYFSATSGADNTPYEIDFELLDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            V V ESK +   R ICYLVKKAE KWWSRLLK+EGKPPVFLKVDWDKW+DED+ +E
Sbjct  61   VSVEESKAAIGLRNICYLVKKAEKKWWSRLLKKEGKPPVFLKVDWDKWIDEDDDNE  116



>ref|XP_006473157.1| PREDICTED: uncharacterized protein OsI_027940-like [Citrus sinensis]
Length=184

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 135/188 (72%), Gaps = 8/188 (4%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ +D+++IT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L+DK
Sbjct  1    MSRHPTVKWAQRTDRVYITIDLPDAQDVKLKLEPEGKFFFSAISGPDKIPYEVDIDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ--DEKP  439
            VDVNESK S   R I YLVKKAE+KWWSRLLKQ GKPPVFLKVDWDKW+DEDE+  D KP
Sbjct  61   VDVNESKASVGLRNIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDNKP  120

Query  440  gagmdfggddfdfSNLSMggpgdfdadaagdddddddsdTEEEGKEIETGAASSEVQAHA  619
             A MDFG  DF   N+            A   D++D+SDTEEE +   T A + E    +
Sbjct  121  PADMDFGDLDFSKMNMG------GFDAEAAGGDENDESDTEEENEVGATPAGNREAPPPS  174

Query  620  PCSEPETK  643
              SEP+TK
Sbjct  175  TSSEPDTK  182



>ref|XP_010916995.1| PREDICTED: uncharacterized protein OsI_027940-like [Elaeis guineensis]
Length=187

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+ KWAQ SDK++IT+ELPDAK+VK  L+P+G FYF A +GADN P+E+ FELFDK
Sbjct  1    MSRHPTTKWAQRSDKVYITIELPDAKDVKLNLQPDGHFYFYATSGADNIPYEIDFELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            V+V ES+ +   R ICYLVKKAE KWWSRLLK EG+PPVFLK DWDKW+DED+++E
Sbjct  61   VNVEESRAAIGLRNICYLVKKAEKKWWSRLLKNEGRPPVFLKADWDKWIDEDDENE  116



>ref|XP_006434559.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47799.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|KDO83850.1| hypothetical protein CISIN_1g030007mg [Citrus sinensis]
Length=182

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 103/120 (86%), Gaps = 2/120 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ +D+++IT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L+DK
Sbjct  1    MSRHPTVKWAQRTDRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ--DEKP  439
            VDVNESK S   R I YLVKKAE+KWWSRLLKQ GKPPVFLKVDWDKW+DEDE+  D+KP
Sbjct  61   VDVNESKASVGLRNIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKP  120



>ref|XP_006434561.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47801.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|KDO83852.1| hypothetical protein CISIN_1g030007mg [Citrus sinensis]
Length=139

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 103/120 (86%), Gaps = 2/120 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ +D+++IT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L+DK
Sbjct  1    MSRHPTVKWAQRTDRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ--DEKP  439
            VDVNESK S   R I YLVKKAE+KWWSRLLKQ GKPPVFLKVDWDKW+DEDE+  D+KP
Sbjct  61   VDVNESKASVGLRNIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKP  120



>ref|XP_011044819.1| PREDICTED: uncharacterized protein OsI_027940-like [Populus euphratica]
Length=186

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SDKLFITV+LPDA++VKFKLEPEGKF+F+A +GAD TP+E+  EL DK
Sbjct  1    MSRHPSVKWAQRSDKLFITVQLPDAQDVKFKLEPEGKFFFSATSGADKTPYEIELELLDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK    SR I Y+VKKAE+KWWSRL+K  GKPPVFL VDWDKW+DEDE+
Sbjct  61   VNVEESKAGIGSRNIQYIVKKAENKWWSRLIKPTGKPPVFLTVDWDKWIDEDEE  114



>ref|XP_010461085.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Camelina sativa]
Length=181

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDK++ITVELPDA++VK KLEP GKF+F+A +G   TP+EV  +LF+ 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFES  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VDVNESK S +SR ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_010461088.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X4 
[Camelina sativa]
Length=179

 Score =   180 bits (456),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDK++ITVELPDA++VK KLEP GKF+F+A +G   TP+EV  +LF+ 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFES  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VDVNESK S +SR ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_010461086.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Camelina sativa]
Length=181

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDK++ITVELPDA++VK KLEP GKF+F+A +G   TP+EV  +LF+ 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFES  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VDVNESK S +SR ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_007151931.1| hypothetical protein PHAVU_004G088000g [Phaseolus vulgaris]
 gb|ESW23925.1| hypothetical protein PHAVU_004G088000g [Phaseolus vulgaris]
Length=189

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SD L++TVELPDA++VK KLEPEGKF+F+A AG++  P+EV  +LFD+
Sbjct  1    MSRHPSVKWAQRSDVLYLTVELPDAQDVKLKLEPEGKFHFSATAGSEKIPYEVDIDLFDE  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            +DVN SK S  SR ICYLVKK E+KWW RLLK+ GK PVFLKVDWDKWVDEDE+
Sbjct  61   IDVNNSKASVGSRNICYLVKKTENKWWDRLLKKGGKTPVFLKVDWDKWVDEDEE  114



>ref|XP_008237430.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X1 [Prunus mume]
Length=237

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD ++IT++LPDA++VK  LEPEGKF F+A  G + TP+E+  +L+DK
Sbjct  1    MSRHPNVKWAQRSDTVYITIDLPDAQDVKLNLEPEGKFLFSATTGPEKTPYEIDLDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            +DVNESK S   R ICYLVKKAEDKWWSRL+KQ+GK PVFLKVDWDKWVDEDE+ E
Sbjct  61   IDVNESKASVGLRNICYLVKKAEDKWWSRLIKQQGKAPVFLKVDWDKWVDEDEEPE  116



>ref|XP_008237431.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X2 [Prunus mume]
Length=236

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD ++IT++LPDA++VK  LEPEGKF F+A  G + TP+E+  +L+DK
Sbjct  1    MSRHPNVKWAQRSDTVYITIDLPDAQDVKLNLEPEGKFLFSATTGPEKTPYEIDLDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            +DVNESK S   R ICYLVKKAEDKWWSRL+KQ+GK PVFLKVDWDKWVDEDE+ E
Sbjct  61   IDVNESKASVGLRNICYLVKKAEDKWWSRLIKQQGKAPVFLKVDWDKWVDEDEEPE  116



>ref|XP_010478707.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Camelina sativa]
Length=182

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDK++ITVELPDA++VK KL+P GKF+F+A +G   TP+EV  +LF+ 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLDPHGKFFFSATSGPSKTPYEVEIDLFES  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VDVNESK S +SR ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_010478705.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Camelina sativa]
Length=183

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDK++ITVELPDA++VK KL+P GKF+F+A +G   TP+EV  +LF+ 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLDPHGKFFFSATSGPSKTPYEVEIDLFES  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VDVNESK S +SR ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_007201255.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
 gb|EMJ02454.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
Length=236

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD ++IT+ LPDA +VK  LEPEGKF F+A  G + TP+EV  +L+DK
Sbjct  1    MSRHPNVKWAQRSDTVYITINLPDAHDVKLNLEPEGKFLFSATTGPEKTPYEVDLDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            +DVNESK S   R ICYLVKKAEDKWWSRL+KQ+GK PVFLKVDWDKWVDEDE+ E
Sbjct  61   IDVNESKASVGLRNICYLVKKAEDKWWSRLIKQQGKAPVFLKVDWDKWVDEDEEPE  116



>ref|XP_007201254.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
 gb|EMJ02453.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
Length=237

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD ++IT+ LPDA +VK  LEPEGKF F+A  G + TP+EV  +L+DK
Sbjct  1    MSRHPNVKWAQRSDTVYITINLPDAHDVKLNLEPEGKFLFSATTGPEKTPYEVDLDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            +DVNESK S   R ICYLVKKAEDKWWSRL+KQ+GK PVFLKVDWDKWVDEDE+ E
Sbjct  61   IDVNESKASVGLRNICYLVKKAEDKWWSRLIKQQGKAPVFLKVDWDKWVDEDEEPE  116



>ref|XP_002300889.2| hypothetical protein POPTR_0002s06240g [Populus trichocarpa]
 gb|EEE80162.2| hypothetical protein POPTR_0002s06240g [Populus trichocarpa]
Length=184

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SD LFITV+LPDA++VK K+EPEGKF+F+A +G D  P+EV  +L DK
Sbjct  1    MSRHPSVKWAQRSDNLFITVQLPDAQDVKLKIEPEGKFFFSATSGVDKIPYEVELDLLDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V V ESK ST SR I Y+VKKAE+KWWSRL+KQ GKPPVFL VDWDKW+DEDE+
Sbjct  61   VIVEESKASTGSRSIQYIVKKAENKWWSRLIKQTGKPPVFLTVDWDKWIDEDEE  114



>ref|XP_010461087.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Camelina sativa]
Length=180

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP+VKWAQ SDK++ITVELPDA++VK KLEP GKF+F+A +G   TP+EV  +LF+ VD
Sbjct  2    RHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFESVD  61

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VNESK S +SR ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  62   VNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  112



>ref|XP_010499806.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Camelina sativa]
Length=182

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDK++ITVELPDA++VK KLEP GKF+F+A +    TP+EV  +LF+ 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSEPTKTPYEVDIDLFES  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VDVNESK S +SR ICY+VKKAE KWW RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWDRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_002265220.1| PREDICTED: uncharacterized protein OsI_027940-like [Vitis vinifera]
Length=178

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD ++IT++LPDAK+V  KLEPEGKF+F+A +GAD  P+E+  +LFDK
Sbjct  1    MSRHPTVKWAQRSDTIYITIDLPDAKDVNLKLEPEGKFFFSATSGADKIPYEIDIDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            VDVNESK S   R I YLVKKAE+KWWSRLLKQEGKPPVFLKVDWDKWV
Sbjct  61   VDVNESKASIGLRNIRYLVKKAENKWWSRLLKQEGKPPVFLKVDWDKWV  109



>ref|XP_010499808.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Camelina sativa]
Length=180

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDK++ITVELPDA++VK KLEP GKF+F+A +    TP+EV  +LF+ 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSEPTKTPYEVDIDLFES  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VDVNESK S +SR ICY+VKKAE KWW RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWDRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_010478706.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Camelina sativa]
Length=182

 Score =   175 bits (443),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP+VKWAQ SDK++ITVELPDA++VK KL+P GKF+F+A +G   TP+EV  +LF+ VD
Sbjct  2    RHPTVKWAQRSDKVYITVELPDAEDVKVKLDPHGKFFFSATSGPSKTPYEVEIDLFESVD  61

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VNESK S +SR ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  62   VNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  112



>ref|XP_009409147.1| PREDICTED: uncharacterized protein OsI_027940-like [Musa acuminata 
subsp. malaccensis]
Length=185

 Score =   175 bits (443),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+ KWAQ SDK++IT+ELPDAK+VK  LEPEG+FYF+A +G  N  +E+  ELFD+
Sbjct  1    MSRHPTTKWAQRSDKVYITIELPDAKDVKLTLEPEGRFYFSATSGTANIRYELDLELFDR  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            V V+ESK +   R ICYLVKKAE KWWSRLLKQ GKPPV+LKVDWDKW+DED++ E
Sbjct  61   VIVDESKAAVGLRTICYLVKKAEKKWWSRLLKQAGKPPVYLKVDWDKWIDEDDEKE  116



>ref|NP_001050241.1| Os03g0381300 [Oryza sativa Japonica Group]
 gb|AAR96242.1| putative ripening regulated protein [Oryza sativa Japonica Group]
 gb|ABF96270.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12155.1| Os03g0381300 [Oryza sativa Japonica Group]
Length=173

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPS KWAQ SDK+F+T+ELPDA++VK  L+PEG+F F+A+  AD+TP+E+  ELFD 
Sbjct  1    MSRHPSTKWAQRSDKVFLTIELPDARDVKLNLKPEGQFIFSAKGPADDTPYELDLELFDA  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +  +R ICYL+KKAE KWW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  61   VNVEESKAAVAARSICYLIKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  115



>ref|XP_004140943.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
 gb|KGN46095.1| hypothetical protein Csa_6G052700 [Cucumis sativus]
Length=191

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+++WAQ SD+LFIT++LPDA++VK KL+PEGKF F+A +G +  P+EV  +L+DK
Sbjct  1    MSRHPTLRWAQTSDRLFITIDLPDAQDVKLKLDPEGKFCFSAVSGTEKIPYEVDIDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            VD+NESK S   R I YL++KAE KWWSRLLKQEGKPPVF+K+DWDKW+DEDE+
Sbjct  61   VDINESKASIGMRNILYLIEKAEKKWWSRLLKQEGKPPVFVKIDWDKWIDEDEE  114



>gb|EAY90254.1| hypothetical protein OsI_11826 [Oryza sativa Indica Group]
Length=171

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPS KWAQ SDK+F+T+ELPDA++VK  L+PEG+F F+A+  AD+TP+E+  ELFD 
Sbjct  1    MSRHPSTKWAQRSDKVFLTIELPDARDVKLNLKPEGQFIFSAKGPADDTPYELDLELFDA  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +  +R ICYL+KKAE KWW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  61   VNVEESKAAVAARSICYLIKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  115



>ref|XP_011458453.1| PREDICTED: uncharacterized protein OsI_027940-like [Fragaria 
vesca subsp. vesca]
Length=183

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            M RHP VKWAQ  D L+IT++LPDA++VK KL PEGKF F+A  G + TP+EV  +L+DK
Sbjct  1    MGRHPIVKWAQRPDTLYITIDLPDAQDVKLKLGPEGKFLFSATTGKEKTPYEVDLDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            +DVNESK S   R ICYLVKKAE KWWSRL+KQEGK PVFLKVDWDKWVDEDE+
Sbjct  61   IDVNESKASIGLRNICYLVKKAESKWWSRLIKQEGKAPVFLKVDWDKWVDEDEE  114



>ref|XP_002307531.2| hypothetical protein POPTR_0005s22140g, partial [Populus trichocarpa]
 gb|EEE94527.2| hypothetical protein POPTR_0005s22140g, partial [Populus trichocarpa]
Length=205

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHPSVKWAQ SDKLFI V+LPDA++VKFKLEPEGKF+F+A +GAD TP+E+  +L DKV+
Sbjct  19   RHPSVKWAQRSDKLFIIVQLPDAQDVKFKLEPEGKFFFSATSGADKTPYEIELDLLDKVN  78

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V ESK    SR I Y+VKKAE+KWWSRL+KQ GKPPVFL VDWDKW+DEDE+
Sbjct  79   VEESKAGIGSRNIQYIVKKAENKWWSRLIKQTGKPPVFLTVDWDKWIDEDEE  130



>gb|ABF96271.1| expressed protein [Oryza sativa Japonica Group]
Length=160

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPS KWAQ SDK+F+T+ELPDA++VK  L+PEG+F F+A+  AD+TP+E+  ELFD 
Sbjct  1    MSRHPSTKWAQRSDKVFLTIELPDARDVKLNLKPEGQFIFSAKGPADDTPYELDLELFDA  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +  +R ICYL+KKAE KWW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  61   VNVEESKAAVAARSICYLIKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  115



>ref|XP_004159475.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
Length=191

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+++WAQ SD+LFIT++LPDA++VK KL+PEGKF F+A +G +  P+EV  +L+DK
Sbjct  1    MSRHPTLRWAQTSDRLFITIDLPDAQDVKLKLDPEGKFCFSAVSGTEKIPYEVDIDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            VD+NESK S   R I YL++KAE KWWSRLLKQEGKPPVF+K+DWDKW+DEDE+
Sbjct  61   VDINESKASIGMRNIRYLIEKAEKKWWSRLLKQEGKPPVFVKIDWDKWIDEDEE  114



