BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF027D04

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011094122.1|  PREDICTED: mediator of RNA polymerase II tra...    331   6e-106   Sesamum indicum [beniseed]
ref|XP_009601665.1|  PREDICTED: mediator of RNA polymerase II tra...    329   7e-105   Nicotiana tomentosiformis
ref|XP_009781829.1|  PREDICTED: mediator of RNA polymerase II tra...    327   4e-104   Nicotiana sylvestris
ref|XP_006364902.1|  PREDICTED: mediator of RNA polymerase II tra...    326   7e-104   Solanum tuberosum [potatoes]
emb|CDP10383.1|  unnamed protein product                                324   4e-103   Coffea canephora [robusta coffee]
ref|XP_004251571.1|  PREDICTED: mediator of RNA polymerase II tra...    322   3e-102   Solanum lycopersicum
gb|EYU29301.1|  hypothetical protein MIMGU_mgv1a002570mg                312   1e-98    Erythranthe guttata [common monkey flower]
ref|XP_009368825.1|  PREDICTED: mediator of RNA polymerase II tra...    305   8e-96    Pyrus x bretschneideri [bai li]
ref|XP_008337314.1|  PREDICTED: mediator of RNA polymerase II tra...    304   2e-95    
ref|XP_002285089.1|  PREDICTED: mediator of RNA polymerase II tra...    303   3e-95    Vitis vinifera
ref|XP_010093735.1|  hypothetical protein L484_006289                   298   1e-92    
gb|KCW82816.1|  hypothetical protein EUGRSUZ_C04186                     294   1e-92    Eucalyptus grandis [rose gum]
gb|KDP32381.1|  hypothetical protein JCGZ_13306                         296   3e-92    Jatropha curcas
ref|XP_010254371.1|  PREDICTED: mediator of RNA polymerase II tra...    296   3e-92    Nelumbo nucifera [Indian lotus]
ref|XP_008242750.1|  PREDICTED: mediator of RNA polymerase II tra...    295   5e-92    Prunus mume [ume]
ref|XP_007204608.1|  hypothetical protein PRUPE_ppa002594mg             294   1e-91    Prunus persica
emb|CDX88852.1|  BnaA03g07970D                                          293   3e-91    
ref|XP_010049981.1|  PREDICTED: mediator of RNA polymerase II tra...    293   4e-91    Eucalyptus grandis [rose gum]
ref|XP_004141551.1|  PREDICTED: mediator of RNA polymerase II tra...    293   4e-91    Cucumis sativus [cucumbers]
ref|XP_009131782.1|  PREDICTED: mediator of RNA polymerase II tra...    292   5e-91    Brassica rapa
gb|KJB07725.1|  hypothetical protein B456_001G041100                    290   6e-91    Gossypium raimondii
ref|XP_008459609.1|  PREDICTED: mediator of RNA polymerase II tra...    292   9e-91    Cucumis melo [Oriental melon]
ref|XP_004300164.1|  PREDICTED: mediator of RNA polymerase II tra...    291   1e-90    Fragaria vesca subsp. vesca
gb|KJB07722.1|  hypothetical protein B456_001G041100                    289   2e-90    Gossypium raimondii
ref|XP_006374395.1|  hypothetical protein POPTR_0015s06780g             291   3e-90    
emb|CDX70919.1|  BnaC03g10030D                                          290   4e-90    
gb|KHG17744.1|  mediator of rna polymerase ii transcription subun...    290   5e-90    Gossypium arboreum [tree cotton]
gb|KJB07724.1|  hypothetical protein B456_001G041100                    289   7e-90    Gossypium raimondii
gb|KJB07721.1|  hypothetical protein B456_001G041100                    289   1e-89    Gossypium raimondii
gb|KJB07723.1|  hypothetical protein B456_001G041100                    289   1e-89    Gossypium raimondii
ref|XP_006475818.1|  PREDICTED: mediator of RNA polymerase II tra...    288   2e-89    Citrus sinensis [apfelsine]
ref|XP_006450970.1|  hypothetical protein CICLE_v10007689mg             288   2e-89    Citrus clementina [clementine]
gb|AIU49750.1|  RNA polymerase II transcription mediator                284   3e-89    Solanum tuberosum [potatoes]
ref|XP_011007274.1|  PREDICTED: mediator of RNA polymerase II tra...    287   8e-89    Populus euphratica
gb|AIU49760.1|  RNA polymerase II transcription mediator                281   4e-88    Solanum lycopersicum
ref|XP_006400585.1|  hypothetical protein EUTSA_v10012923mg             282   3e-87    Eutrema salsugineum [saltwater cress]
ref|XP_002873986.1|  hypothetical protein ARALYDRAFT_351112             280   2e-86    
gb|KFK26261.1|  hypothetical protein AALP_AA8G224100                    279   7e-86    Arabis alpina [alpine rockcress]
ref|XP_010493125.1|  PREDICTED: mediator of RNA polymerase II tra...    278   2e-85    Camelina sativa [gold-of-pleasure]
gb|AIU49763.1|  RNA polymerase II transcription mediator                274   2e-85    Vitis vinifera
gb|EPS70468.1|  hypothetical protein M569_04289                         276   3e-85    Genlisea aurea
ref|XP_003525658.1|  PREDICTED: mediator of RNA polymerase II tra...    276   6e-85    Glycine max [soybeans]
ref|XP_010454320.1|  PREDICTED: mediator of RNA polymerase II tra...    276   9e-85    Camelina sativa [gold-of-pleasure]
gb|AIU49748.1|  RNA polymerase II transcription mediator                272   2e-84    Manihot esculenta [manioc]
ref|XP_006286416.1|  hypothetical protein CARUB_v10002972mg             274   5e-84    Capsella rubella
ref|XP_007013390.1|  RNA polymerase II transcription mediators is...    274   6e-84    
ref|XP_003549778.1|  PREDICTED: mediator of RNA polymerase II tra...    274   6e-84    Glycine max [soybeans]
ref|XP_010420856.1|  PREDICTED: mediator of RNA polymerase II tra...    273   1e-83    Camelina sativa [gold-of-pleasure]
ref|NP_197517.3|  RNA polymerase II transcription mediator              272   3e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154971.1|  hypothetical protein PHAVU_003G161800g             272   5e-83    Phaseolus vulgaris [French bean]
gb|AES91489.2|  RNA polymerase II transcription mediators protein       271   6e-83    Medicago truncatula
gb|AIU49751.1|  RNA polymerase II transcription mediator                267   9e-83    Populus trichocarpa [western balsam poplar]
gb|AIU49749.1|  RNA polymerase II transcription mediator                266   1e-82    Erythranthe guttata [common monkey flower]
gb|KJB54060.1|  hypothetical protein B456_009G019100                    270   3e-82    Gossypium raimondii
gb|AIU49752.1|  RNA polymerase II transcription mediator                265   9e-82    Prunus persica
gb|AIU49767.1|  RNA polymerase II transcription mediator                264   2e-81    Platanus x hispanica [London plane tree]
gb|KHN46923.1|  hypothetical protein glysoja_031223                     262   5e-81    Glycine soja [wild soybean]
ref|XP_003609292.1|  hypothetical protein MTR_4g114100                  269   2e-80    
ref|XP_004508515.1|  PREDICTED: mediator of RNA polymerase II tra...    264   4e-80    
gb|AIU49727.1|  RNA polymerase II transcription mediator                260   7e-80    Theobroma cacao [chocolate]
gb|AIU49736.1|  RNA polymerase II transcription mediator                259   1e-79    Glycine max [soybeans]
ref|XP_007013395.1|  RNA polymerase II transcription mediators is...    259   1e-79    
gb|AIU49762.1|  RNA polymerase II transcription mediator                259   2e-79    Schrenkiella parvula
gb|AIU49730.1|  RNA polymerase II transcription mediator                258   2e-79    Citrus clementina [clementine]
gb|AIU49734.1|  RNA polymerase II transcription mediator                258   2e-79    Citrus sinensis [apfelsine]
gb|AIU49735.1|  RNA polymerase II transcription mediator                258   4e-79    Eucalyptus grandis [rose gum]
gb|AIU49719.1|  RNA polymerase II transcription mediator                256   1e-78    Aquilegia coerulea [Rocky Mountain columbine]
ref|XP_006842865.1|  hypothetical protein AMTR_s00081p00160620          260   1e-78    Amborella trichopoda
gb|AIU49731.1|  RNA polymerase II transcription mediator                256   2e-78    Gossypium raimondii
ref|XP_010520585.1|  PREDICTED: mediator of RNA polymerase II tra...    259   3e-78    Tarenaya hassleriana [spider flower]