>ref|XP_003619026.1| Ripening regulated protein DDTFR8 [Medicago truncatula]
 gb|AES75244.1| HSP90 co-chaperone [Medicago truncatula]
Length=190

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 100/121 (83%), Gaps = 3/121 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ S++L ITVELPDA++VK K+EPEGKFYF+A AGA+  P+EV+ +LFD 
Sbjct  1    MSRHPTVKWAQRSEELSITVELPDAQDVKLKVEPEGKFYFSATAGAEKIPYEVNVDLFDS  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED---EQDEK  436
            +DVN+   S +SR ICYLVKKAE+KWW RLLKQ GK P FLK+DWDKWVDED   EQ+ K
Sbjct  61   IDVNDIITSASSRQICYLVKKAENKWWDRLLKQGGKIPSFLKIDWDKWVDEDEYYEQEAK  120

Query  437  P  439
            P
Sbjct  121  P  121



>emb|CBI29341.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD ++IT++LPDAK+V  KLEPEGKF+F+A +GAD  P+E+  +LFDK
Sbjct  41   MSRHPTVKWAQRSDTIYITIDLPDAKDVNLKLEPEGKFFFSATSGADKIPYEIDIDLFDK  100

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            VDVNESK S   R I YLVKKAE+KWWSRLLKQEGKPPVFLKVDWDKWV
Sbjct  101  VDVNESKASIGLRNIRYLVKKAENKWWSRLLKQEGKPPVFLKVDWDKWV  149



>ref|XP_009380995.1| PREDICTED: uncharacterized protein At3g03773-like [Musa acuminata 
subsp. malaccensis]
Length=178

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+ KWAQ SDK++I +ELPDAK+VKF L+P+G+FYF+A +GA+N P+E+ FELFDK
Sbjct  1    MSRHPTTKWAQRSDKVYIIIELPDAKDVKFTLQPDGRFYFSATSGAENIPYELDFELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            V+V+ESK +   R ICYLVKKAE KWWSRLLK  GKPPV+LKVDWDKW+
Sbjct  61   VNVDESKAAVGLRTICYLVKKAEKKWWSRLLKTAGKPPVYLKVDWDKWI  109



>ref|XP_010499807.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Camelina sativa]
Length=181

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP+VKWAQ SDK++ITVELPDA++VK KLEP GKF+F+A +    TP+EV  +LF+ VD
Sbjct  2    RHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSEPTKTPYEVDIDLFESVD  61

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VNESK S +SR ICY+VKKAE KWW RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  62   VNESKASVSSRCICYMVKKAESKWWDRLIKQEGKTPVYLKVDWDKWVDEDE  112



>ref|XP_006434558.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47798.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
Length=180

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 132/188 (70%), Gaps = 12/188 (6%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ +D+++IT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L+DK
Sbjct  1    MSRHPTVKWAQRTDRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ--DEKP  439
                ESK S   R I YLVKKAE+KWWSRLLKQ GKPPVFLKVDWDKW+DEDE+  D+KP
Sbjct  61   ----ESKASVGLRNIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKP  116

Query  440  gagmdfggddfdfSNLSMggpgdfdadaagdddddddsdTEEEGKEIETGAASSEVQAHA  619
             A MDFG  DF   N+            A   D++D+SDTEEE +   T A + E    +
Sbjct  117  PADMDFGDLDFSKMNMG------GLDAEAAGGDENDESDTEEENEVGTTPAGNREAPPPS  170

Query  620  PCSEPETK  643
              SEP+TK
Sbjct  171  TSSEPDTK  178



>ref|XP_011026295.1| PREDICTED: uncharacterized protein OsI_027940-like [Populus euphratica]
Length=184

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SD LFITV+LPDA++VK K+EPEGKF+F+A +G +  P+EV  +L DK
Sbjct  1    MSRHPSVKWAQRSDNLFITVQLPDAQDVKLKIEPEGKFFFSASSGVEKIPYEVELDLLDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V V ESK S  SR I Y+VKKAE+KWWSRL+K  GKPPVFL VDWDKW+DEDE+
Sbjct  61   VIVEESKASIGSRSIQYIVKKAENKWWSRLIKPTGKPPVFLTVDWDKWIDEDEE  114



>gb|KJB59532.1| hypothetical protein B456_009G259900 [Gossypium raimondii]
Length=182

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  D +FIT+ELPDA++VK KLEPEGKF+F+A++GAD  P+EV  +L DK
Sbjct  1    MSRHPMVKWAQRLDDVFITIELPDAQDVKLKLEPEGKFFFSAKSGADKIPYEVDLDLHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            VDV+ SK S  +R ICYLVKKAE KWWSRLLKQEG+PPVFLKVDWD+W
Sbjct  61   VDVDGSKASVGNRNICYLVKKAESKWWSRLLKQEGRPPVFLKVDWDRW  108



>ref|XP_008456697.1| PREDICTED: uncharacterized protein At3g03773-like isoform X1 
[Cucumis melo]
Length=190

 Score =   171 bits (432),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+++WAQ S++LFIT++LPDA++VK KLEPEGKF F+A +GA+  P EV  +L+DK
Sbjct  1    MSRHPTLRWAQTSNRLFITIDLPDAQDVKLKLEPEGKFCFSAVSGAEKIPHEVDIDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            VD+NESK S   R I YL++KAE KWWSRLLKQEGK PVF+K+DWDKW+DEDE+
Sbjct  61   VDINESKASIGMRNIRYLIEKAEKKWWSRLLKQEGKHPVFVKIDWDKWIDEDEE  114



>gb|KHF97613.1| hypothetical protein F383_14672 [Gossypium arboreum]
Length=182

 Score =   170 bits (431),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  D +FIT+ELPDA++VK KLEPEGKF+F+A++GAD  P+EV  +L DK
Sbjct  1    MSRHPIVKWAQRLDDVFITIELPDAQDVKLKLEPEGKFFFSAKSGADKIPYEVDLDLHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            VDV+ SK S  +R ICYLVKKAE KWWSRLLKQEG+PPVFLKVDWD+W
Sbjct  61   VDVDGSKASVGNRNICYLVKKAESKWWSRLLKQEGRPPVFLKVDWDRW  108



>ref|XP_006651444.1| PREDICTED: uncharacterized protein OsI_027940-like [Oryza brachyantha]
Length=173

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP  KWAQ SDK+F+T+ELPDA++VK  L+P+G F F+A+  AD+TP+E+  ELFD 
Sbjct  1    MSRHPITKWAQRSDKVFLTIELPDARDVKLNLKPDGHFIFSAKGPADDTPYELDLELFDA  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R ICYLVKKAE KWW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  61   VNVEESKAAVAPRTICYLVKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  115



>gb|AAG41763.1|AF153128_1 p23 [Brassica napus]
Length=178

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD ++ITVELPDA++VK KLEPEGKF+F+A +GA  T +EV  +L D 
Sbjct  1    MSRHPTVKWAQRSDWVYITVELPDAEDVKLKLEPEGKFFFSATSGASKTLYEVDLDLLDS  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            VDVNESK S +SR + YLVKKAE KWW+RL K EGK P++LKVDWDKWVDED++D
Sbjct  61   VDVNESKASVSSRSVFYLVKKAESKWWNRLTKPEGKHPLYLKVDWDKWVDEDDED  115



>ref|XP_008381044.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Malus domestica]
Length=224

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD ++IT++LPDA++VK KLEPEGKF F+A  G + TP+EV  +L+DK
Sbjct  1    MSRHPNVKWAQRSDMVYITIDLPDAQDVKLKLEPEGKFLFSATTGPEKTPYEVDLDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            +D+NE+K S   R ICYLVKKAEDKWWSRL+KQ+G+ P+FLKVDWDKW
Sbjct  61   IDINETKTSVGLRNICYLVKKAEDKWWSRLIKQQGRAPIFLKVDWDKW  108



>ref|XP_008381045.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Malus domestica]
Length=223

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD ++IT++LPDA++VK KLEPEGKF F+A  G + TP+EV  +L+DK
Sbjct  1    MSRHPNVKWAQRSDMVYITIDLPDAQDVKLKLEPEGKFLFSATTGPEKTPYEVDLDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            +D+NE+K S   R ICYLVKKAEDKWWSRL+KQ+G+ P+FLKVDWDKW
Sbjct  61   IDINETKTSVGLRNICYLVKKAEDKWWSRLIKQQGRAPIFLKVDWDKW  108



>ref|XP_008456698.1| PREDICTED: uncharacterized protein At3g03773-like isoform X2 
[Cucumis melo]
Length=189

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP+++WAQ S++LFIT++LPDA++VK KLEPEGKF F+A +GA+  P EV  +L+DKVD
Sbjct  2    RHPTLRWAQTSNRLFITIDLPDAQDVKLKLEPEGKFCFSAVSGAEKIPHEVDIDLYDKVD  61

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            +NESK S   R I YL++KAE KWWSRLLKQEGK PVF+K+DWDKW+DEDE+
Sbjct  62   INESKASIGMRNIRYLIEKAEKKWWSRLLKQEGKHPVFVKIDWDKWIDEDEE  113



>ref|XP_003557812.1| PREDICTED: uncharacterized protein OsI_027940-like [Brachypodium 
distachyon]
Length=175

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPS KWAQ SDK+++T+ELPDAK+VK  L+P+G F F+A+A AD T +   FELFD 
Sbjct  1    MSRHPSTKWAQRSDKVYLTIELPDAKDVKLNLKPDGHFDFSAKAPADETQYVFDFELFDA  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R ICYL+KKAE KWW RLLK EGKPPVFLKVDWDKW DED++D
Sbjct  61   VNVEESKAAVAQRSICYLIKKAESKWWPRLLKNEGKPPVFLKVDWDKWQDEDDED  115



>emb|CDY04790.1| BnaC05g17990D [Brassica napus]
Length=196

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  83   TMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFD  262
            + SRHP+VKWAQ SD ++ITVELPDA++VK KLEPEGKF+F+A +GA  T +EV  +L D
Sbjct  18   SCSRHPTVKWAQRSDWVYITVELPDAEDVKLKLEPEGKFFFSATSGASKTLYEVDLDLLD  77

Query  263  KVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
             VDVNESK S +SR + YLVKKAE KWW+RL K EGK P++LKVDWDKWVDED++D
Sbjct  78   SVDVNESKASVSSRSVFYLVKKAESKWWNRLTKPEGKHPLYLKVDWDKWVDEDDED  133



>ref|XP_010251769.1| PREDICTED: uncharacterized protein Os08g0359500-like [Nelumbo 
nucifera]
Length=172

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 97/117 (83%), Gaps = 2/117 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP++KWAQ SDK+++TV+LPDAK+VK KLEPEGKF F+A    DN P+EV  +L DK
Sbjct  1    MSRHPTLKWAQRSDKIYLTVDLPDAKDVKLKLEPEGKFIFSA--TKDNLPYEVDIDLHDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
            V+V ESK S   R I Y+++KAE KWW RLLKQEGKPPVFLKVDWDKWVDE++++EK
Sbjct  59   VNVEESKVSIGVRSIVYVIEKAEKKWWGRLLKQEGKPPVFLKVDWDKWVDEEDENEK  115



>emb|CDY21385.1| BnaA09g30420D [Brassica napus]
Length=182

 Score =   165 bits (417),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  83   TMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFD  262
            + SRHP+VKWAQ SD ++ITVELPDA++VK KLEPEGK +F+A +GA  T +EV  +L D
Sbjct  4    SCSRHPTVKWAQRSDWVYITVELPDAEDVKLKLEPEGKLFFSATSGASKTLYEVDLDLLD  63

Query  263  KVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
             VDVNESK + +SR + YLVKKAE KWW+RL KQEGK P++LKVDWDKWVDED++D
Sbjct  64   SVDVNESKVNVSSRSVFYLVKKAESKWWNRLTKQEGKHPLYLKVDWDKWVDEDDED  119



>ref|XP_002277004.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Vitis vinifera]
Length=159

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 96/117 (82%), Gaps = 2/117 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDKL++TVELPDAK+VK KLEPEG+F F+A    D+ P+EV  ELFDK
Sbjct  1    MSRHPTVKWAQRSDKLYLTVELPDAKDVKLKLEPEGRFMFSA--TKDDVPYEVDIELFDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
            + V +SK +   R I Y++ KAE KWW+RL+K EGKPPVFLKVDWDKWVDE++++EK
Sbjct  59   IKVEDSKCNVGVRSIVYVIAKAEKKWWARLIKNEGKPPVFLKVDWDKWVDEEDENEK  115



>gb|AFK43711.1| unknown [Lotus japonicus]
Length=191

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ SD+L+IT+ELPDA++VK  LEPEGK YF+A AG +N P+E +F+LFDK
Sbjct  1    MSRHPPVKWAQRSDELYITIELPDAQDVKLILEPEGKLYFSATAGPENIPYEFNFDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            VDVN S+ S + R I YL+ KAE K W RLLKQ GKPPVFLKVDWDKWV
Sbjct  61   VDVNNSESSVSKRNIIYLISKAESKCWDRLLKQGGKPPVFLKVDWDKWV  109



>ref|XP_002276982.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Vitis vinifera]
Length=170

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 96/117 (82%), Gaps = 2/117 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SDKL++TVELPDAK+VK KLEPEG+F F+A    D+ P+EV  ELFDK
Sbjct  1    MSRHPTVKWAQRSDKLYLTVELPDAKDVKLKLEPEGRFMFSA--TKDDVPYEVDIELFDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
            + V +SK +   R I Y++ KAE KWW+RL+K EGKPPVFLKVDWDKWVDE++++EK
Sbjct  59   IKVEDSKCNVGVRSIVYVIAKAEKKWWARLIKNEGKPPVFLKVDWDKWVDEEDENEK  115



>ref|XP_002525582.1| HSP90 co-chaperone, putative [Ricinus communis]
 gb|EEF36841.1| HSP90 co-chaperone, putative [Ricinus communis]
Length=149

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ SDK+FITVELPDAK+VK KLEPEG+F F+A    D+ P+EV  ELFDK
Sbjct  1    MSRHPIVKWAQRSDKVFITVELPDAKDVKLKLEPEGRFIFSATK--DDVPYEVDIELFDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
            V+V ESK +   R I Y +KK E KWW RL+KQEGK PVFLKVDWDKWVDED++++K
Sbjct  59   VNVKESKYNIGVRSIVYDIKKVEKKWWGRLIKQEGKTPVFLKVDWDKWVDEDDENDK  115



>ref|XP_004984205.1| PREDICTED: uncharacterized protein OsI_027940-like [Setaria italica]
Length=177

 Score =   162 bits (411),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP  KWAQ SD++F+T+ELPDAK+VK  L+PEG F F+A+ G+D+ P+E+  ELFD 
Sbjct  1    MSRHPITKWAQRSDRVFLTIELPDAKDVKLNLKPEGHFNFSAK-GSDDLPYELDLELFDA  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R ICYL+KKAE KWW RL K+EGKPPVFLKVDWDKW DED++D
Sbjct  60   VNVEESKAAVAPRTICYLIKKAESKWWPRLPKKEGKPPVFLKVDWDKWQDEDDED  114



>gb|AGT16170.1| hypothetical protein SHCRBa_024_F14_R_20 [Saccharum hybrid cultivar 
R570]
Length=179

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP  KWAQ SD++F+T+ELPDAK+VK  L+PEG F F+A+ G+D+ P+E   ELFD 
Sbjct  1    MSRHPITKWAQRSDRVFLTIELPDAKDVKLNLKPEGHFNFSAK-GSDDLPYEFDLELFDA  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R ICYL+KK E KWW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  60   VNVEESKAAVAPRTICYLIKKTESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  114



>gb|ABA60373.1| p23 [Dactylis glomerata]
Length=180

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPS KWAQ SDK+++T+ELPDAK+VK  L+P+G F F+A+ G+D+  +E+  ELFD 
Sbjct  1    MSRHPSTKWAQRSDKVYLTIELPDAKDVKLNLKPDGHFNFSAK-GSDDMQYELDLELFDA  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R ICYLVKKAE  WW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  60   VNVEESKAAVAPRTICYLVKKAESTWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  114



>ref|XP_002465200.1| hypothetical protein SORBIDRAFT_01g033940 [Sorghum bicolor]
 gb|EER92198.1| hypothetical protein SORBIDRAFT_01g033940 [Sorghum bicolor]
Length=178

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP  KWAQ SD++F+T+ELPDAK+VK  L+PEG F F+A+ G+D+ P+E   ELFD 
Sbjct  1    MSRHPITKWAQRSDRVFLTIELPDAKDVKLNLKPEGHFNFSAK-GSDDLPYEFDLELFDA  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R ICYL+KKAE KWW RLLK+EGK PVFLKVDWDKW DED++D
Sbjct  60   VNVEESKAAVAPRTICYLIKKAESKWWPRLLKKEGKAPVFLKVDWDKWQDEDDED  114



>ref|XP_010922128.1| PREDICTED: uncharacterized protein At3g03773-like [Elaeis guineensis]
Length=155

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 93/117 (79%), Gaps = 2/117 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ SDK+++TVELPDAK+V  KLEPEGKFYF+A    D   +EV  ELF+K
Sbjct  1    MSRHPIVKWAQRSDKIYLTVELPDAKDVNLKLEPEGKFYFSA--NKDGVSYEVDLELFNK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
            V   ESK +   R I Y++KKAE KWWSRLLK+EGKPP FLKVDWDKW+DE++++EK
Sbjct  59   VITKESKFNIGMRSIGYVIKKAEKKWWSRLLKEEGKPPAFLKVDWDKWIDEEDENEK  115



>ref|XP_010694670.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X4 
[Beta vulgaris subsp. vulgaris]
Length=187

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SDK+++T+ELPDAK+VK KLEPEGK  F+A   A   P+E   EL DK
Sbjct  1    MSRHPSVKWAQSSDKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            ++V ESK +   R I Y+++KAE +WWSRL+KQEG PP+FLKVDWDKWVDE+E++
Sbjct  59   INVEESKYNIGVRQIVYVIEKAEKRWWSRLIKQEGNPPIFLKVDWDKWVDENEEN  113



>ref|XP_010694667.1| PREDICTED: uncharacterized protein At3g03773-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=200

 Score =   160 bits (405),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SDK+++T+ELPDAK+VK KLEPEGK  F+A   A   P+E   EL DK
Sbjct  1    MSRHPSVKWAQSSDKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            ++V ESK +   R I Y+++KAE +WWSRL+KQEG PP+FLKVDWDKWVDE+E++
Sbjct  59   INVEESKYNIGVRQIVYVIEKAEKRWWSRLIKQEGNPPIFLKVDWDKWVDENEEN  113



>ref|XP_010694668.1| PREDICTED: uncharacterized protein At3g03773-like isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=197

 Score =   160 bits (405),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SDK+++T+ELPDAK+VK KLEPEGK  F+A   A   P+E   EL DK
Sbjct  1    MSRHPSVKWAQSSDKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            ++V ESK +   R I Y+++KAE +WWSRL+KQEG PP+FLKVDWDKWVDE+E++
Sbjct  59   INVEESKYNIGVRQIVYVIEKAEKRWWSRLIKQEGNPPIFLKVDWDKWVDENEEN  113



>ref|XP_010694666.1| PREDICTED: uncharacterized protein At3g03773-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=201

 Score =   160 bits (405),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHPSVKWAQ SDK+++T+ELPDAK+VK KLEPEGK  F+A   A   P+E   EL DK
Sbjct  1    MSRHPSVKWAQSSDKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            ++V ESK +   R I Y+++KAE +WWSRL+KQEG PP+FLKVDWDKWVDE+E++
Sbjct  59   INVEESKYNIGVRQIVYVIEKAEKRWWSRLIKQEGNPPIFLKVDWDKWVDENEEN  113



>ref|XP_009115602.1| PREDICTED: uncharacterized protein OsI_027940-like [Brassica 
rapa]
Length=180

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ SD ++ITVELPDA++VK KLEPEGK +F+A +GA  T +EV  +L D 
Sbjct  1    MSRHPTVKWAQRSDWVYITVELPDAEDVKLKLEPEGKLFFSATSGASKTLYEVDLDLLDS  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            VDVNESK + +SR + YLVKKAE KWW+RL KQEGK P++LKVDWDKWV
Sbjct  61   VDVNESKVNVSSRSVFYLVKKAESKWWNRLTKQEGKHPLYLKVDWDKWV  109



>emb|CAN64654.1| hypothetical protein VITISV_015756 [Vitis vinifera]
Length=182

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   DTMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELF  259
            D  SRHP+VKWAQ SDKL++TVELPDAK+VK KLEPEG+F F+A    D+ P+EV  ELF
Sbjct  9    DKWSRHPTVKWAQRSDKLYLTVELPDAKDVKLKLEPEGRFMFSA--TKDDVPYEVDIELF  66

Query  260  DKVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            DK+ V +SK +   R I Y++ KAE KWW+RL+K EGKPPVFLKVDWDKWVDE++++
Sbjct  67   DKIKVEDSKCNVGVRSIVYVIAKAEKKWWARLIKNEGKPPVFLKVDWDKWVDEEDEN  123



>ref|XP_008792419.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Phoenix dactylifera]
Length=155

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP+VKWAQ  DK+++TVELPDAK+V  KLEPEGKF F+A    D   +EV  ELFDK
Sbjct  1    MSRHPTVKWAQRCDKIYLTVELPDAKDVNLKLEPEGKFSFSA--NKDGVSYEVDLELFDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
            V   ESK +   R I Y++KKAE KWWSRLLK EGKPP FLKVDWDKW+DE++++EK
Sbjct  59   VSTKESKFNIGMRSIVYVIKKAEKKWWSRLLKDEGKPPAFLKVDWDKWIDEEDENEK  115



>gb|EMT32541.1| hypothetical protein F775_31652 [Aegilops tauschii]
Length=194

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHPS KWAQ  DK+++T+ELPDAK+VK  L P+G F F+A+A AD+  +E+  ELFD V 
Sbjct  16   RHPSTKWAQRLDKVYLTIELPDAKDVKLNLRPDGHFNFSAKAPADDMQYELDLELFDAVS  75

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V ES+ +   R ICYLVKKAE KWW RLLK+EG+PPVFLKVDWDKW DED++D
Sbjct  76   VEESQAAVAPRAICYLVKKAEGKWWPRLLKKEGRPPVFLKVDWDKWQDEDDED  128



>ref|NP_001148600.1| prostaglandin E synthase 3 [Zea mays]
 gb|ACF82936.1| unknown [Zea mays]
 gb|ACG32174.1| prostaglandin E synthase 3 [Zea mays]
Length=176

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 91/115 (79%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP  KWAQ SD++F+T+ELPDA++VK  L+PEG F F+A+ G+D+  +E   ELFD 
Sbjct  1    MSRHPITKWAQRSDRVFLTIELPDAQDVKLNLKPEGHFNFSAK-GSDDLRYEFDIELFDA  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R ICYL+KKA+  WW RLLKQEGKPPVFLKVDWDKW DED++D
Sbjct  60   VNVEESKAAIAPRTICYLIKKAKSGWWPRLLKQEGKPPVFLKVDWDKWQDEDDED  114



>dbj|BAE92292.1| putative p23 co-chaperone [Cryptomeria japonica]
Length=240

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            +SRHP VKWAQ +DK+++T++LPD+KN   KLEPEGK  F+A  G +N PFE +F+LFDK
Sbjct  6    ISRHPEVKWAQRTDKVYVTIQLPDSKNADVKLEPEGKLSFSATTGPENAPFEFNFDLFDK  65

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  439
            VDV  SK +   R I   ++KAE  WW RLLK EGK P ++KVDWDKWVDEDE+DEKP
Sbjct  66   VDVEASKINVGLRNIFCCIEKAEKGWWKRLLKAEGKTPQYIKVDWDKWVDEDEEDEKP  123



>ref|XP_008792417.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Phoenix dactylifera]
 ref|XP_008792418.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Phoenix dactylifera]
Length=213

 Score =   153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +2

Query  89   SRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKV  268
            +RHP+VKWAQ  DK+++TVELPDAK+V  KLEPEGKF F+A    D   +EV  ELFDKV
Sbjct  73   NRHPTVKWAQRCDKIYLTVELPDAKDVNLKLEPEGKFSFSA--NKDGVSYEVDLELFDKV  130

Query  269  DVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
               ESK +   R I Y++KKAE KWWSRLLK EGKPP FLKVDWDKW+DE++++EK
Sbjct  131  STKESKFNIGMRSIVYVIKKAEKKWWSRLLKDEGKPPAFLKVDWDKWIDEEDENEK  186



>ref|XP_008792416.1| PREDICTED: uncharacterized protein At3g03773-like isoform X1 
[Phoenix dactylifera]
Length=226

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +2

Query  89   SRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKV  268
            +RHP+VKWAQ  DK+++TVELPDAK+V  KLEPEGKF F+A    D   +EV  ELFDKV
Sbjct  73   NRHPTVKWAQRCDKIYLTVELPDAKDVNLKLEPEGKFSFSA--NKDGVSYEVDLELFDKV  130

Query  269  DVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
               ESK +   R I Y++KKAE KWWSRLLK EGKPP FLKVDWDKW+DE++++EK
Sbjct  131  STKESKFNIGMRSIVYVIKKAEKKWWSRLLKDEGKPPAFLKVDWDKWIDEEDENEK  186



>gb|ABK26701.1| unknown [Picea sitchensis]
Length=246

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ +DK++IT+ LPDAKN   +L+PEGK  F+A AG+ +TPFE++ EL+DK
Sbjct  1    MSRHPEVNWAQRTDKIYITILLPDAKNADVELQPEGKLTFSATAGSQDTPFELNLELYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  436
            V+V  SK +   R I  +V+KAE  WW RLLK EGK P++LKVDWDKWVDEDE+DEK
Sbjct  61   VNVEASKINVGLRNIFCVVEKAEKGWWKRLLKGEGKTPLYLKVDWDKWVDEDEEDEK  117



>gb|KDP28144.1| hypothetical protein JCGZ_13915 [Jatropha curcas]
Length=188

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+FITV LPDAKN K  LEPEG F F+A AGA+N  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQRVDKVFITVLLPDAKNAKVNLEPEGVFTFSASAGAENHVYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE  WW +LL+ +GKPP +LKVDWDKWVDEDE
Sbjct  61   VNVEESKINIGVRSIFCIVEKAEKVWWKKLLRGDGKPPHYLKVDWDKWVDEDE  113



>gb|AFK39090.1| unknown [Lotus japonicus]
Length=228

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +2

Query  83   TMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFD  262
            + SRHP VKWAQ  DK++ITV+LPD+K+ K  L P+G F F A AGA + P+EV  ELFD
Sbjct  2    SSSRHPEVKWAQREDKVYITVQLPDSKDAKVDLTPDGVFTFTASAGAGDKPYEVKLELFD  61

Query  263  KVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            KV+V ESK +   R I  +V+KAE  WW RLL+ EGKPP ++KVDWDKWVDEDE+D
Sbjct  62   KVNVEESKINIGVRSIFSVVQKAESGWWKRLLRGEGKPPHYVKVDWDKWVDEDEED  117



>ref|XP_007050893.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX95050.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
Length=180

 Score =   146 bits (368),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ SDK+FITV LPD+KN K  LEPEG F F+A AGADN  +E+  EL DK
Sbjct  1    MSRHPEVKWAQRSDKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R I  +++KAE  WW++LL+ +GK P ++KVDWDKWVDEDE++
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDEDEEN  115



>ref|XP_007050895.1| HSP20-like chaperones superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX95052.1| HSP20-like chaperones superfamily protein isoform 3 [Theobroma 
cacao]
Length=183

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ SDK+FITV LPD+KN K  LEPEG F F+A AGADN  +E+  EL DK
Sbjct  1    MSRHPEVKWAQRSDKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R I  +++KAE  WW++LL+ +GK P ++KVDWDKWVDEDE++
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDEDEEN  115



>ref|XP_004290784.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X5 [Fragaria 
vesca subsp. vesca]
Length=241

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+F+TV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQREDKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK S   R I  +V+KAE  WWS+LLK +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKISIGVRSIVCIVEKAEKVWWSKLLKGDGKTPHYVKVDWDKWVDEDE  113



>gb|AES61800.2| CS domain protein [Medicago truncatula]
Length=183

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ +DK+++TV+LPD+KN K  L P+G   F+A AGA++  +E+   LFDK
Sbjct  1    MSRHPEVKWAQRADKVYVTVQLPDSKNAKVNLTPDGVLTFSATAGAEDHLYELKLPLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAED+WW RLLK EGKPP ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINVGVRGIFCVVQKAEDEWWKRLLKAEGKPPHYVKVDWDKWVDEDE  113



>ref|XP_011458724.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X6 [Fragaria 
vesca subsp. vesca]
Length=240

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+F+TV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQREDKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK S   R I  +V+KAE  WWS+LLK +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKISIGVRSIVCIVEKAEKVWWSKLLKGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_004290783.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=249

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+F+TV LPDAK+ K KLEPEG F F+A AGA +  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQREDKVFLTVLLPDAKDAKVKLEPEGTFIFSACAGAGDNQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VDV ESK S   R I  +V+KAE  WWSRLLK++G+ P ++K+DWDKWVDEDE
Sbjct  61   VDVEESKISIGVRSIVCIVEKAEKVWWSRLLKEQGRTPHYVKIDWDKWVDEDE  113



>ref|XP_011458723.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X4 [Fragaria 
vesca subsp. vesca]
Length=248

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+F+TV LPDAK+ K KLEPEG F F+A AGA +  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQREDKVFLTVLLPDAKDAKVKLEPEGTFIFSACAGAGDNQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            VDV ESK S   R I  +V+KAE  WWSRLLK++G+ P ++K+DWDKWVDEDE
Sbjct  61   VDVEESKISIGVRSIVCIVEKAEKVWWSRLLKEQGRTPHYVKIDWDKWVDEDE  113



>ref|NP_001241395.1| uncharacterized protein LOC100796372 [Glycine max]
 gb|ACU22871.1| unknown [Glycine max]
Length=200

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L D+KN K  L P+G F F+  AGA++  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQRLDKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R I  +V+KAED WW RLL+ EGKPP ++KVDWDKWVDEDE D
Sbjct  61   VNVEESKINVGVRSIFCVVQKAEDGWWKRLLRGEGKPPHYVKVDWDKWVDEDEDD  115



>ref|XP_006444305.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 ref|XP_006479938.1| PREDICTED: uncharacterized protein OsI_027940-like [Citrus sinensis]
 gb|ESR57545.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 gb|KDO87267.1| hypothetical protein CISIN_1g029750mg [Citrus sinensis]
Length=188