gb|AIU49723.1|  RNA polymerase II transcription mediator                256   3e-78    Magnolia denudata [haku-mokuren]
gb|AIU49742.1|  RNA polymerase II transcription mediator                255   5e-78    Chimonanthus praecox [wintersweet]
gb|AIU49766.1|  RNA polymerase II transcription mediator                254   7e-78    Cinnamomum camphora
gb|AIU49720.1|  RNA polymerase II transcription mediator                254   8e-78    Arabidopsis lyrata [lyrate rockcress]
gb|AIU49746.1|  RNA polymerase II transcription mediator                254   8e-78    Medicago truncatula
gb|AIU49754.1|  RNA polymerase II transcription mediator                252   5e-77    Phaseolus vulgaris [French bean]
gb|AIU49741.1|  RNA polymerase II transcription mediator                251   2e-76    Ceratophyllum demersum [hornwort]
gb|AIU49740.1|  RNA polymerase II transcription mediator                251   2e-76    Chloranthus japonicus
gb|AIU49729.1|  RNA polymerase II transcription mediator                251   3e-76    Sarcandra glabra
ref|XP_010688034.1|  PREDICTED: mediator of RNA polymerase II tra...    251   3e-75    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU49733.1|  RNA polymerase II transcription mediator                247   4e-75    Capsella rubella
gb|AIU49721.1|  RNA polymerase II transcription mediator                247   5e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010910117.1|  PREDICTED: mediator of RNA polymerase II tra...    250   8e-75    Elaeis guineensis
gb|AIU49737.1|  RNA polymerase II transcription mediator                245   2e-74    Illicium henryi
gb|AIU49728.1|  RNA polymerase II transcription mediator                245   3e-74    Acorus calamus [flagroot]
ref|XP_008354374.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    248   4e-74    
gb|AIU49769.1|  RNA polymerase II transcription mediator                239   1e-71    Houttuynia cordata [chameleon-plant]
gb|AIU49745.1|  RNA polymerase II transcription mediator                237   4e-71    Aristolochia tagala
gb|AIU49757.1|  RNA polymerase II transcription mediator                236   6e-71    Dioscorea oppositifolia
ref|XP_009389497.1|  PREDICTED: mediator of RNA polymerase II tra...    240   7e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008809751.1|  PREDICTED: mediator of RNA polymerase II tra...    234   8e-69    Phoenix dactylifera
gb|AIU49739.1|  RNA polymerase II transcription mediator                230   2e-68    Iris japonica
gb|AIU49758.1|  RNA polymerase II transcription mediator                228   2e-67    Yucca filamentosa [Adam's-needle]
gb|AIU49747.1|  RNA polymerase II transcription mediator                227   2e-67    Canna indica [canna]
gb|AIU49724.1|  RNA polymerase II transcription mediator                224   4e-66    Musa acuminata [banana]
gb|KJB54063.1|  hypothetical protein B456_009G019100                    224   9e-66    Gossypium raimondii
ref|XP_002524467.1|  hypothetical protein RCOM_0221540                  217   1e-64    Ricinus communis
gb|AIU49744.1|  RNA polymerase II transcription mediator                219   3e-64    Asparagus officinalis
gb|AIU49768.1|  RNA polymerase II transcription mediator                217   2e-63    Ginkgo biloba [ginkgo]
ref|XP_010520586.1|  PREDICTED: mediator of RNA polymerase II tra...    217   2e-62    Tarenaya hassleriana [spider flower]
ref|XP_003569428.1|  PREDICTED: mediator of RNA polymerase II tra...    216   3e-62    
ref|NP_001145828.1|  uncharacterized protein LOC100279335               216   4e-62    Zea mays [maize]
ref|XP_010232920.1|  PREDICTED: serine/threonine-protein kinase ATM     217   4e-60    
ref|XP_004967947.1|  PREDICTED: mediator of RNA polymerase II tra...    211   5e-60    Setaria italica
ref|NP_001067381.1|  Os12g0638600                                       209   2e-59    
ref|XP_002457523.1|  hypothetical protein SORBIDRAFT_03g008700          206   2e-58    Sorghum bicolor [broomcorn]
gb|AIU49770.1|  RNA polymerase II transcription mediator                202   9e-58    Zea mays [maize]
ref|NP_001288373.1|  mediator of RNA polymerase II transcription ...    204   2e-57    Zea mays [maize]
gb|AIU49756.1|  RNA polymerase II transcription mediator                192   5e-56    Ricinus communis
gb|AIU49761.1|  RNA polymerase II transcription mediator                196   1e-55    Sorghum bicolor [broomcorn]
gb|AIU49753.1|  RNA polymerase II transcription mediator                195   3e-55    Panicum virgatum
gb|AIU49759.1|  RNA polymerase II transcription mediator                194   5e-55    Setaria italica
gb|AIU49772.1|  RNA polymerase II transcription mediator                193   7e-55    Trachycarpus fortunei
gb|AIU49726.1|  RNA polymerase II transcription mediator                194   1e-54    Brachypodium distachyon [annual false brome]
gb|EEE53678.1|  hypothetical protein OsJ_37013                          195   3e-54    Oryza sativa Japonica Group [Japonica rice]
gb|KJB54064.1|  hypothetical protein B456_009G019100                    189   1e-52    Gossypium raimondii
gb|KJB54062.1|  hypothetical protein B456_009G019100                    190   2e-52    Gossypium raimondii
gb|EMT09196.1|  hypothetical protein F775_08586                         189   4e-52    
gb|AIU49722.1|  RNA polymerase II transcription mediator                181   2e-50    Lilium brownii [Hong Kong lily]
gb|KJB07727.1|  hypothetical protein B456_001G041100                    174   4e-47    Gossypium raimondii
ref|XP_001782525.1|  predicted protein                                  171   6e-46    
ref|XP_007013392.1|  RNA polymerase II transcription mediators is...    161   1e-42    
ref|XP_007013393.1|  RNA polymerase II transcription mediators is...    161   2e-42    Theobroma cacao [chocolate]
ref|XP_006664786.1|  PREDICTED: mediator of RNA polymerase II tra...    161   2e-42    
gb|KJB07726.1|  hypothetical protein B456_001G041100                    157   5e-41    Gossypium raimondii
gb|KDO80288.1|  hypothetical protein CISIN_1g006207mg                   156   1e-40    Citrus sinensis [apfelsine]
ref|XP_002991906.1|  hypothetical protein SELMODRAFT_430185             155   5e-40    
ref|XP_002980116.1|  hypothetical protein SELMODRAFT_419660             154   1e-39    
ref|XP_010420857.1|  PREDICTED: mediator of RNA polymerase II tra...    152   4e-39    
dbj|BAK08012.1|  predicted protein                                      145   8e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH32115.1|  RNA polymerase II transcription mediators protein       142   9e-36    Medicago truncatula
ref|XP_008809755.1|  PREDICTED: mediator of RNA polymerase II tra...    138   3e-34    
gb|EMS61166.1|  hypothetical protein TRIUR3_03686                       120   6e-28    Triticum urartu
gb|AIU49738.1|  RNA polymerase II transcription mediator                114   5e-26    Buxus sinica
dbj|BAJ93746.1|  predicted protein                                      113   3e-25    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008679946.1|  PREDICTED: mediator of RNA polymerase II tra...    111   1e-24    
ref|XP_008654792.1|  PREDICTED: uncharacterized protein LOC100279...  95.5    5e-19    Zea mays [maize]
gb|EMT20869.1|  hypothetical protein F775_22791                       92.0    9e-18    
emb|CBI38915.3|  unnamed protein product                              81.3    5e-15    Vitis vinifera
gb|AIU49773.1|  RNA polymerase II transcription mediator              76.6    7e-13    Cabomba caroliniana
emb|CAN63371.1|  hypothetical protein VITISV_031279                   65.5    3e-09    Vitis vinifera
ref|XP_009861198.1|  PREDICTED: mediator of RNA polymerase II tra...  50.4    6e-04    