 Score =   144 bits (364),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSR P VKWAQ  DK+FITV+LPDAKN K  LEPEG F F+A AGA+N  +E+  ELFDK
Sbjct  1    MSRVPEVKWAQRQDKVFITVQLPDAKNAKVNLEPEGVFSFSASAGAENHLYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEKGWWKKLLRGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_011458722.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+F+TV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQREDKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK S   R I  +V+KAE  WWS+LLK +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKISIGVRSIVCIVEKAEKVWWSKLLKGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_006304541.1| hypothetical protein CARUB_v10011509mg, partial [Capsella rubella]
 gb|EOA37439.1| hypothetical protein CARUB_v10011509mg, partial [Capsella rubella]
Length=153

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +2

Query  134  FITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSRYIC  313
            ++T+ELPDA+ V  KLEP+GKF+F A +GA  TP+E+  +LFD VDVN ++   +SR IC
Sbjct  1    YVTLELPDAEEVNMKLEPQGKFFFYATSGASKTPYELELDLFDNVDVNVTR-RVSSRCIC  59

Query  314  YLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            Y+VKKAE KWW+RL+KQEGKPPV+LKVDWDKWVDED++D
Sbjct  60   YMVKKAESKWWNRLIKQEGKPPVYLKVDWDKWVDEDDED  98



>ref|XP_011458721.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=293

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+F+TV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQREDKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK S   R I  +V+KAE  WWS+LLK +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKISIGVRSIVCIVEKAEKVWWSKLLKGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_006444304.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 gb|ESR57544.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 gb|KDO87268.1| hypothetical protein CISIN_1g029750mg [Citrus sinensis]
Length=187

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSR P VKWAQ  DK+FITV+LPDAKN K  LEPEG F F+A AGA+N  +E+  ELFDK
Sbjct  1    MSRVPEVKWAQRQDKVFITVQLPDAKNAKVNLEPEGVFSFSASAGAENHLYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEKGWWKKLLRGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_007050896.1| HSP20-like chaperones superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX95053.1| HSP20-like chaperones superfamily protein isoform 4 [Theobroma 
cacao]
Length=183

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ SDK+FITV LPD+KN K  LEPEG F F+A AGADN  +E+  EL DK
Sbjct  1    MSRHPEVKWAQRSDKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R I  +++KAE  WW++LL+ +GK P ++KVDWDKWVDEDE++
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDEDEEN  115



>gb|KJB22493.1| hypothetical protein B456_004G052400 [Gossypium raimondii]
Length=189

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK++ITV LPD+KN K  LEPEG F  +A AGADN  +E+  +L+DK
Sbjct  1    MSRHPEVKWAERADKVYITVLLPDSKNAKVNLEPEGVFTLSANAGADNNLYELKLDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK S   R I  +++KAE  WW +LL+ EGK P ++KVDWDKWVDEDE +
Sbjct  61   VNVEESKISIGVRNIVCVLEKAEKVWWKKLLRSEGKAPHYIKVDWDKWVDEDEDN  115



>ref|XP_008451590.1| PREDICTED: uncharacterized protein OsI_027940 [Cucumis melo]
Length=202

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+FITV+LPD+K+ K  LEP+G F F+  AG++N  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQRLDKVFITVQLPDSKDSKVNLEPDGVFTFSGSAGSENHHYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R I  +++KAE  WW +LL+ +GKPP ++KVDWDKWVDEDE D
Sbjct  61   VNVEESKVNIGVRSIFCILEKAEKGWWKKLLRGDGKPPHYVKVDWDKWVDEDEDD  115



>ref|NP_001236771.1| uncharacterized protein LOC100499842 [Glycine max]
 gb|ACU13874.1| unknown [Glycine max]
Length=174

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L D+KN K  L P+G F F+  AGA++  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQRLDKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAED WW RLL+ EGK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINVGERSIFIVVQKAEDGWWKRLLRGEGKTPHYVKVDWDKWVDEDE  113



>ref|XP_004136034.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
 ref|XP_004160550.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
 gb|KGN44928.1| hypothetical protein Csa_7G396430 [Cucumis sativus]
Length=208

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+FITV+LPD+K+ K  LEP+G F F+  AG++N  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQRLDKVFITVQLPDSKDSKVNLEPDGVFTFSGSAGSENHHYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R I  +++KAE  WW +LL+ +GKPP ++KVDWDKWVDEDE D
Sbjct  61   VNVEESKVNIGVRSIFCILEKAEKGWWKKLLRGDGKPPHYVKVDWDKWVDEDEDD  115



>gb|KJB22494.1| hypothetical protein B456_004G052400 [Gossypium raimondii]
Length=169

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK++ITV LPD+KN K  LEPEG F  +A AGADN  +E+  +L+DK
Sbjct  1    MSRHPEVKWAERADKVYITVLLPDSKNAKVNLEPEGVFTLSANAGADNNLYELKLDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK S   R I  +++KAE  WW +LL+ EGK P ++KVDWDKWVDEDE +
Sbjct  61   VNVEESKISIGVRNIVCVLEKAEKVWWKKLLRSEGKAPHYIKVDWDKWVDEDEDN  115



>ref|XP_004495968.1| PREDICTED: uncharacterized protein OsI_027940-like [Cicer arietinum]
Length=186

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ +DK+++T++LPD+KN K  L P+G   F+A AGA+N  +E+   LFDK
Sbjct  1    MSRHPEVKWAQRADKVYVTIQLPDSKNAKVDLTPDGILTFSASAGAENHLYELQLPLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE +WW RLLK EGKPP ++KVDWDKW+DEDE
Sbjct  61   VNVEESKINVGVRGIFCVVQKAEIEWWKRLLKAEGKPPHYVKVDWDKWMDEDE  113



>gb|KHG16575.1| hypothetical protein F383_01113 [Gossypium arboreum]
Length=193

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ +DK+FITV LPD+KN K  LEPEG F F+A AG DN  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQRTDKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINVGVRSIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDE  113



>gb|KJB49925.1| hypothetical protein B456_008G146000 [Gossypium raimondii]
Length=209

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ +DK+FITV LPD+KN K  LEPEG F F+A AG DN  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQRTDKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDE  113



>gb|KJB49923.1| hypothetical protein B456_008G146000 [Gossypium raimondii]
Length=208

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ +DK+FITV LPD+KN K  LEPEG F F+A AG DN  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQRTDKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDE  113



>gb|KJB49924.1| hypothetical protein B456_008G146000 [Gossypium raimondii]
Length=206

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ +DK+FITV LPD+KN K  LEPEG F F+A AG DN  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQRTDKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDE  113



>ref|XP_003591549.1| hypothetical protein MTR_1g088700 [Medicago truncatula]
Length=222

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +2

Query  89   SRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKV  268
            SRHP VKWAQ +DK+++TV+LPD+KN K  L P+G   F+A AGA++  +E+   LFDKV
Sbjct  41   SRHPEVKWAQRADKVYVTVQLPDSKNAKVNLTPDGVLTFSATAGAEDHLYELKLPLFDKV  100

Query  269  DVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            +V ESK +   R I  +V+KAED+WW RLLK EGKPP ++KVDWDKWVDEDE
Sbjct  101  NVEESKINVGVRGIFCVVQKAEDEWWKRLLKAEGKPPHYVKVDWDKWVDEDE  152



>ref|XP_009342102.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Pyrus x bretschneideri]
Length=193

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP +KWAQ  DK+FITV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPELKWAQRVDKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE  WW++LL+ +GK P ++KVDWDKWVDED+
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEPAWWNKLLRGDGKMPHYVKVDWDKWVDEDD  113



>ref|XP_010652179.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Vitis 
vinifera]
Length=177

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ +DK+FITV LPDAKN K  LEP+G F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQRADKVFITVLLPDAKNAKVNLEPDGDFTFSASAGAENHLYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE  WW +LL+ + K P +LKVDWDKWVDEDE
Sbjct  61   VNVEESKINIGVRSIFCVVEKAEKGWWKKLLRGDEKAPHYLKVDWDKWVDEDE  113



>ref|XP_009342103.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Pyrus x bretschneideri]
Length=192

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP +KWAQ  DK+FITV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPELKWAQRVDKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE  WW++LL+ +GK P ++KVDWDKWVDED+
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEPAWWNKLLRGDGKMPHYVKVDWDKWVDEDD  113



>ref|XP_002264898.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Vitis 
vinifera]
Length=178

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ +DK+FITV LPDAKN K  LEP+G F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQRADKVFITVLLPDAKNAKVNLEPDGDFTFSASAGAENHLYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE  WW +LL+ + K P +LKVDWDKWVDEDE
Sbjct  61   VNVEESKINIGVRSIFCVVEKAEKGWWKKLLRGDEKAPHYLKVDWDKWVDEDE  113



>gb|ADE76546.1| unknown [Picea sitchensis]
Length=204

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ SDKL+IT+ELPDA N K+KLEP+GKF F+A  G + T +E+ F L+D+
Sbjct  1    MSRHPEVKWAQRSDKLYITIELPDANNPKWKLEPDGKFTFSATTGQEKTFYELDFYLYDR  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK S   R I  ++KK + KWW +LLK E K   FLKVDWDKWVDEDE+
Sbjct  61   VNVEESKISVNLRNIICILKKEDKKWWKQLLKTEAKRLPFLKVDWDKWVDEDEE  114



>ref|XP_008386666.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Malus 
domestica]
Length=191

 Score =   141 bits (356),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+F+TV LPDAK+ K KLEP+G F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQRVDKVFLTVLLPDAKDAKVKLEPDGTFSFSASAGAENHQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE +WW +LL+ +GK P ++KVDWDKWVDED+
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEPEWWPKLLRGDGKTPHYVKVDWDKWVDEDD  113



>ref|XP_008386667.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Malus 
domestica]
Length=190

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+F+TV LPDAK+ K KLEP+G F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQRVDKVFLTVLLPDAKDAKVKLEPDGTFSFSASAGAENHQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE +WW +LL+ +GK P ++KVDWDKWVDED+
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEPEWWPKLLRGDGKTPHYVKVDWDKWVDEDD  113



>gb|ADE76981.1| unknown [Picea sitchensis]
Length=207

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ SDKL+IT+ELPDA N K+KLEP+GKF F+A  G + T +E+ F L+D+
Sbjct  1    MSRHPEVKWAQRSDKLYITIELPDANNPKWKLEPDGKFTFSATTGQEKTFYELDFYLYDR  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK S   R I  ++KK + KWW +LLK E K   FLKVDWDKWVDEDE+
Sbjct  61   VNVEESKISVNLRNIICILKKEDKKWWKQLLKTEAKRLPFLKVDWDKWVDEDEE  114



>emb|CBI36840.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +2

Query  80   DTMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELF  259
            + MSRHP VKWAQ +DK+FITV LPDAKN K  LEP+G F F+A AGA+N  +E+  +LF
Sbjct  34   ENMSRHPEVKWAQRADKVFITVLLPDAKNAKVNLEPDGDFTFSASAGAENHLYELKLDLF  93

Query  260  DKVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            DKV+V ESK +   R I  +V+KAE  WW +LL+ + K P +LKVDWDKWVDEDE
Sbjct  94   DKVNVEESKINIGVRSIFCVVEKAEKGWWKKLLRGDEKAPHYLKVDWDKWVDEDE  148



>ref|XP_006840547.1| hypothetical protein AMTR_s00045p00215950 [Amborella trichopoda]
 gb|ERN02222.1| hypothetical protein AMTR_s00045p00215950 [Amborella trichopoda]
Length=225

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV LPDAKNVK  L+PEG F F+A AG D  P+E+  +LF K
Sbjct  1    MSRHPEVKWAQRLDKVYITVSLPDAKNVKTNLDPEGIFTFSANAGTDGNPYELKLDLFGK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+  ESK +   R I  +V+KAE+ WW +LL+ + K P +LKVDWDKWVDEDE D
Sbjct  61   VNAEESKINVGVRNIFCIVEKAEEGWWKKLLRGDEKTPHYLKVDWDKWVDEDEDD  115



>ref|XP_008235058.1| PREDICTED: uncharacterized protein OsI_027940 [Prunus mume]
Length=183

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+FITV LPDAK+ K KLEP+G F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQRVDKVFITVLLPDAKDAKVKLEPDGVFSFSASAGAENHHYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINVGVRSIFCILEKAEKVWWKKLLRGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_007201343.1| hypothetical protein PRUPE_ppa011992mg [Prunus persica]
 gb|EMJ02542.1| hypothetical protein PRUPE_ppa011992mg [Prunus persica]
Length=188

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+FITV LPDAK+ K KLEP+G F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPEVKWAQRVDKVFITVLLPDAKDAKVKLEPDGVFSFSASAGAENHHYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINVGVRSIFCILEKAEKVWWKKLLRGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_010038204.1| PREDICTED: uncharacterized protein Os08g0359500 [Eucalyptus grandis]
Length=209

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            M+RHP +KWAQ  DK+F+TV LPDAK+ K  LEP+G F F+A+AGA+N P+E+  ELFDK
Sbjct  1    MNRHPELKWAQRKDKVFLTVLLPDAKDAKVNLEPDGIFTFSAKAGAENHPYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE +WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINIGVRNIFCILEKAEKEWWKKLLRGDGKLPHYVKVDWDKWVDEDE  113



>ref|XP_010684508.1| PREDICTED: uncharacterized protein OsI_027940 [Beta vulgaris 
subsp. vulgaris]
Length=194

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+  DK+++TV LPDAKN K  L PEG F F A  GA +  +E+  +LFDK
Sbjct  1    MSRHPEVKWAEREDKVYLTVMLPDAKNPKVNLGPEGTFTFTATGGAGDHVYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK S   R I  +++KAE KWW+RLL+ EGKPP ++K+DWDKW DEDE
Sbjct  61   VNVEESKISYGVRSIFCVLEKAEQKWWNRLLRGEGKPPHYVKIDWDKWADEDE  113



>ref|XP_009342150.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Pyrus x bretschneideri]
Length=200

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP +KWAQ  DK+FITV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPELKWAQRVDKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE  WW++LL  +GK P ++KVDWDKWVDED+
Sbjct  61   VNVEESKINVGMRSIFCIVEKAEPAWWNKLLCGDGKMPHYVKVDWDKWVDEDD  113



>ref|XP_009342151.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Pyrus x bretschneideri]
Length=199

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP +KWAQ  DK+FITV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDK
Sbjct  1    MSRHPELKWAQRVDKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE  WW++LL  +GK P ++KVDWDKWVDED+
Sbjct  61   VNVEESKINVGMRSIFCIVEKAEPAWWNKLLCGDGKMPHYVKVDWDKWVDEDD  113



>ref|XP_007050894.1| HSP20-like chaperones superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX95051.1| HSP20-like chaperones superfamily protein isoform 2 [Theobroma 
cacao]
Length=188

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 88/123 (72%), Gaps = 8/123 (7%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ SDK+FITV LPD+KN K  LEPEG F F+A AGADN  +E+  EL DK
Sbjct  1    MSRHPEVKWAQRSDKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDK  60

Query  266  VDV--------NESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED  421
            V+V         ESK +   R I  +++KAE  WW++LL+ +GK P ++KVDWDKWVDED
Sbjct  61   VNVEFLFFFGKKESKINIGVRSIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDED  120

Query  422  EQD  430
            E++
Sbjct  121  EEN  123



>gb|KHN20406.1| Hypothetical protein glysoja_039704 [Glycine soja]
Length=269

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +2

Query  89   SRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKV  268
            SRHP VKWAQ  DK++ITV+L D+KN K  L P+G F F+  AGA++  +E+  ELFDKV
Sbjct  50   SRHPEVKWAQRLDKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDKV  109

Query  269  DVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            +V ESK +   R I  +V+KAED WW RLL+ EGK P ++KVDWDKWVDEDE
Sbjct  110  NVEESKINVGERSIFIVVQKAEDGWWKRLLRGEGKTPHYVKVDWDKWVDEDE  161



>emb|CDX89935.1| BnaA10g01470D [Brassica napus]
Length=251

 Score =   137 bits (346),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +2

Query  83   TMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFD  262
            TMS HP VKWA+  DK+++TV LPDAK+   KL+PEG F F+A+AG +N  +E+  EL D
Sbjct  18   TMSHHPEVKWAEREDKVYLTVLLPDAKDANVKLDPEGVFEFSAKAGPENQVYELKLELSD  77

Query  263  KVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            KV+V ESK +   R I  +V+KAE KWWS+LL+  GKPP ++KVDWDKWVDEDE
Sbjct  78   KVNVEESKINIGLRSIFCIVEKAEPKWWSKLLRVGGKPPHYVKVDWDKWVDEDE  131



>ref|XP_006659323.1| PREDICTED: uncharacterized protein Os08g0359500-like [Oryza brachyantha]
Length=204

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L DAKN K  LEPEG F F+A AG D   +E   EL DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLADAKNAKVNLEPEGVFSFSATAGTDGNLYESKLELNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK S   R I  +V+KAE KWW +L++ + K P F+KVDWDKWVDED+
Sbjct  61   VNVEESKISVGVRSIFCIVEKAEAKWWKKLVRDDQKAPHFVKVDWDKWVDEDD  113



>ref|XP_001768873.1| predicted protein [Physcomitrella patens]
 gb|EDQ66227.1| predicted protein, partial [Physcomitrella patens]
Length=114

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP + WAQ SDK+F+TVEL DAK+ + KLEPEG+F F+A  GA++  FE   +LF  
Sbjct  1    MSRHPEILWAQRSDKVFLTVELLDAKHPEVKLEPEGRFTFSATVGANDLKFETDLQLFGA  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            +DV +S  +   R+   ++ K E  WWSRLLK EGK P F+KVDW+KWVDEDE+
Sbjct  61   IDVEKSVVNKGQRHTTLVLVKKEAGWWSRLLKAEGKAPQFVKVDWNKWVDEDEE  114



>ref|XP_003573778.1| PREDICTED: uncharacterized protein Os08g0359500 [Brachypodium 
distachyon]
Length=234

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+ K  LEP+G F F+A AG+D   +E   +L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFSFSATAGSDGNIYESKLDLNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK S   R I  +V+KAE KWW++L++ + K P F+KVDWDKWVDED+
Sbjct  61   VNVEESKTSVGPRSIFCIVEKAEAKWWNKLVRDDQKAPHFVKVDWDKWVDEDD  113



>sp|P0C8Z0.2|Y8359_ORYSI RecName: Full=Uncharacterized protein OsI_027940 [Oryza sativa 
Indica Group]
Length=210

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L DAK+ K  LEPEG F F+A AG D   +E   EL DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLADAKDAKVNLEPEGVFSFSATAGTDGNLYESKLELNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK S   R I  +V+KAE KWW +L++ + K P F+KVDWDKWVDED+
Sbjct  61   VNVEESKISVGVRSIFCIVEKAEAKWWKKLVRDDQKAPHFVKVDWDKWVDEDD  113



>ref|NP_001061631.1| Os08g0359500 [Oryza sativa Japonica Group]
 sp|Q6YYB0.1|Y8359_ORYSJ RecName: Full=Uncharacterized protein Os08g0359500 [Oryza sativa 
Japonica Group]
 dbj|BAD03784.1| putative p23 co-chaperone [Oryza sativa Japonica Group]
 dbj|BAD03808.1| putative p23 co-chaperone [Oryza sativa Japonica Group]
 dbj|BAF23545.1| Os08g0359500 [Oryza sativa Japonica Group]
 gb|EAZ42474.1| hypothetical protein OsJ_27041 [Oryza sativa Japonica Group]
 dbj|BAG96959.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99524.1| unnamed protein product [Oryza sativa Japonica Group]
Length=213

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L DAK+ K  LEPEG F F+A AG D   +E   EL DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLADAKDAKVNLEPEGVFSFSATAGTDGNLYESKLELNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK S   R I  +V+KAE KWW +L++ + K P F+KVDWDKWVDED+
Sbjct  61   VNVEESKISVGVRSIFCIVEKAEAKWWKKLVRDDQKAPHFVKVDWDKWVDEDD  113



>gb|KHN43515.1| Hypothetical protein glysoja_002098 [Glycine soja]
Length=738

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP VKWAQ  DK++ITV+L D+KN K  L P+G F F+  AGA++  +E+  ELFDKV+
Sbjct  42   RHPEVKWAQRLDKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDKVN  101

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V ESK +   R I  +V+KAED WW RLL+ EGKPP ++KVDWDKWVDEDE D
Sbjct  102  VEESKINVGVRSIFCVVQKAEDGWWKRLLRGEGKPPHYVKVDWDKWVDEDEDD  154



>gb|EEC83453.1| hypothetical protein OsI_28951 [Oryza sativa Indica Group]
Length=274

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L DAK+ K  LEPEG F F+A AG D   +E   EL DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLADAKDAKVNLEPEGVFSFSATAGTDGNLYESKLELNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK S   R I  +V+KAE KWW +L++ + K P F+KVDWDKWVDED+
Sbjct  61   VNVEESKISVGVRSIFCIVEKAEAKWWKKLVRDDQKAPHFVKVDWDKWVDEDD  113



>ref|XP_010481284.1| PREDICTED: uncharacterized protein OsI_027940-like [Camelina 
sativa]
 ref|XP_010481293.1| PREDICTED: uncharacterized protein OsI_027940-like [Camelina 
sativa]
Length=202

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWA+ +DK+++TV+L DAK+   KL+PEG F F+A+AG+DN  FE+  EL DK
Sbjct  1    MSHHPEVKWAERADKVYLTVQLTDAKDADVKLDPEGVFNFSAKAGSDNQLFELKLELNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE KWW++LL+  GKPP ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINIGLRSIFCILEKAEPKWWNKLLRG-GKPPHYVKVDWDKWVDEDE  112



>emb|CDP03502.1| unnamed protein product [Coffea canephora]
Length=286

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 90/129 (70%), Gaps = 2/129 (2%)
 Frame = +2

Query  38   LRSTSVYLEEAAVADTMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEA  217
            + S S +L++  +   MSRHP VKWAQ  DK+++TV LPDAKN K  L+P+G F F+  A
Sbjct  60   ILSLSSFLQKQNI--NMSRHPEVKWAQRLDKVYLTVLLPDAKNAKVNLDPDGVFTFSGTA  117

Query  218  GADNTPFEVSFELFDKVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVD  397
            GA+N  +E+  EL DKVDV ESK +   R I  +++KAE  WW +LL+ +GK P ++KVD
Sbjct  118  GAENHLYELKLELHDKVDVEESKINIGVRNIFCVLEKAEKNWWKKLLRGDGKAPHYIKVD  177

Query  398  WDKWVDEDE  424
            WDKW DED+
Sbjct  178  WDKWADEDD  186



>ref|XP_009799463.1| PREDICTED: uncharacterized protein OsI_027940 [Nicotiana sylvestris]
Length=194

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  D +++TV+LPDAKN K  L+PEG F F+A AG ++  +E+  ELFDK
Sbjct  1    MSRHPQVKWAQRPDVVYLTVQLPDAKNPKVNLDPEGIFTFSATAGPESYAYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            V+V ESK +   R I  +++K+E KWW++LL+ + K P ++KVDWDKWVDED+ +E
Sbjct  61   VNVEESKINIGVRNIFCVLEKSEKKWWNKLLRGDEKAPHYVKVDWDKWVDEDDDNE  116



>ref|XP_009414713.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=180

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDA++VK  LEP+G F F+A AGA N  +E+  +L+DK
Sbjct  1    MSRHPEVKWAQRLDKVYITVQLPDARDVKVNLEPDGSFTFSATAGAGNNTYELQMDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            V+   SK +   R I  +V+KAE  WW +LL+ +GK P ++KVDWDKWV
Sbjct  61   VNKEASKINIGVRSIFCVVEKAEKGWWKKLLRGDGKAPHYVKVDWDKWV  109



>gb|AFX67021.1| putative p23 co-chaperone [Solanum tuberosum]
Length=227

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWAQ  D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DK
Sbjct  1    MSLHPEVKWAQRPDVVYLTVMLPDAKDAKVNLDPEGVFNFSASAGAGDRHYELKLELQDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK ST  R I  +++KAE KWW++LL+ +GK P ++KVDWDKWVDED++
Sbjct  61   VNVEESKISTGVRSIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDE  114



>ref|XP_009385408.1| PREDICTED: uncharacterized protein OsI_027940-like [Musa acuminata 
subsp. malaccensis]
Length=159

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VK AQ  DK++ITV+LPDAK+ K  LEP+G F F+A AGA N+ +E+  +L+DK
Sbjct  1    MSRHPEVKLAQRLDKIYITVQLPDAKDAKVNLEPDGIFTFSATAGAGNSTYELKMDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED  421
            V+   SK +   R I  +V+KAE  WW +LL+ +GK P ++KVDWDKWVDED
Sbjct  61   VNKEASKINVGVRSIFCVVEKAEKGWWKKLLRGDGKAPHYVKVDWDKWVDED  112



>ref|XP_009414711.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=181

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDA++VK  LEP+G F F+A AGA N  +E+  +L+DK
Sbjct  1    MSRHPEVKWAQRLDKVYITVQLPDARDVKVNLEPDGSFTFSATAGAGNNTYELQMDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            V+   SK +   R I  +V+KAE  WW +LL+ +GK P ++KVDWDKWV
Sbjct  61   VNKEASKINIGVRSIFCVVEKAEKGWWKKLLRGDGKAPHYVKVDWDKWV  109



>ref|XP_004494372.1| PREDICTED: uncharacterized protein Os08g0359500-like [Cicer arietinum]
Length=215

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L D+K+ K  L P+G F F+  AGA +  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQRVDKVYITVQLADSKDAKVDLAPDGTFTFSGSAGAGDNQYELKMELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            V+V ESK +   R I  +V+KAE+ WW RLL+ EGKPP ++KVDWDKW 
Sbjct  61   VNVEESKINVGVRSIFCVVQKAENGWWKRLLRGEGKPPHYVKVDWDKWA  109



>gb|AFX66984.1| putative p23 co-chaperone [Solanum tuberosum]
Length=256

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWAQ  D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DK
Sbjct  1    MSLHPEVKWAQRPDVVYLTVMLPDAKDAKVNLDPEGVFNFSASAGAGDRHYELKLELQDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK ST  R I  +++KAE KWW++LL+ +GK P ++KVDWDKWVDED++
Sbjct  61   VNVEESKISTGVRSIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDE  114



>gb|KEH24379.1| CS domain protein [Medicago truncatula]
Length=209

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            V+V ESK S   R I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  108



>ref|XP_009386345.1| PREDICTED: uncharacterized protein OsI_027940-like [Musa acuminata 
subsp. malaccensis]
Length=178

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSR+P VKWAQ  DK++ITV+LPDAK+VK  LEP+G F F+A AG  N  +E+  +L+DK
Sbjct  1    MSRYPEVKWAQRLDKVYITVQLPDAKDVKVNLEPDGIFTFSATAGTGNNTYELKMDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            VD + SK +   R I  +V KAE +WW +LL+ +GK P +LKVDWDKWV
Sbjct  61   VDKDASKINIGVRSIFVVVAKAEKQWWKKLLRGDGKAPHYLKVDWDKWV  109



>emb|CDY15271.1| BnaC05g01500D [Brassica napus]
Length=282

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +2

Query  83   TMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFD  262
            TMS HP VKWA+  DK+++TV LPDAK+   KL+PEG F F+A+AG +N  +E+  EL D
Sbjct  55   TMSHHPEVKWAEREDKVYLTVLLPDAKDADVKLDPEGVFEFSAKAGPENQVYELKLELND  114

Query  263  KVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            KV+V ESK +   R I  +V+KAE +WWS+LL+  GKPP ++KVDWDKWVDEDE
Sbjct  115  KVNVEESKINIGLRSIFCIVEKAEPRWWSKLLRG-GKPPHYVKVDWDKWVDEDE  167



>ref|XP_010269540.1| PREDICTED: uncharacterized protein OsI_027940 [Nelumbo nucifera]
Length=177

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV LPDAKN K  LEP+G F F+A AGA+N  +E    L DK
Sbjct  1    MSRHPEVKWAERADKVFLTVLLPDAKNPKVNLEPDGAFTFSAIAGAENHLYEFKINLHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE  WW +LLK + K P ++KVDWDKWVDED+
Sbjct  61   VNVEESKINMGVRSIFCIIEKAEQGWWKKLLKGDEKTPHYVKVDWDKWVDEDD  113



>gb|AFK43198.1| unknown [Medicago truncatula]
 gb|KEH19404.1| CS domain protein [Medicago truncatula]
 gb|AES82146.2| CS domain protein [Medicago truncatula]
Length=234

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            V+V ESK S   R I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  108



>ref|XP_006418294.1| hypothetical protein EUTSA_v10008755mg [Eutrema salsugineum]
 gb|ESQ36647.1| hypothetical protein EUTSA_v10008755mg [Eutrema salsugineum]
Length=215

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWA+ +DK+F+TV LPDAK+   KL+PEG F F+A+AG +N  +E+  EL DK
Sbjct  1    MSHHPEVKWAERADKVFLTVLLPDAKDADVKLDPEGVFNFSAKAGPENQLYELKLELNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE KWW++LL+  GKPP ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINIGLRSIFCILEKAEPKWWNKLLRG-GKPPHYVKVDWDKWVDEDE  112



>ref|XP_006359384.1| PREDICTED: uncharacterized protein Os08g0359500-like [Solanum 
tuberosum]
Length=230

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWAQ  D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DK
Sbjct  1    MSLHPEVKWAQRPDVVYLTVMLPDAKDPKVNLDPEGVFNFSASAGAGDRHYELKLELQDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK ST  R I  +++KAE KWW++LL+ +GK P ++KVDWDKWVDED++
Sbjct  61   VNVEESKISTGVRSIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDE  114



>ref|XP_008775907.1| PREDICTED: uncharacterized protein OsI_027940-like [Phoenix dactylifera]
Length=181

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++IT++LPDAK+ K  LEP+G F F+A AGA+   +E+  +L+DK
Sbjct  1    MSRHPEVKWAQRVDKVYITIQLPDAKDAKVNLEPDGIFSFSATAGAEKNLYELKMDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK +T  R I  +V+K E  WW +LL+ + K P ++KVDWDKWVDED+
Sbjct  61   VNVEGSKINTGVRSIFCVVEKVEKGWWKKLLRGDEKTPHYVKVDWDKWVDEDD  113



>ref|XP_010474870.1| PREDICTED: uncharacterized protein OsI_027940-like [Camelina 
sativa]
Length=217

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWA+ +DK+++TV+L DAK+   KL+PEG F F+A+AG+DN  +E+  EL DK
Sbjct  1    MSHHPEVKWAERADKVYLTVQLTDAKDADVKLDPEGVFNFSAKAGSDNQLYELKLELNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++K E KWW++LL+  GKPP ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINIGLRSIFCILEKTEPKWWNKLLRG-GKPPHYVKVDWDKWVDEDE  112



>gb|KEH24381.1| CS domain protein [Medicago truncatula]
Length=213

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            V+V ESK S   R I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  108



>ref|XP_002964192.1| hypothetical protein SELMODRAFT_81672, partial [Selaginella moellendorffii]
 gb|EFJ34525.1| hypothetical protein SELMODRAFT_81672, partial [Selaginella moellendorffii]
Length=135

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 1/112 (1%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP + WAQ SDKLF+TVELPDA +   +L+P+G+F F A A AD+ P+E S EL+  V 
Sbjct  1    RHPEIVWAQRSDKLFLTVELPDAVDPSVELQPDGRFVFRA-AAADSAPYEASLELYGSVS  59