>ref|XP_011094122.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Sesamum indicum]
Length=662

 Score =   331 bits (849),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 187/214 (87%), Gaps = 3/214 (1%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ DL+ISLDKLPIKR+E +EENG ERFPS DVGYDEK V+LIRRIDFAWAVEREDPSKK
Sbjct  1    MDGDLEISLDKLPIKRLEALEENGFERFPS-DVGYDEKRVNLIRRIDFAWAVEREDPSKK  59

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            QK   A +   +    + Q WPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  60   QKSEGASAKEGTST--SQQQWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVAGMTR  117

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PKQLPNE LSDLAVS  TKLQ FR+ GKYFKQSAK+LE+Q+AREARFYGALIRLQQNWKI
Sbjct  118  PKQLPNEHLSDLAVSTATKLQCFRNLGKYFKQSAKSLEEQIAREARFYGALIRLQQNWKI  177

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KRHR++AA SGNEGFYIDLFDN+L+D A +FRPS
Sbjct  178  KRHRLVAAASGNEGFYIDLFDNSLYDSAAIFRPS  211



>ref|XP_009601665.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Nicotiana tomentosiformis]
Length=668

 Score =   329 bits (843),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 190/217 (88%), Gaps = 4/217 (2%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M  DL+IS+DKLPIKR+EF+EE G ERFPS D+GYDEKTV+LIRRIDFAWAVERE+PSKK
Sbjct  1    MNGDLEISVDKLPIKRLEFIEEKGAERFPS-DIGYDEKTVNLIRRIDFAWAVEREEPSKK  59

Query  222  qkkssadsssssketsA---NQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVAS  392
            QKK S+ +SS+S         QPW WQSLVENL+LAHQEL VIIDLI+TVEANDAVTVA 
Sbjct  60   QKKKSSSTSSTSSSKETSSNQQPWQWQSLVENLRLAHQELQVIIDLIHTVEANDAVTVAG  119

Query  393  MTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQN  572
            MTRPKQLPNE LSDLAVSM TKLQ FRH GKYFKQSAKALE+QVAREARFYGALIRLQQN
Sbjct  120  MTRPKQLPNEHLSDLAVSMATKLQCFRHLGKYFKQSAKALEQQVAREARFYGALIRLQQN  179

Query  573  WKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            WK+K HRM+AA SGNEGFYIDLFDN+L+DPA  FRPS
Sbjct  180  WKVKWHRMVAAASGNEGFYIDLFDNSLYDPAVAFRPS  216



>ref|XP_009781829.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Nicotiana sylvestris]
Length=671

 Score =   327 bits (838),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 189/220 (86%), Gaps = 7/220 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M  DL+IS+DKLPIKR+EF+EE G ERFPS D+GYDEKTV+LIRRIDFAWAVERE+P  K
Sbjct  1    MNGDLEISVDKLPIKRLEFIEEGGAERFPS-DIGYDEKTVNLIRRIDFAWAVEREEPKSK  59

Query  222  qkkssadsssssketsA------NQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVT  383
            ++K  + SSSS+  +S        QPW WQ+LVENL+LAHQEL VIIDLI+TVEANDAVT
Sbjct  60   KQKKKSSSSSSTSTSSKETSSSNQQPWQWQTLVENLRLAHQELQVIIDLIHTVEANDAVT  119

Query  384  VASMTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRL  563
            VA MTRPKQLPNE LSDLAVSM TKLQ FRH GKYFKQSAKALE+QVAREARFYGALIRL
Sbjct  120  VAGMTRPKQLPNEHLSDLAVSMATKLQCFRHLGKYFKQSAKALEQQVAREARFYGALIRL  179

Query  564  QQNWKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            QQNWK+K HRM+AA SGNEGFYIDLFDN+L+DPA  FRPS
Sbjct  180  QQNWKVKWHRMVAAASGNEGFYIDLFDNSLYDPAVAFRPS  219



>ref|XP_006364902.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Solanum tuberosum]
Length=663

 Score =   326 bits (836),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 191/214 (89%), Gaps = 3/214 (1%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M  DL+IS+DKLPIKR+EF+EE G ERFPS D+GYDEKTV+LIRRIDFAWAVERE+PSKK
Sbjct  1    MNGDLEISVDKLPIKRLEFIEEQGAERFPS-DIGYDEKTVNLIRRIDFAWAVEREEPSKK  59

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            QKKSS+ +SS      ++QPW WQSLVENL+LAHQEL VIIDLI+TVEANDAVTVASMTR
Sbjct  60   QKKSSSATSSKETS--SSQPWQWQSLVENLRLAHQELQVIIDLIHTVEANDAVTVASMTR  117

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PKQLPNE LSDLAVSM TKLQ FRH GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+
Sbjct  118  PKQLPNEHLSDLAVSMATKLQCFRHLGKYFKQSAKALEQQVAREARFYGALIRLQQNWKV  177

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            K HRM+AA SGNEGFYIDLFD +L+DPA  FRPS
Sbjct  178  KWHRMVAAASGNEGFYIDLFDTSLYDPAVAFRPS  211



>emb|CDP10383.1| unnamed protein product [Coffea canephora]
Length=665

 Score =   324 bits (831),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 189/215 (88%), Gaps = 2/215 (1%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L IS+DKLPIKR+E +EENG ERFPS DVG++EK V LIRRIDFAWAVERE+PS K
Sbjct  1    MDGNLDISIDKLPIKRLEVIEENGVERFPS-DVGHEEKRVDLIRRIDFAWAVEREEPSSK  59

Query  222  qkkssadsssssk-etsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMT  398
            ++K +  SS+S +   S NQPW WQSL+ENLQLAHQELSVIIDLINT+EAN+ VTVASMT
Sbjct  60   KQKKTTTSSTSKETHNSGNQPWQWQSLLENLQLAHQELSVIIDLINTLEANNDVTVASMT  119

Query  399  RPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWK  578
            RPKQLPNELLSDLAVS  TKLQ FRH G+YFKQSAKALE+QVAREARFYGALIRLQQNWK
Sbjct  120  RPKQLPNELLSDLAVSTATKLQCFRHLGRYFKQSAKALEQQVAREARFYGALIRLQQNWK  179

Query  579  IKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            +KRHR +AA SGNEGFYIDLFDN+L+DPA  FRPS
Sbjct  180  VKRHRAVAAASGNEGFYIDLFDNSLNDPAAAFRPS  214



>ref|XP_004251571.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Solanum lycopersicum]
Length=663

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 190/214 (89%), Gaps = 3/214 (1%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M  +L+IS+DKLPIKR+E++EE G ERFPS D+GYDEKTV+LIRRIDFAWAVERE+PSKK
Sbjct  1    MNGNLEISVDKLPIKRLEYIEEQGAERFPS-DIGYDEKTVNLIRRIDFAWAVEREEPSKK  59

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            QKKSS+ +SS      ++QPW WQSLVENL+LAHQEL VIIDLI+TVEANDAVTVA MTR
Sbjct  60   QKKSSSATSSKETS--SSQPWQWQSLVENLRLAHQELQVIIDLIHTVEANDAVTVAGMTR  117

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PKQLPNE LSDLAVSM TKLQ FRH GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+
Sbjct  118  PKQLPNEHLSDLAVSMATKLQCFRHLGKYFKQSAKALEQQVAREARFYGALIRLQQNWKV  177

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            K HRM+AA SGNEGFYIDLFD +L+DPA  FRPS
Sbjct  178  KWHRMVAAASGNEGFYIDLFDTSLYDPAVAFRPS  211



>gb|EYU29301.1| hypothetical protein MIMGU_mgv1a002570mg [Erythranthe guttata]
Length=657

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 181/214 (85%), Gaps = 3/214 (1%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLPIKR+E +EE G ERFPS DV YDEK V+LIRRIDFAWAVEREDPSKK
Sbjct  1    MDGNLEISLDKLPIKRLESIEEFGSERFPS-DVDYDEKRVNLIRRIDFAWAVEREDPSKK  59