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V ESK +  SR+   ++ K E  WW RLLK EGK P ++KVDW+KW+DEDE+
Sbjct  60   VEESKVNVGSRHTLCIIHKQEQGWWKRLLKSEGKMPPYVKVDWNKWIDEDEE  111



>ref|XP_009769849.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Nicotiana sylvestris]
Length=187

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWAQ  D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DK
Sbjct  1    MSLHPQVKWAQRPDVVYLTVLLPDAKDSKVNLDPEGVFTFSATAGAGDRHYELKLELLDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK S   R I  +++KAE KWW++LL+ + K P ++KVDWDKWVDED++
Sbjct  61   VNVEESKISIGVRSIVCVLQKAEPKWWNKLLRGDAKTPHYVKVDWDKWVDEDDE  114



>ref|XP_009119603.1| PREDICTED: uncharacterized protein Os08g0359500-like [Brassica 
rapa]
Length=230

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWA+  DK+++TV LPDAK+   KL+PEG F F+A+AG +N  +E+  EL DK
Sbjct  1    MSHHPEVKWAEREDKVYLTVLLPDAKDADVKLDPEGVFEFSAKAGPENQVYELKLELNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +V+KAE KWW +LL   GKPP ++KVDWDKWVDEDE
Sbjct  61   VNVEESKINIGLRSIFCIVEKAEPKWWGKLLCVGGKPPHYVKVDWDKWVDEDE  113



>ref|XP_009586785.1| PREDICTED: uncharacterized protein OsI_027940-like [Nicotiana 
tomentosiformis]
Length=193

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  D +++TV+LPDAK+ K  L+PEG F F+A AG ++  +E+  ELFDK
Sbjct  1    MSRHPQVKWAQRPDVVYLTVQLPDAKSSKVNLDPEGIFTFSATAGPESHAYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            ++V ESK +   R I  +++K+E KWW++LL+ + K P ++KVDWDKWVDED+ ++
Sbjct  61   INVEESKINIGVRNIFCVLEKSEKKWWNKLLRGDEKAPHYVKVDWDKWVDEDDDND  116



>ref|XP_010922352.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Elaeis guineensis]
Length=181

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+VK  LE +G F F+A AGA+   +E+  +L+DK
Sbjct  1    MSRHPEVKWAQRVDKVYITVQLPDAKDVKVNLESDGIFTFSATAGAEKNLYELKMDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK +T  R I  +V+K E  WW +LL+ + K P ++KVDWDKWVDED+
Sbjct  61   VNVEGSKINTGVRSIFCMVEKVEKVWWKKLLRGDEKTPHYVKVDWDKWVDEDD  113



>dbj|BAJ94677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=224

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V+WAQ  DK++ITV+LPDAK+ K  LEP+G F F A AG D   +E   +L DK
Sbjct  1    MSRHPEVRWAQRIDKVYITVQLPDAKDAKVNLEPDGVFSFFATAGTDGNSYESKLDLNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK S   R I  +++KAE KWW++L++ + K P F+KVDWDKWVDED+
Sbjct  61   VNVEASKVSVGVRSIFCILEKAEAKWWNKLVRDDQKAPHFVKVDWDKWVDEDD  113



>ref|XP_010522788.1| PREDICTED: uncharacterized protein OsI_027940 [Tarenaya hassleriana]
Length=204

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV+LPD+K+ K  L+PEG F F+A AG +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAERTDKIFLTVQLPDSKDAKVNLDPEGVFTFSANAGPENHLYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V  SK +   R I  +++KAE K W +LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  61   VNVEASKINIGVRNIFCILEKAEPKRWDKLLRG-GKPPHYVKVDWDKWVDEDEE  113



>ref|XP_002988870.1| hypothetical protein SELMODRAFT_128863, partial [Selaginella 
moellendorffii]
 gb|EFJ10132.1| hypothetical protein SELMODRAFT_128863, partial [Selaginella 
moellendorffii]
Length=144

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 1/112 (1%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP + WAQ SDKLF+TVELPDA +   +L+P+G+F F A A AD+ P+E S EL+  V 
Sbjct  1    RHPEIVWAQRSDKLFLTVELPDAVDPSVELQPDGRFVFRA-AAADSAPYEASLELYGSVS  59

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V ESK +  SR+   ++ K E  WW RLLK EGK P ++KVDW+KW+DEDE+
Sbjct  60   VEESKVNVGSRHTLCIIHKQEQGWWKRLLKSEGKMPPYVKVDWNKWIDEDEE  111



>ref|XP_004247428.1| PREDICTED: uncharacterized protein OsI_027940 [Solanum lycopersicum]
Length=225

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWAQ  D +++TV LPDAK+ K  L+PEG F F+A AG  +  +E+  EL D+
Sbjct  1    MSLHPEVKWAQRPDVVYLTVMLPDAKDAKVNLDPEGVFNFSASAGTGDRHYELKLELQDQ  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK ST  R I  +++KAE KWW++LL+ +GK P ++KVDWDKWVDED++
Sbjct  61   VNVEESKISTGVRSIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDE  114



>ref|XP_009769848.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Nicotiana sylvestris]
Length=223

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWAQ  D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DK
Sbjct  1    MSLHPQVKWAQRPDVVYLTVLLPDAKDSKVNLDPEGVFTFSATAGAGDRHYELKLELLDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK S   R I  +++KAE KWW++LL+ + K P ++KVDWDKWVDED++
Sbjct  61   VNVEESKISIGVRSIVCVLQKAEPKWWNKLLRGDAKTPHYVKVDWDKWVDEDDE  114



>ref|XP_010556743.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Tarenaya hassleriana]
Length=206

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV+L D+KN K  L+PEG F F+A AG +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAELTDKVFLTVQLADSKNTKVNLDPEGVFTFSANAGPENHVYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V  SK +   R I  +++KAE K W +LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  61   VNVEPSKINIGVRNIFCILEKAEPKRWEKLLRG-GKPPHYVKVDWDKWVDEDEE  113



>ref|XP_010556742.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Tarenaya hassleriana]
Length=224

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV+L D+KN K  L+PEG F F+A AG +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAELTDKVFLTVQLADSKNTKVNLDPEGVFTFSANAGPENHVYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V  SK +   R I  +++KAE K W +LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  61   VNVEPSKINIGVRNIFCILEKAEPKRWEKLLRG-GKPPHYVKVDWDKWVDEDEE  113



>ref|XP_002992410.1| hypothetical protein SELMODRAFT_186712 [Selaginella moellendorffii]
 gb|EFJ06560.1| hypothetical protein SELMODRAFT_186712 [Selaginella moellendorffii]
Length=184

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP + WAQ S+++F+T+ELPDAK+   K+EP+GK  F+A AGA +  +EV  ELF +++
Sbjct  2    RHPEIVWAQHSERVFLTIELPDAKSPVVKIEPQGKLKFSATAGASDEKYEVELELFKEIN  61

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVD  415
            V  SK ST +R I  +++KAE  WW RL+K EG+ P +LKVDW+KWVD
Sbjct  62   VEASKISTGARQIFVVIEKAEKMWWPRLIKSEGRAPPYLKVDWNKWVD  109



>gb|EMS68218.1| hypothetical protein TRIUR3_30845 [Triticum urartu]
Length=230

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V+WAQ  DK++ITV+LPDAK+ K  LEP+G F F A AG D   +E   +L DK
Sbjct  1    MSRHPEVRWAQRIDKVYITVQLPDAKDAKVNLEPDGVFSFFATAGTDGNSYESKLDLNDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK S   R I  +++KA+ KWW++L++ + K P F+KVDWDKWVDED+
Sbjct  61   VNVEASKVSVGVRSIFCILEKADAKWWNKLVRDDQKAPHFVKVDWDKWVDEDD  113



>ref|XP_011082475.1| PREDICTED: uncharacterized protein OsI_027940-like [Sesamum indicum]
Length=196

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+  DK+++TV LPDAKN K  ++PEG F F+A AG DN  +E+  +L +K
Sbjct  1    MSRHPEVKWAEREDKVYLTVLLPDAKNAKVNVDPEGTFTFSATAGTDNNLYELKLDLLEK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V E K +   R I  +++KAE KWW +LL+   K P ++KVDWDKWVDED+
Sbjct  61   VNVEECKINIGVRNIFCVLEKAEKKWWEKLLRGNEKAPHYVKVDWDKWVDEDD  113



>ref|XP_009598042.1| PREDICTED: uncharacterized protein OsI_027940 isoform X3 [Nicotiana 
tomentosiformis]
Length=187

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWAQ  D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DK
Sbjct  1    MSLHPQVKWAQRPDVVYLTVLLPDAKDPKVNLDPEGIFTFSATAGAGDRHYELKLELQDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK S   R I  +++KAE KWW++LL+ + K P ++KVDWDKWVDED++
Sbjct  61   VNVEESKISIGVRSIVCVLQKAEPKWWNKLLRGDAKAPHYVKVDWDKWVDEDDE  114



>ref|XP_003625928.1| RING finger protein 113A [Medicago truncatula]
Length=394

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            V+V ESK S   R I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  108



>ref|XP_009598041.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Nicotiana 
tomentosiformis]
Length=198

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWAQ  D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DK
Sbjct  1    MSLHPQVKWAQRPDVVYLTVLLPDAKDPKVNLDPEGIFTFSATAGAGDRHYELKLELQDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK S   R I  +++KAE KWW++LL+ + K P ++KVDWDKWVDED++
Sbjct  61   VNVEESKISIGVRSIVCVLQKAEPKWWNKLLRGDAKAPHYVKVDWDKWVDEDDE  114



>ref|XP_002968013.1| hypothetical protein SELMODRAFT_145227 [Selaginella moellendorffii]
 gb|EFJ31360.1| hypothetical protein SELMODRAFT_145227 [Selaginella moellendorffii]
Length=183

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP + WAQ S+++F+T+ELPDAK+   K+EP+GK  F+A AGA +  +EV  ELF +++
Sbjct  2    RHPEIVWAQHSERVFLTIELPDAKSPVVKIEPQGKLKFSATAGASDEKYEVELELFKEIN  61

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVD  415
            V  SK ST +R I  +++KAE  WW RL+K EG+ P +LKVDW+KWVD
Sbjct  62   VEASKISTGARQIFVVIEKAEKMWWPRLIKGEGRAPPYLKVDWNKWVD  109



>ref|XP_003628460.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
Length=358

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            V+V ESK S   R I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  108



>ref|XP_007163102.1| hypothetical protein PHAVU_001G206400g [Phaseolus vulgaris]
 gb|ESW35096.1| hypothetical protein PHAVU_001G206400g [Phaseolus vulgaris]
Length=186

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+F+TV+L D+KN K  L PEG F F+  AG+++  +E+  ELF+K
Sbjct  1    MSRHPEVKWAQRVDKVFVTVQLADSKNAKVDLTPEGVFTFSGSAGSEDHQYELKLELFEK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            V+V ESK +   R I  +V+KAE  WW R L+ EGK P ++KVDWDKWV
Sbjct  61   VNVEESKINVGVRSIFCVVQKAEIGWWKRFLRAEGKTPHYVKVDWDKWV  109



>gb|ACJ83262.1| unknown [Medicago truncatula]
Length=217

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            V+V ESK S   R I  +V+KAE  WW RLL+ EGK P ++K+ WDKW
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHYVKIVWDKW  108



>ref|XP_009598040.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Nicotiana 
tomentosiformis]
Length=229

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MS HP VKWAQ  D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DK
Sbjct  1    MSLHPQVKWAQRPDVVYLTVLLPDAKDPKVNLDPEGIFTFSATAGAGDRHYELKLELQDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK S   R I  +++KAE KWW++LL+ + K P ++KVDWDKWVDED++
Sbjct  61   VNVEESKISIGVRSIVCVLQKAEPKWWNKLLRGDAKAPHYVKVDWDKWVDEDDE  114



>gb|KEH24380.1| CS domain protein [Medicago truncatula]
Length=242

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP VKWAQ  DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDKV+
Sbjct  11   RHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDKVN  70

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            V ESK S   R I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  71   VEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  116



>ref|XP_010906988.1| PREDICTED: uncharacterized protein OsI_027940-like [Elaeis guineensis]
Length=174

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+VK  LEP+G F F+A AGA+N  +E+  +L+DK
Sbjct  1    MSRHPEVKWAQRVDKVYITVQLPDAKDVKVNLEPDGIFTFSATAGAENNLYELKMDLYDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            V+V  S+ +T  R I  +V+K E  WW +LL+ +GK P ++KVDWDKW
Sbjct  61   VNVEGSRINTGVRSIFCVVEKVEKGWWKKLLR-DGKTPHYVKVDWDKW  107



>gb|AGV54501.1| zinc finger CCCH domain-containing protein [Phaseolus vulgaris]
Length=186

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK+++TV+L D+KN K  L PEG F F+  AG+++  +E+  ELF+K
Sbjct  1    MSRHPEVKWAQRVDKVYVTVQLADSKNAKVDLTPEGVFTFSGSAGSEDHQYELKLELFEK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            V+V ESK +   R I  +V+KAE  WW R L+ EGK P ++KVDWDKWV
Sbjct  61   VNVEESKINVGVRSIFCVVQKAEIGWWKRFLRAEGKTPHYVKVDWDKWV  109



>gb|ABR17014.1| unknown [Picea sitchensis]
Length=157

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDKL++TV LPDAKNV  K EP+GKF F+A  G    PF++  ELF K
Sbjct  1    MSRHPEVLWAQRSDKLYLTVCLPDAKNVLVKPEPDGKFSFSA-IGLHAEPFQLELELFGK  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            ++   SK +   R I  ++KK E  WW RLLK EGKP  ++KVDW+KW DEDE++
Sbjct  60   LNSEGSKINIGLRNIFCVLKKEEKGWWKRLLKSEGKPAPYIKVDWNKWCDEDEEE  114



>ref|XP_002892131.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68390.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=228

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            +  HP VKWA+ +D +++TV+L DAK+   KL+PEG F F+A+AG DN  +E+  EL DK
Sbjct  6    LGHHPEVKWAERADIVYLTVQLADAKDADVKLDPEGIFSFSAKAGPDNQLYELKLELNDK  65

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V ESK +   R I  +++KAE KWW++LL+  GKPP ++KVDWDKWVDEDE
Sbjct  66   VNVEESKINIGLRSIVCILEKAEPKWWNKLLRG-GKPPHYVKVDWDKWVDEDE  117



>gb|ACN34684.1| unknown [Zea mays]
Length=191

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+ K  LEP+G F F+  AG +   +E+  +L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGTN--LYELKLDLNDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>gb|ACN35583.1| unknown [Zea mays]
 gb|AFW60896.1| hypothetical protein ZEAMMB73_488396 [Zea mays]
Length=120

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+ K  LEP+G F F+  AG +   +E+  +L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGTN--LYELKLDLNDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>gb|ACF88149.1| unknown [Zea mays]
 gb|ACG29923.1| hypothetical protein [Zea mays]
 gb|AFW60897.1| co-chaperone protein SBA1 [Zea mays]
Length=192

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+ K  LEP+G F F+  AG +   +E+  +L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGTN--LYELKLDLNDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>tpg|DAA49201.1| TPA: hypothetical protein ZEAMMB73_435161 [Zea mays]
Length=128

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+ K  L+P+G F F+  AG +   +E+  +L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGTN--LYELKLDLNDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>gb|KFK30837.1| hypothetical protein AALP_AA6G032100 [Arabis alpina]
Length=234