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            +K   A +  S+      Q W W+SLVENLQLAHQELSVIIDLINTVE NDAVTVA MTR
Sbjct  60   RKTDGATAKESTSTN--QQQWQWKSLVENLQLAHQELSVIIDLINTVETNDAVTVAGMTR  117

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE LSDLAVS  TKLQ FR  GKYFKQSAKALE+Q+AREARFYGALIRLQQNWKI
Sbjct  118  PKPLPNEHLSDLAVSTATKLQCFRSLGKYFKQSAKALEEQIAREARFYGALIRLQQNWKI  177

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            K+HR++AA SGNEGFYIDLFDN+L++ A VFRPS
Sbjct  178  KQHRLVAAASGNEGFYIDLFDNSLYNSAAVFRPS  211



>ref|XP_009368825.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Pyrus x bretschneideri]
Length=655

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 173/214 (81%), Gaps = 10/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+  ++ISLDKLPIKR+E +EENG ERFP  DVGYDEK  +LIRRIDFAWAVE+++    
Sbjct  1    MDGKMEISLDKLPIKRLEVIEENGLERFPP-DVGYDEKRQNLIRRIDFAWAVEKDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                       S + SA   W WQS+VENLQLAHQELSVIIDLINTVE NDAVTVASMTR
Sbjct  56   -----NKKQKKSSKESAATQWQWQSMVENLQLAHQELSVIIDLINTVETNDAVTVASMTR  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE +SDLAVS  TKLQ FRH GKYFKQSAKAL++QVAREARFYGALIRLQQNWK+
Sbjct  111  PKPLPNEAMSDLAVSAATKLQCFRHLGKYFKQSAKALDRQVAREARFYGALIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM A+ SGNEGF IDLFDN+L+DPA +FRPS
Sbjct  171  KRQRMAASASGNEGFTIDLFDNSLYDPAAIFRPS  204



>ref|XP_008337314.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Malus domestica]
Length=655

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 173/214 (81%), Gaps = 10/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+  ++ISLDKLPIKR+E +EENG ERFP  DVGYDEK  +LIRRIDFAWAVE+++    
Sbjct  1    MDGKMEISLDKLPIKRLEVIEENGLERFPP-DVGYDEKRQNLIRRIDFAWAVEKDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                       S + SA   W WQS+VENLQLAHQELSVIIDLINTVE NDAVTVASMTR
Sbjct  56   -----NKKQKKSSKESAATQWQWQSMVENLQLAHQELSVIIDLINTVETNDAVTVASMTR  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE +SDLAVS  TKLQ FRH GKYFKQSAKAL++QVAREARFYGALIRLQQNWK+
Sbjct  111  PKPLPNEAMSDLAVSAATKLQCFRHLGKYFKQSAKALDRQVAREARFYGALIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM A+ SGNEGF IDLFDN+L+DPA +FRP+
Sbjct  171  KRQRMAASASGNEGFTIDLFDNSLYDPAAIFRPT  204



>ref|XP_002285089.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Vitis vinifera]
 emb|CAN63500.1| hypothetical protein VITISV_011675 [Vitis vinifera]
 emb|CBI28174.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 173/214 (81%), Gaps = 12/214 (6%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+  ++ISLDKLPIKR++ +EENG ERFP+ DVGYD+K VSLIRRIDFAWAVE++   +K
Sbjct  1    MDGKMEISLDKLPIKRLDAIEENGAERFPT-DVGYDDKRVSLIRRIDFAWAVEKDTKKQK  59

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            +      +           PWPWQSLVENL+LAHQELSVIIDLI+TVEANDAVTVASMTR
Sbjct  60   KASKEEAT-----------PWPWQSLVENLRLAHQELSVIIDLISTVEANDAVTVASMTR  108

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDL VS  TKLQ FRH  KYFKQSAKALE+Q+AREARFYGALIRLQQNWK+
Sbjct  109  PKPLPNEVLSDLGVSAATKLQCFRHLSKYFKQSAKALEQQIAREARFYGALIRLQQNWKV  168

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A+  GNEGF IDLF N+LHDP  VFRPS
Sbjct  169  KRQRVAASAPGNEGFSIDLFSNSLHDPVAVFRPS  202



>ref|XP_010093735.1| hypothetical protein L484_006289 [Morus notabilis]
 gb|EXB54541.1| hypothetical protein L484_006289 [Morus notabilis]
Length=701

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 176/214 (82%), Gaps = 11/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M E +Q+SLDKLP+KR++ +EENG ERFPS DVGYDEK +SLIRRIDFAWAVE+++  K+
Sbjct  1    MNEKVQVSLDKLPVKRLDVIEENGAERFPS-DVGYDEKRLSLIRRIDFAWAVEKDEKKKQ  59

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            +K +    +          PWPWQ++VENLQLA QELSVI+DLINTVEANDAVTVA MTR
Sbjct  60   KKSAKESLT----------PWPWQTMVENLQLAQQELSVIVDLINTVEANDAVTVAGMTR  109

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDLAVS   KLQ FR  GKYFKQSAKALE+QV REARFYGALIRLQQNWK+
Sbjct  110  PKPLPNEVLSDLAVSAAIKLQGFRSLGKYFKQSAKALEQQVVREARFYGALIRLQQNWKV  169

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ AA SGNEGF IDLFDN+L+DPA V+RP+
Sbjct  170  KRQRIAAAASGNEGFTIDLFDNSLYDPASVYRPT  203



>gb|KCW82816.1| hypothetical protein EUGRSUZ_C04186 [Eucalyptus grandis]
Length=554

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 171/214 (80%), Gaps = 11/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L++SLDKLP+KR+EF+EE+G ERFP+ DV YDEK +SLIRRIDFAWA+E++D    
Sbjct  2    MDGNLEVSLDKLPVKRLEFIEESGAERFPT-DVSYDEKRLSLIRRIDFAWALEKDD----  56

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                  +         ++ PW WQS+VENLQLA QELSV++DLINTVEANDAVTVAS+TR
Sbjct  57   ------NKKQKKSAKESSTPWQWQSMVENLQLAQQELSVVLDLINTVEANDAVTVASITR  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LP+E+LSD AVS  TKLQ FRH GKYFKQSAKALE+QVA+EARFYGALIRLQQNWK+
Sbjct  111  PKALPHEVLSDHAVSAATKLQCFRHLGKYFKQSAKALEQQVAKEARFYGALIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A+T G E F IDLFDN++ DP  V RPS
Sbjct  171  KRQRVAASTPGGESFTIDLFDNSITDPTTVIRPS  204



>gb|KDP32381.1| hypothetical protein JCGZ_13306 [Jatropha curcas]
Length=664

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 178/214 (83%), Gaps = 6/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+  ++IS+DKLP+KR+E ++ENG ERFP+ DVGYDEK VSLIRRIDFAWAVE+E     
Sbjct  1    MDGKIEISIDKLPVKRLEAIDENGAERFPT-DVGYDEKRVSLIRRIDFAWAVEKE-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
             ++       S+KE+S+  PWPWQS+VENLQLAHQELS+IIDLINTVEANDAVTV SMTR
Sbjct  55   DEEKKKKQKKSAKESSSTTPWPWQSMVENLQLAHQELSIIIDLINTVEANDAVTVNSMTR  114

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE L+DLAVS  TKLQ +RH GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+
Sbjct  115  PKPLPNEHLADLAVSTATKLQCYRHLGKYFKQSAKALEQQVAREARFYGALIRLQQNWKV  174

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A   GNEGF IDLFDN+L+D A +FRP+
Sbjct  175  KRQRVAAIAPGNEGFTIDLFDNSLYDSASLFRPT  208



>ref|XP_010254371.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Nelumbo nucifera]
Length=667

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 167/213 (78%), Gaps = 13/213 (6%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +++ISLDKLPIKR++ +EENG ERFP  D+G+DEK +SLIRRIDFAWAVE++     
Sbjct  1    MDGNMEISLDKLPIKRLDAIEENGIERFPP-DIGHDEKRLSLIRRIDFAWAVEKD-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                   +           PWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVA M R
Sbjct  55   -------TKKQKTSKETTTPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVAGMIR  107

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PKQLPNE+LSDL+VS  TKLQ FR+ G+YFKQSAK LE+QVAREARFYGALIRLQQNWK+
Sbjct  108  PKQLPNEILSDLSVSAATKLQCFRNLGRYFKQSAKGLEQQVAREARFYGALIRLQQNWKV  167

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRP  680
            KR R+     G+EGF IDLFDN+L DP  +FRP
Sbjct  168  KRQRLPVPAPGSEGFTIDLFDNSLSDPGAIFRP  200



>ref|XP_008242750.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Prunus mume]
Length=654

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 172/214 (80%), Gaps = 10/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+  ++ISLDKLPIKR++ +EENG ERFP  DVGY+EK  SLIRRIDFAWAVE+++    
Sbjct  1    MDGKMEISLDKLPIKRLDVIEENGLERFPP-DVGYEEKRQSLIRRIDFAWAVEKDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                       S + SA   W WQS+VENLQLAHQELSVIIDLINTVE NDAVTVASMTR
Sbjct  56   -----NKKQKKSSKESAATQWQWQSMVENLQLAHQELSVIIDLINTVETNDAVTVASMTR  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK   +E++SDLAVS  TKLQ FRH GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+
Sbjct  111  PKPFHDEVMSDLAVSAATKLQCFRHLGKYFKQSAKALERQVAREARFYGALIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A+ SGNEGF IDLFD++L+DPA VFRPS
Sbjct  171  KRQRVAASASGNEGFTIDLFDSSLYDPAAVFRPS  204



>ref|XP_007204608.1| hypothetical protein PRUPE_ppa002594mg [Prunus persica]
 gb|EMJ05807.1| hypothetical protein PRUPE_ppa002594mg [Prunus persica]
Length=654

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 172/214 (80%), Gaps = 10/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+  ++ISLDKLPIKR++ +EENG ERFP  DVGY+EK  SLIRRIDFAWAVE+++    
Sbjct  1    MDGKMEISLDKLPIKRLDVIEENGLERFPP-DVGYEEKRQSLIRRIDFAWAVEKDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                       S + SA   W WQS+VENLQLAHQELSVIIDLINTVE NDAVTVASMTR
Sbjct  56   -----NKKQKKSSKESAATQWQWQSMVENLQLAHQELSVIIDLINTVETNDAVTVASMTR  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK   +E++SDLAVS  TKLQ FRH GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+
Sbjct  111  PKPFHDEVMSDLAVSAATKLQCFRHLGKYFKQSAKALERQVAREARFYGALIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A+ SGNEGF IDLFD++L+DPA +FRPS
Sbjct  171  KRQRVAASASGNEGFTIDLFDSSLYDPAAIFRPS  204



>emb|CDX88852.1| BnaA03g07970D [Brassica napus]
Length=644

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 172/214 (80%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG ERFPS DVGYD+K VSLIRRIDFAWA+E ED    
Sbjct  1    MDSDMEISLDRLPIKRLESIEENGAERFPS-DVGYDDKRVSLIRRIDFAWALEEED----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              +   +           + W W+ +VENLQLAHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  56   --ELKNNKKKKKTSKEGPEQWQWKGMVENLQLAHQELSVIIDLINTVEANDAVTVAGMTR  113

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK +PNE+LSDLAVS  TKLQS+RH GK+FKQSAK+LE++V REARFYGALIRLQ+NWK+
Sbjct  114  PKPMPNEILSDLAVSTATKLQSYRHLGKFFKQSAKSLEQKVNREARFYGALIRLQRNWKV  173

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R++A+ + NEGF IDL D++L+DPA  FRPS
Sbjct  174  KRQRVLASNASNEGFTIDLSDSSLYDPASGFRPS  207



>ref|XP_010049981.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Eucalyptus grandis]
 gb|KCW82815.1| hypothetical protein EUGRSUZ_C04186 [Eucalyptus grandis]
Length=651

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 171/214 (80%), Gaps = 11/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L++SLDKLP+KR+EF+EE+G ERFP+ DV YDEK +SLIRRIDFAWA+E++D    
Sbjct  2    MDGNLEVSLDKLPVKRLEFIEESGAERFPT-DVSYDEKRLSLIRRIDFAWALEKDD----  56