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ ++K+F+T+ L DAK+ K  L PEG   F+A+AG +N  FE+  EL DK
Sbjct  1    MSRHPEVKWAETTEKIFLTIVLADAKDAKVNLAPEGVLDFSAKAGPENHVFELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            V+V ESK +   R I  +++KAE   W +LL+  GKPP ++KVDWDKWVDEDE++
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPARWDKLLRG-GKPPHYVKVDWDKWVDEDEEN  114



>ref|XP_010456028.1| PREDICTED: uncharacterized protein Os08g0359500-like [Camelina 
sativa]
Length=234

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV L D K+ K  L PEG F F+A+ G +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHLYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W++LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  61   VNVEESKINVGERSIFCIIEKAEPERWNKLLRV-GKPPHYVKVDWDKWVDEDEE  113



>ref|XP_010429707.1| PREDICTED: uncharacterized protein Os08g0359500-like [Camelina 
sativa]
Length=240

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV L D K+ K  L PEG F F+A+ G +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHLYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W++LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  61   VNVEESKINVGERSIFCIIEKAEPERWNKLLRV-GKPPHYVKVDWDKWVDEDEE  113



>ref|NP_001241744.1| co-chaperone protein SBA1 [Zea mays]
 gb|ACG34656.1| co-chaperone protein SBA1 [Zea mays]
Length=198

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+ K  LEP+G F F+   G +   +E+  +L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSVGTN--LYELKLDLNDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>ref|NP_001148972.1| LOC100282592 [Zea mays]
 gb|ACG33684.1| co-chaperone protein SBA1 [Zea mays]
Length=205

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+ K  L+P+G F F+  AG +   +E+  +L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGTN--LYELKLDLNDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>gb|ACR38464.1| unknown [Zea mays]
 tpg|DAA49202.1| TPA: co-chaperone protein SBA1 [Zea mays]
Length=205

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+ K  L+P+G F F+  AG +   +E+  +L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGTN--LYELKLDLNDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>ref|XP_011079678.1| PREDICTED: uncharacterized protein Os08g0359500 [Sesamum indicum]
Length=182

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+  DK+++TV L DAKN K K++P+G F F+A AG DN  +E+  +L DK
Sbjct  1    MSRHPEVKWAEREDKVYLTVLLSDAKNPKVKVDPDGTFTFSATAGTDNNLYELKLDLLDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            V+V ESK +   R I  +++KAE +WW +LL+   K P ++KVDWDKWV
Sbjct  61   VNVEESKINIGVRNIFCVLEKAEQQWWKKLLRGNAKAPHYVKVDWDKWV  109



>ref|XP_006288563.1| hypothetical protein CARUB_v10001852mg [Capsella rubella]
 gb|EOA21461.1| hypothetical protein CARUB_v10001852mg [Capsella rubella]
Length=237

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV L D K+ K  L PEG F F+A+ G +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHVYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W++LL+  GKPP ++KVDWDKWVDED++
Sbjct  61   VNVEESKINVGERSIFCIIEKAEPERWNKLLRV-GKPPHYVKVDWDKWVDEDDE  113



>ref|XP_006396454.1| hypothetical protein EUTSA_v10028946mg [Eutrema salsugineum]
 gb|ESQ37907.1| hypothetical protein EUTSA_v10028946mg [Eutrema salsugineum]
Length=225

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV L D+K+ K  L PEG F F+A+AG +N  FE+  EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADSKDAKVNLNPEGVFDFSAKAGPENHVFELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W++L++  GK P ++KVDWDKWVDED++
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWNKLIRG-GKAPHYVKVDWDKWVDEDDE  113



>gb|EMT10253.1| hypothetical protein F775_29406 [Aegilops tauschii]
Length=335

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP V+WAQ  DK++ITV+LPDAK+ K  LEP+G F F A AG D   +E   +L DKV+
Sbjct  105  RHPEVRWAQRIDKVYITVQLPDAKDAKVNLEPDGVFSFFATAGTDGNSYESKLDLNDKVN  164

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V  SK S   R I  +++KA+ KWW++L++ + K P F+KVDWDKWVDED+
Sbjct  165  VEASKVSVGVRSIFCILEKADAKWWNKLVRDDQKAPHFVKVDWDKWVDEDD  215



>ref|XP_010422586.1| PREDICTED: uncharacterized protein Os08g0359500-like [Camelina 
sativa]
Length=231

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ + K+F+TV L D K+ K  L PEG F F+A+ G +N  +E++ EL DK
Sbjct  1    MSRHPEVKWAETTHKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHLYELNLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W++LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  61   VNVEESKINVGERSIFCIIEKAEPERWNKLLRV-GKPPHYVKVDWDKWVDEDEE  113



>ref|XP_008792885.1| PREDICTED: uncharacterized protein OsI_027940-like [Phoenix dactylifera]
Length=200

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 81/116 (70%), Gaps = 5/116 (4%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP VKWAQ  DK++ITV+LPDAK+VK  LEP+G F F+A AGA+N  +E+  +L+DKV+
Sbjct  17   RHPEVKWAQRVDKVYITVQLPDAKDVKVNLEPDGIFTFSATAGAENNLYELKMDLYDKVN  76

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPV-----FLKVDWDKWVDEDE  424
            V  S+ +T  R I  +V+K E  WW +LL+ + K        +LKVDWD WVDED+
Sbjct  77   VEGSRINTGVRSIFCVVEKVEKGWWKKLLRGDDKNTSLSESRYLKVDWDMWVDEDD  132



>ref|XP_009134431.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Brassica rapa]
Length=210

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV L D+K  K  L+PEG F F+A+AG +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADSKETKVNLDPEGVFDFSAKAGPENHVYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W +L++  GK P ++KVDWDKWVDED++
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWDKLIRG-GKAPHYVKVDWDKWVDEDDE  113



>ref|XP_010259596.1| PREDICTED: uncharacterized protein OsI_027940-like [Nelumbo nucifera]
Length=187

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+  DK+++TV LPDAKN K  LEP+G F F+A  G +N  +E+   L DK
Sbjct  1    MSRHPEVKWAERVDKVYLTVLLPDAKNSKVNLEPDGVFTFSATTGPENLLYELKINLHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  412
            V+V ESK +   R I  +++KAE  WW +LL+ + K P ++KVDWDKWV
Sbjct  61   VNVEESKINIGVRNIFCVIEKAEKGWWKKLLQADEKTPHYVKVDWDKWV  109



>ref|XP_002444216.1| hypothetical protein SORBIDRAFT_07g015140 [Sorghum bicolor]
 gb|EES13711.1| hypothetical protein SORBIDRAFT_07g015140 [Sorghum bicolor]
Length=214

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 79/113 (70%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+L DAK+ K  LEP+G F F+   G +   +E+  +L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLSDAKDAKVNLEPDGVFTFSGSVGTN--VYELKLDLNDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            V+V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>ref|XP_009144563.1| PREDICTED: uncharacterized protein Os08g0359500-like [Brassica 
rapa]
Length=218

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV L D+K  K  L PEG F F+A+AG +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHAYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V+ESK +   R I  +++KAE + W++L++  GK P ++K+DWDKWVDED++
Sbjct  61   VNVDESKINIGVRSIFCIIEKAEPERWNKLIRG-GKAPHYVKIDWDKWVDEDDE  113



>tpg|DAA49203.1| TPA: hypothetical protein ZEAMMB73_435161 [Zea mays]
Length=210

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 2/112 (2%)
 Frame = +2

Query  89   SRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKV  268
            SRHP VKWAQ  DK++ITV+LPDAK+ K  L+P+G F F+  AG +   +E+  +L DKV
Sbjct  8    SRHPEVKWAQRIDKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGTN--LYELKLDLNDKV  65

Query  269  DVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            +V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  66   NVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  117



>ref|NP_001150702.1| co-chaperone protein SBA1 [Zea mays]
 ref|XP_008676569.1| PREDICTED: LOC100282592 isoform X1 [Zea mays]
 gb|ACG40054.1| co-chaperone protein SBA1 [Zea mays]
 tpg|DAA49204.1| TPA: co-chaperone protein SBA1 [Zea mays]
Length=211

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 2/112 (2%)
 Frame = +2

Query  89   SRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKV  268
            SRHP VKWAQ  DK++ITV+LPDAK+ K  L+P+G F F+  AG +   +E+  +L DKV
Sbjct  8    SRHPEVKWAQRIDKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGTN--LYELKLDLNDKV  65

Query  269  DVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            +V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  66   NVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  117



>emb|CDX90937.1| BnaA03g26170D [Brassica napus]
Length=240

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +2

Query  83   TMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFD  262
             MSRHP VKWA+ +DK+F+TV L D+K  K  L+PEG F F+A++G +N  +E+  EL D
Sbjct  21   NMSRHPEVKWAETTDKIFLTVVLADSKETKVNLDPEGVFDFSAKSGPENHVYELKLELHD  80

Query  263  KVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            KV+V ESK +   R I  +++KAE + W +L++  GK P ++KVDWDKWVDED++
Sbjct  81   KVNVEESKINIGERSIFCIIEKAEPERWDKLIRG-GKAPHYVKVDWDKWVDEDDE  134



>ref|NP_001154201.1| HSP20-like chaperone [Arabidopsis thaliana]
 gb|AEE82174.1| HSP20-like chaperone [Arabidopsis thaliana]
Length=240

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ ++K+F+TV L D K+ K  L+PEG F F+A+ G +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W++LL+ + KPP ++KVDWDKWVDED++
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWNKLLRVK-KPPHYVKVDWDKWVDEDDE  113



>ref|NP_192154.2| HSP20-like chaperone [Arabidopsis thaliana]
 gb|AAM83226.1| AT4g02450/T14P8_5 [Arabidopsis thaliana]
 gb|AAN18096.1| At4g02450/T14P8_5 [Arabidopsis thaliana]
 gb|AEE82173.1| HSP20-like chaperone [Arabidopsis thaliana]
Length=241

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ ++K+F+TV L D K+ K  L+PEG F F+A+ G +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W++LL+ + KPP ++KVDWDKWVDED++
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWNKLLRVK-KPPHYVKVDWDKWVDEDDE  113



>emb|CAC16575.1| p23 co-chaperone [Arabidopsis thaliana]
Length=241

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ ++K+F+TV L D K+ K  L+PEG F F+A+ G +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W++LL+ + KPP ++KVDWDKWVDED++
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWNKLLRVK-KPPHYVKVDWDKWVDEDDE  113



>ref|XP_002872836.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49095.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ ++K+F+TV L D K+ K  L+PEG F F+A+ G +N  +E+  EL DK
Sbjct  1    MSRHPEVKWAETTEKIFLTVVLADTKDAKVNLDPEGVFDFSAKVGPENHVYELKLELHDK  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W++LL+ + KPP ++KVDWDKWVDED++
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWNKLLRVK-KPPHYVKVDWDKWVDEDDE  113



>ref|XP_009134430.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Brassica rapa]
Length=239

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            +SRHP VKWA+ +DK+F+TV L D+K  K  L+PEG F F+A+AG +N  +E+  EL DK
Sbjct  30   LSRHPEVKWAETTDKIFLTVVLADSKETKVNLDPEGVFDFSAKAGPENHVYELKLELHDK  89

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE + W +L++  GK P ++KVDWDKWVDED++
Sbjct  90   VNVEESKINIGERSIFCIIEKAEPERWDKLIRG-GKAPHYVKVDWDKWVDEDDE  142



>emb|CDY18019.1| BnaC03g30910D [Brassica napus]
Length=304

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV L D+K  K  L PEG F F+A+AG +N  +E+  EL DK
Sbjct  83   MSRHPEVKWAETTDKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHVYELKLELHDK  142

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V ESK +   R I  +++KAE   W +L+++ GK P ++KVDWDKWVDED++
Sbjct  143  VNVEESKINIGERSIFCIIEKAEPARWDKLIRR-GKAPHYVKVDWDKWVDEDDE  195



>ref|XP_007202648.1| hypothetical protein PRUPE_ppa012211mg [Prunus persica]
 gb|EMJ03847.1| hypothetical protein PRUPE_ppa012211mg [Prunus persica]
Length=179

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = +2

Query  44   STSVYLEEAAVADTMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGA  223
            S  V L+ +    ++SRHP V WAQ SDK+++TV LPDAK++  K EP+G F F+A  G 
Sbjct  45   SAIVPLQRSHATVSLSRHPEVLWAQRSDKVYLTVALPDAKDINIKCEPQGSFSFSA-IGV  103

Query  224  DNTPFEVSFELFDKVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWD  403
               PF  + +L+  +  +  K     R I   ++K ++ WW RLLK E KP  ++KVDW+
Sbjct  104  QGEPFHFTLDLYGPITPDGCKTKAGLRNILCSIQKDQNGWWKRLLKTEEKPAPYIKVDWN  163

Query  404  KWVDEDEQD  430
            KW DEDE+D
Sbjct  164  KWCDEDEED  172



>gb|AAT68744.1| hypothetical protein At3g03773 [Arabidopsis thaliana]
Length=117

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSR+P V WAQ SDK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL+ K
Sbjct  1    MSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSA-LGAQGERFEFSLELYGK  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            + + E + +   R I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  60   I-MTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  112



>ref|XP_007151769.1| hypothetical protein PHAVU_004G073200g [Phaseolus vulgaris]
 gb|ESW23763.1| hypothetical protein PHAVU_004G073200g [Phaseolus vulgaris]
Length=119

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 74/114 (65%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++TV LPDAK+V  K EP+G F F+A +G  +  +  S EL+  
Sbjct  1    MSRHPEVLWAQRSDKVYLTVALPDAKDVSVKCEPQGLFSFSA-SGVQDESYSFSLELYGS  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            ++    K  +  R I   V+K E  WW RLLK E KP  +LKVDW+KW DEDE+
Sbjct  60   IEPEGCKTKSGLRNILCSVQKGEKGWWKRLLKSEEKPAPYLKVDWNKWCDEDEE  113



>ref|NP_683525.2| p23 co-chaperone protein [Arabidopsis thaliana]
 sp|Q6ID70.1|Y3377_ARATH RecName: Full=Uncharacterized protein At3g03773 [Arabidopsis 
thaliana]
 gb|AAT41786.1| At3g03773 [Arabidopsis thaliana]
 gb|AAT68743.1| hypothetical protein At3g03773 [Arabidopsis thaliana]
 gb|AAT70471.1| At3g03773 [Arabidopsis thaliana]
 gb|AAX55169.1| hypothetical protein At3g03773 [Arabidopsis thaliana]
 gb|AEE73986.1| p23 co-chaperone protein [Arabidopsis thaliana]
Length=150

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSR+P V WAQ SDK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL+ K
Sbjct  1    MSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSA-LGAQGERFEFSLELYGK  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            + + E + +   R I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  60   I-MTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  112



>ref|XP_001763304.1| predicted protein [Physcomitrella patens]
 gb|EDQ71834.1| predicted protein [Physcomitrella patens]
Length=156

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = +2

Query  83   TMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFD  262
            T  RHP + WAQ SDK+++TVELPDA N + KL+P+G+F F   A + +  +E  F+LF 
Sbjct  3    TSIRHPEILWAQRSDKIYLTVELPDAINAQVKLQPDGRFTFT--ASSKDAKYEADFQLFG  60

Query  263  KVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  433
            +V V+ S      R+   +++K E  WW RLLK EGK P F+K DW++W+DEDE++E
Sbjct  61   RVKVDVSNIDEGRRHTFCVIQKEESGWWDRLLK-EGKAPPFVKADWNRWIDEDEEEE  116



>ref|XP_004973281.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X2 [Setaria italica]
Length=214

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWAQ  DK++ITV+LPDAK+ K  LEP+G F F+  AG +   +E+  +L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGTN--LYELKLDLNDK  58

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            V+V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKW
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKW  106



>emb|CDX97265.1| BnaA02g20560D [Brassica napus]
Length=1121

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  86    MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
             MSRHP VKWA+ +DK+F+TV L D+K  K  L PEG F F+A+AG +N  +E+  EL DK
Sbjct  923   MSRHPEVKWAETTDKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHAYELKLELHDK  982

Query  266   VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
             V+V+ESK +   R I  +++KAE + W++L++  GK P ++K+DWDKWVDED++
Sbjct  983   VNVDESKINIGVRSIFCIIEKAEPERWNKLIRG-GKAPHYVKIDWDKWVDEDDE  1035



>emb|CDX91318.1| BnaC02g27290D [Brassica napus]
Length=886

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+ +DK+F+TV L D+K  K  L PEG F F+A+AG +N  +E+  EL DK
Sbjct  684  MSRHPEVKWAETTDKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHVYELKLELHDK  743

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V+V+ESK +   R I  +++KAE + W++L++  GK P ++K+DWDKWVDED++
Sbjct  744  VNVDESKINIGVRSIFCIIEKAEPERWNKLIRG-GKAPHYVKIDWDKWVDEDDE  796



>ref|XP_004489674.1| PREDICTED: uncharacterized protein At3g03773-like [Cicer arietinum]
Length=151

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (65%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++TV LPDAK+V  K EP G F F+A +   +  +  S EL+  
Sbjct  1    MSRHPEVLWAQRSDKVYLTVALPDAKDVTVKCEPHGLFSFSA-SRVQHESYSFSLELYGS  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            ++    K  T+SR I   ++K +  WW RLLK E KP  +LKVDW+KW DEDE+
Sbjct  60   IEPGGCKTKTSSRNILCSIQKGQRGWWKRLLKSEEKPAPYLKVDWNKWCDEDEE  113



>ref|XP_008244127.1| PREDICTED: uncharacterized protein At3g03773 isoform X2 [Prunus 
mume]
Length=127

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++TV LPDAK++  K EP+G F F+A  G    PF  + +L+  
Sbjct  1    MSRHPEVLWAQRSDKVYLTVALPDAKDINIKCEPQGSFSFSA-IGVQGEPFHFTLDLYGP  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            +  +  K     R I   ++K +  WW RLLK E KP  ++KVDW+KW DEDE+D
Sbjct  60   ITPDGCKTKAGLRNILCSIQKDQKGWWKRLLKTEEKPAPYIKVDWNKWCDEDEED  114



>gb|AFK42085.1| unknown [Lotus japonicus]
Length=150

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++TV LPDAK+V  K EP G F F+A +G  + P+  S EL+  
Sbjct  1    MSRHPEVLWAQRSDKVYLTVALPDAKDVSVKCEPHGLFSFSA-SGVQHEPYSFSLELYGS  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            ++    K     R I   V+K +  WW RLLK E KP  +LKVDW++W DED+++
Sbjct  60   IEPEGCKIKAGLRNILCSVQKGQKGWWKRLLKSEDKPAPYLKVDWNRWCDEDDEE  114



>ref|XP_002882306.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58565.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=150

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSR+P V WAQ SDK+++TV LPDAK++  K EP G F F+A  GA    FE S EL+ K
Sbjct  1    MSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPRGLFSFSA-LGAQGERFEFSLELYGK  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            + + E + +   R I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  60   I-MPEYRKNVGLRNIIFSIQKEEKSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  112



>gb|AAC19287.1| T14P8.5 [Arabidopsis thaliana]
 emb|CAB80738.1| putative protein [Arabidopsis thaliana]
Length=262

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +2

Query  92   RHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVD  271
            RHP VKWA+ ++K+F+TV L D K+ K  L+PEG F F+A+ G +N  +E+  EL DKV+
Sbjct  7    RHPEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADKVN  66

Query  272  VNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            V ESK +   R I  +++KAE + W++LL+ + KPP ++KVDWDKWVDED++
Sbjct  67   VEESKINIGERSIFCIIEKAEPERWNKLLRVK-KPPHYVKVDWDKWVDEDDE  117



>ref|XP_008386859.1| PREDICTED: uncharacterized protein At3g03773 [Malus domestica]
Length=153

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = +2

Query  89   SRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKV  268
            SRHP V WAQ SDK+++TV LPDAK++  K EPEG F F+A  G    PF  + EL+  +
Sbjct  5    SRHPEVLWAQRSDKVYLTVALPDAKDITVKCEPEGLFSFSA-VGVQGEPFHFTLELYGPI  63

Query  269  DVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
              +  K  T  R I   ++K +  WW RLLK E KP  ++KVDW+KW DEDE+
Sbjct  64   TPDGCKTRTGLRNILCSIQKEQRGWWKRLLKTEEKPAPYIKVDWNKWCDEDEE  116



>gb|EPS74301.1| hypothetical protein M569_00457 [Genlisea aurea]
Length=175

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP VKWA+  D +++T+ LPDAKN K  ++P+G F F   AG DN  +E+  +L D+
Sbjct  1    MSRHPEVKWAEREDIVYLTLLLPDAKNPKVNVDPDGSFTFTGTAGTDNNHYELKLDLLDR  60

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  424
            ++V ESK +   R I  +++KAE KWW +LL+ +GK P ++KVDWDKWVDED+
Sbjct  61   INVEESKINIGVRSIICILEKAEKKWWKKLLRGDGKAPHYVKVDWDKWVDEDD  113



>gb|KJB80743.1| hypothetical protein B456_013G113500 [Gossypium raimondii]
Length=151

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++T+ LPDAK++  K +P+G F F+A  G     F+ S ELF K
Sbjct  1    MSRHPEVLWAQRSDKVYLTISLPDAKDISVKCDPQGLFSFSA-MGVQGESFDFSLELFGK  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            +     K +   R I   + K E  WW RLLK E KP  ++KVDW+KW DED++D
Sbjct  60   IVPEGCKTNVGLRNIICSIMKEEKGWWKRLLKSEEKPAPYIKVDWNKWCDEDDED  114



>ref|XP_006298626.1| hypothetical protein CARUB_v10014713mg, partial [Capsella rubella]
 gb|EOA31524.1| hypothetical protein CARUB_v10014713mg, partial [Capsella rubella]
Length=191

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +2

Query  77   ADTMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFEL  256
            A+ MSR+P V WAQ SDK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL
Sbjct  40   AENMSRNPEVLWAQRSDKVYLTVALPDAKDLSVKCEPQGLFSFSA-LGALGERFEFSLEL  98

Query  257  FDKVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            + K+ + E + +   R I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  99   YGKI-MPEYRKNVGLRNIIFSIQKEEKSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  154



>pdb|2KMW|A Chain A, Solution Structure Of At3g03773.1 Protein From Arabidopsis 
Thaliana
Length=150

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +2

Query  89   SRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKV  268
            SR+P V WAQ SDK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL+ K+
Sbjct  2    SRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSA-LGAQGERFEFSLELYGKI  60

Query  269  DVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
             + E + +   R I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  61   -MTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  112



>gb|KHG15374.1| hypothetical protein F383_20155 [Gossypium arboreum]
Length=153

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++T+ LPDAK++  K +P+G F F+A  G     F+ S ELF K
Sbjct  1    MSRHPEVLWAQRSDKVYLTISLPDAKDISVKCDPQGLFSFSA-MGVQGESFDFSLELFGK  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            +     K +   R I   + K E  WW RLLK E KP  ++KVDW+KW DED++D
Sbjct  60   IVPEGCKTNVGLRNIICSIMKEETGWWKRLLKSEEKPAPYIKVDWNKWCDEDDED  114



>ref|XP_009366492.1| PREDICTED: uncharacterized protein At3g03773-like [Pyrus x bretschneideri]
 ref|XP_009366493.1| PREDICTED: uncharacterized protein At3g03773-like [Pyrus x bretschneideri]
 ref|XP_009350547.1| PREDICTED: uncharacterized protein At3g03773-like [Pyrus x bretschneideri]
Length=153

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = +2

Query  89   SRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKV  268
            SRHP V WAQ SDK+++TV LPDAK++  K EPEG F F+A  G    PF  + EL+  +
Sbjct  5    SRHPEVLWAQRSDKVYLTVALPDAKDITVKCEPEGFFSFSA-VGVQGEPFHFTLELYGPI  63

Query  269  DVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
              +  K  T  R I   ++K +  WW RLLK E KP  ++KVDW+KW DEDE+
Sbjct  64   TPDGCKTRTGLRNILCSIQKEQRGWWKRLLKTEEKPAPYIKVDWNKWCDEDEE  116



>gb|KJB80742.1| hypothetical protein B456_013G113500 [Gossypium raimondii]
Length=153

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++T+ LPDAK++  K +P+G F F+A  G     F+ S ELF K
Sbjct  1    MSRHPEVLWAQRSDKVYLTISLPDAKDISVKCDPQGLFSFSA-MGVQGESFDFSLELFGK  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            +     K +   R I   + K E  WW RLLK E KP  ++KVDW+KW DED++D
Sbjct  60   IVPEGCKTNVGLRNIICSIMKEEKGWWKRLLKSEEKPAPYIKVDWNKWCDEDDED  114



>ref|XP_010514039.1| PREDICTED: uncharacterized protein At3g03773 isoform X1 [Camelina 
sativa]
 ref|XP_010514104.1| PREDICTED: uncharacterized protein At3g03773 isoform X2 [Camelina 
sativa]
 ref|XP_010463839.1| PREDICTED: uncharacterized protein At3g03773 [Camelina sativa]
 ref|XP_010485732.1| PREDICTED: uncharacterized protein At3g03773 [Camelina sativa]
Length=149

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSR+P V WAQ SDK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL+ K
Sbjct  1    MSRNPEVLWAQRSDKVYLTVALPDAKDLSVKCEPQGLFSFSA-LGALGERFEFSLELYGK  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            + + E + +   R I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  60   I-LPEYRKNVGLRNIIFSIQKEEKSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  112



>ref|XP_004973280.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X1 [Setaria italica]
Length=220

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 2/107 (2%)
 Frame = +2

Query  89   SRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKV  268
            SRHP VKWAQ  DK++ITV+LPDAK+ K  LEP+G F F+  AG +   +E+  +L DKV
Sbjct  8    SRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGTN--LYELKLDLNDKV  65

Query  269  DVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  409
            +V  SK S   R I  +V+KAE KWW +L++ + + P F+KVDWDKW
Sbjct  66   NVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKW  112



>ref|NP_001236575.1| uncharacterized protein LOC100527476 [Glycine max]
 ref|XP_006579378.1| PREDICTED: uncharacterized protein LOC100527476 isoform X1 [Glycine 
max]
 gb|ACU16570.1| unknown [Glycine max]
Length=151

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++TV LPDAK+V  K EP+G F F+A +G  +  +  S EL+  
Sbjct  1    MSRHPEVLWAQRSDKVYLTVALPDAKDVFVKCEPQGLFAFSA-SGVQDKAYSFSLELYGS  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            ++    K  +  R I   ++K E  WW RLLK E KP  +LKVDW+KW DED+++
Sbjct  60   IEPEGCKTKSGLRNILCSIQKGEKGWWKRLLKSEEKPAPYLKVDWNKWCDEDDEE  114



>ref|XP_006443478.1| hypothetical protein CICLE_v10022696mg [Citrus clementina]
 ref|XP_006479156.1| PREDICTED: uncharacterized protein At3g03773-like [Citrus sinensis]
 gb|ESR56718.1| hypothetical protein CICLE_v10022696mg [Citrus clementina]
Length=150

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++T+ LPDAK++  K EP+G F F+A  G     ++ S ELF K
Sbjct  1    MSRHPEVLWAQRSDKVYLTISLPDAKDISVKCEPQGIFGFSA-VGVQGELYDFSLELFGK  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            +   + K     R I   V+K E  WW RLLK E KP  ++KVDW+KW DED++
Sbjct  60   ILPEKCKTKVGLRNIICSVQKEEKGWWKRLLKSEEKPAPYIKVDWNKWCDEDDE  113



>ref|NP_001154589.1| p23 co-chaperone protein [Arabidopsis thaliana]
 gb|AEE73987.1| p23 co-chaperone protein [Arabidopsis thaliana]
Length=204

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 85/135 (63%), Gaps = 3/135 (2%)
 Frame = +2

Query  26   QNV-LLRSTSVYLEEAAVADTMSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFY  202
            QN+ L  + S  L    +   M R+P V WAQ SDK+++TV LPDAK++  K EP+G F 
Sbjct  34   QNLHLAENMSSKLRIFVIDIRMIRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFS  93

Query  203  FAAEAGADNTPFEVSFELFDKVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPV  382
            F+A  GA    FE S EL+ K+ + E + +   R I + ++K E  WW+RLLK E KP  
Sbjct  94   FSA-LGAQGERFEFSLELYGKI-MTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAP  151

Query  383  FLKVDWDKWVDEDEQ  427
            ++KVDW+KW DEDE+
Sbjct  152  YIKVDWNKWCDEDEE  166



>gb|KDO66094.1| hypothetical protein CISIN_1g031955mg [Citrus sinensis]
Length=150

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++T+ LPDAK++  K EP+G F F+A  G     F+ S ELF K
Sbjct  1    MSRHPEVLWAQRSDKVYLTISLPDAKDISVKCEPQGIFGFSA-VGVQGELFDFSLELFGK  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
                + K     R I   V+K E  WW RLLK E KP  ++KVDW+KW DED++
Sbjct  60   TLPEKCKTKVGLRNIICSVQKEEKGWWKRLLKSEEKPAPYIKVDWNKWCDEDDE  113



>ref|XP_002325859.2| hypothetical protein POPTR_0019s05470g [Populus trichocarpa]
 gb|EEF00241.2| hypothetical protein POPTR_0019s05470g [Populus trichocarpa]
Length=151

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSRHP V WAQ SDK+++T+ LPDAK+V  K E  G F F+A  G     F+ S ELF  
Sbjct  1    MSRHPEVLWAQRSDKVYLTIALPDAKDVSVKCEGGGLFSFSA-VGVQGESFDFSLELFGN  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  427
            +    SK     R I   ++K E  WW RLLK EGKP  ++KVDW+KW DED++
Sbjct  60   IVPEGSKTKVGLRNIICSIQKEEKVWWKRLLKSEGKPAPYIKVDWNKWFDEDDE  113



>ref|XP_003550100.1| PREDICTED: uncharacterized protein At3g03773-like isoform 1 [Glycine 
max]
Length=151

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSRHPSVKWAQCSDKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDK  265
            MSR+P V WAQ SDK+++TV LPDAKNV  K EP+G F F+A +G     +  S EL+  
Sbjct  1    MSRYPEVLWAQRSDKVYLTVALPDAKNVSVKCEPQGLFTFSA-SGVQEEAYSFSLELYGC  59

Query  266  VDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  430
            ++    K  +  R I   ++K E  WW RLLK E KP  +LKVDW++W DED+++
Sbjct  60   IEPEGCKTKSGLRNILCSIQKGEKGWWKRLLKSEEKPAPYLKVDWNRWCDEDDEE  114



>gb|EEE59155.1| hypothetical protein OsJ_11066 [Oryza sativa Japonica Group]
Length=160

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +2

Query  221  ADNTPFEVSFELFDKVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDW  400
            AD+TP+E+  ELFD V+V ESK +  +R ICYL+KKAE KWW RLLK+EGKPPVFLKVDW
Sbjct  20   ADDTPYELDLELFDAVNVEESKAAVAARSICYLIKKAESKWWPRLLKKEGKPPVFLKVDW  79

Query  401  DKWVDEDEQD  430
            DKW DED++D
Sbjct  80   DKWQDEDDED  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520