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                  +         ++ PW WQS+VENLQLA QELSV++DLINTVEANDAVTVAS+TR
Sbjct  57   ------NKKQKKSAKESSTPWQWQSMVENLQLAQQELSVVLDLINTVEANDAVTVASITR  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LP+E+LSD AVS  TKLQ FRH GKYFKQSAKALE+QVA+EARFYGALIRLQQNWK+
Sbjct  111  PKALPHEVLSDHAVSAATKLQCFRHLGKYFKQSAKALEQQVAKEARFYGALIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A+T G E F IDLFDN++ DP  V RPS
Sbjct  171  KRQRVAASTPGGESFTIDLFDNSITDPTTVIRPS  204



>ref|XP_004141551.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Cucumis sativus]
 ref|XP_004156208.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Cucumis sativus]
 gb|KGN52676.1| hypothetical protein Csa_5G650410 [Cucumis sativus]
Length=662

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 170/214 (79%), Gaps = 10/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ED+++SLDKLP+KR+E +EENG ERFPS DVGY+EK +SLIRRIDFAWA+E++     
Sbjct  1    MDEDMKVSLDKLPVKRLEAIEENGLERFPS-DVGYEEKRLSLIRRIDFAWAIEKD-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                            ++ PW WQS++ENLQLAHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  55   ----DDKKKQKKSSKESSTPWQWQSMIENLQLAHQELSVIIDLINTVEANDAVTVAGMTR  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+L+DL VS+ TKLQ FRH GKYFKQSAK LE+QVAREARFYGALIRLQQNWK+
Sbjct  111  PKPLPNEVLADLGVSVATKLQCFRHLGKYFKQSAKGLERQVAREARFYGALIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A    NEGF IDLFDN+  DP+ VFRPS
Sbjct  171  KRQRVAAPAPANEGFTIDLFDNSSCDPSSVFRPS  204



>ref|XP_009131782.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Brassica rapa]
Length=645

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 172/214 (80%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG ERFPS DVGYD+K VSLIRRIDFAWA+E ED    
Sbjct  1    MDSDMEISLDRLPIKRLESIEENGAERFPS-DVGYDDKRVSLIRRIDFAWALEEED----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              +   +           + W W+ +VENLQLAHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  56   --ELKNNKKKKKTSKEGPEQWQWKGMVENLQLAHQELSVIIDLINTVEANDAVTVAGMTR  113

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK +PNE+LSDLAVS  TKLQS+RH GK+FKQSAK+LE++V REARFYGALIRLQ+NWK+
Sbjct  114  PKPMPNEILSDLAVSTATKLQSYRHLGKFFKQSAKSLEQKVNREARFYGALIRLQRNWKV  173

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R++A+ + NEGF IDL D++++DPA  FRPS
Sbjct  174  KRQRVLASNASNEGFTIDLSDSSIYDPASGFRPS  207



>gb|KJB07725.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=560

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLPIKR+E +EENG ER+PS D  YDEK VSLIRRIDFAWA+E ++    
Sbjct  1    MDGNLEISLDKLPIKRLESIEENGVERYPS-DSSYDEKRVSLIRRIDFAWALEDDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              +             A+  W WQS+VENLQLAHQELSVIIDLINTV+ANDAVTVA MTR
Sbjct  56   --ERERKKRQKKSSKDASATWQWQSMVENLQLAHQELSVIIDLINTVDANDAVTVAGMTR  113

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDLAVS  TKLQ +R  GKYFKQSAKALE+Q+AREARFYGALIRLQQNWK+
Sbjct  114  PKPLPNEVLSDLAVSAATKLQCYRQLGKYFKQSAKALEEQIAREARFYGALIRLQQNWKV  173

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ AA S +EGF IDLFDN+L+D A + RPS
Sbjct  174  KRQRLAAAASSSEGFIIDLFDNSLYDSAAMCRPS  207



>ref|XP_008459609.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Cucumis melo]
Length=662

 Score =   292 bits (747),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 170/214 (79%), Gaps = 10/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+EDL++SLDKLPIKR+E +EENG ERFP+ DVGY+EK +SLIRRIDFAWA+E++     
Sbjct  1    MDEDLKVSLDKLPIKRLEAIEENGLERFPT-DVGYEEKRLSLIRRIDFAWAIEKD-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                            ++ PW WQ+++ENLQLAHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  55   ----DEKKKQKKSSKESSTPWQWQNMIENLQLAHQELSVIIDLINTVEANDAVTVAGMTR  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+L+DL VS+ TKLQ FRH GKYFKQSAK LE+QVAREARFYGALIRLQQNWK+
Sbjct  111  PKPLPNEVLADLGVSVATKLQCFRHLGKYFKQSAKGLERQVAREARFYGALIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A    NEGF IDLFDN+  DP+ VFRPS
Sbjct  171  KRQRVAAPAPANEGFTIDLFDNSSCDPSSVFRPS  204



>ref|XP_004300164.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Fragaria vesca subsp. vesca]
Length=655

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 173/214 (81%), Gaps = 9/214 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+  L+ISLDKLPIKR++ +EENG ERFP  +VGY+EK  SLIRRIDFAWAVE++D    
Sbjct  1    MDGKLEISLDKLPIKRLDVIEENGLERFPP-EVGYEEKRESLIRRIDFAWAVEKDD----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                 +     S+ETSA   W +QS+V+NL LAHQELSVI+DLINTVEANDAVTVASMTR
Sbjct  56   ----KSKQKKRSRETSAPAQWEFQSMVDNLHLAHQELSVIVDLINTVEANDAVTVASMTR  111

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            P+  PNE LSDLAVS  TKLQ FRH GKYFKQSA ALE+Q+AREARFYGALIRLQQNWK+
Sbjct  112  PRPFPNEALSDLAVSAATKLQCFRHLGKYFKQSANALEQQMAREARFYGALIRLQQNWKV  171

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R +A  SGNEGF IDLFDN+L+DPA +FRPS
Sbjct  172  KRQRAVALASGNEGFTIDLFDNSLYDPAGIFRPS  205



>gb|KJB07722.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=586

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLPIKR+E +EENG ER+PS D  YDEK VSLIRRIDFAWA+E ++    
Sbjct  1    MDGNLEISLDKLPIKRLESIEENGVERYPS-DSSYDEKRVSLIRRIDFAWALEDDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              +             A+  W WQS+VENLQLAHQELSVIIDLINTV+ANDAVTVA MTR
Sbjct  56   --ERERKKRQKKSSKDASATWQWQSMVENLQLAHQELSVIIDLINTVDANDAVTVAGMTR  113

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDLAVS  TKLQ +R  GKYFKQSAKALE+Q+AREARFYGALIRLQQNWK+
Sbjct  114  PKPLPNEVLSDLAVSAATKLQCYRQLGKYFKQSAKALEEQIAREARFYGALIRLQQNWKV  173

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ AA S +EGF IDLFDN+L+D A + RPS
Sbjct  174  KRQRLAAAASSSEGFIIDLFDNSLYDSAAMCRPS  207



>ref|XP_006374395.1| hypothetical protein POPTR_0015s06780g [Populus trichocarpa]
 gb|ERP52192.1| hypothetical protein POPTR_0015s06780g [Populus trichocarpa]
Length=667

 Score =   291 bits (744),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 178/214 (83%), Gaps = 3/214 (1%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+  L++SLDKLP+KR+E +EENG ERFP+ D+GYDEK V+LIRRIDFAWAVE+E   K+
Sbjct  1    MDGKLEMSLDKLPVKRLESIEENGFERFPT-DIGYDEKQVALIRRIDFAWAVEKE--DKE  57

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            +K+      SS + +S   PWPWQ++VENL LAHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  58   KKQKKKQKKSSRESSSTTTPWPWQNMVENLHLAHQELSVIIDLINTVEANDAVTVAGMTR  117

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+L+DLAVS  TKLQ +R+ GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+
Sbjct  118  PKPLPNEILADLAVSTATKLQCYRNLGKYFKQSAKALEQQVAREARFYGALIRLQQNWKV  177

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A   GNEGF IDLFDN+L+D   VF+PS
Sbjct  178  KRQRVAAIAPGNEGFMIDLFDNSLYDSVAVFQPS  211



>emb|CDX70919.1| BnaC03g10030D [Brassica napus]
Length=644

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 171/214 (80%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG ERFPS DVGYD+K VSLIRRIDFAWA+E ED    
Sbjct  1    MDSDMEISLDRLPIKRLESIEENGAERFPS-DVGYDDKRVSLIRRIDFAWALEEED----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              +   +           + W W+ +VENLQ AHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  56   --ELKNNKKKKKTSKEGPEQWQWKGMVENLQSAHQELSVIIDLINTVEANDAVTVAGMTR  113

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK +PNE+LSDLAVS  TKLQS+RH GK+FKQSAK+LE++V REARFYGALIRLQ+NWK+
Sbjct  114  PKPIPNEILSDLAVSTATKLQSYRHLGKFFKQSAKSLEQKVNREARFYGALIRLQRNWKV  173

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R++A+ + NEGF IDL D++L+DPA  FRPS
Sbjct  174  KRQRVLASNASNEGFTIDLSDSSLYDPASGFRPS  207



>gb|KHG17744.1| mediator of rna polymerase ii transcription subunit 17 [Gossypium 
arboreum]
Length=664

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLPIKR++ +EENG ER+PS D  YDEK VSLIRRIDFAWAVE ++    
Sbjct  1    MDGNLEISLDKLPIKRLDSIEENGVERYPS-DSSYDEKRVSLIRRIDFAWAVEDDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              +             A+  W WQS+VENLQLAHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  56   --ERERKKRQKKSSKDASATWQWQSMVENLQLAHQELSVIIDLINTVEANDAVTVAGMTR  113

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDLAVS  TKLQ +R  GKYFKQSAKALE+Q+AREARFYGALIRLQQNWK+
Sbjct  114  PKPLPNEVLSDLAVSAATKLQCYRQLGKYFKQSAKALEEQIAREARFYGALIRLQQNWKV  173

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ AA S +EGF IDLFDN+L+D A + RPS
Sbjct  174  KRQRLAAAASSSEGFIIDLFDNSLYDSAAMCRPS  207



>gb|KJB07724.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=630

 Score =   289 bits (739),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLPIKR+E +EENG ER+PS D  YDEK VSLIRRIDFAWA+E ++    
Sbjct  1    MDGNLEISLDKLPIKRLESIEENGVERYPS-DSSYDEKRVSLIRRIDFAWALEDDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              +             A+  W WQS+VENLQLAHQELSVIIDLINTV+ANDAVTVA MTR
Sbjct  56   --ERERKKRQKKSSKDASATWQWQSMVENLQLAHQELSVIIDLINTVDANDAVTVAGMTR  113

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDLAVS  TKLQ +R  GKYFKQSAKALE+Q+AREARFYGALIRLQQNWK+
Sbjct  114  PKPLPNEVLSDLAVSAATKLQCYRQLGKYFKQSAKALEEQIAREARFYGALIRLQQNWKV  173

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ AA S +EGF IDLFDN+L+D A + RPS
Sbjct  174  KRQRLAAAASSSEGFIIDLFDNSLYDSAAMCRPS  207



>gb|KJB07721.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=663

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLPIKR+E +EENG ER+PS D  YDEK VSLIRRIDFAWA+E ++    
Sbjct  1    MDGNLEISLDKLPIKRLESIEENGVERYPS-DSSYDEKRVSLIRRIDFAWALEDDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              +             A+  W WQS+VENLQLAHQELSVIIDLINTV+ANDAVTVA MTR
Sbjct  56   --ERERKKRQKKSSKDASATWQWQSMVENLQLAHQELSVIIDLINTVDANDAVTVAGMTR  113

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDLAVS  TKLQ +R  GKYFKQSAKALE+Q+AREARFYGALIRLQQNWK+
Sbjct  114  PKPLPNEVLSDLAVSAATKLQCYRQLGKYFKQSAKALEEQIAREARFYGALIRLQQNWKV  173

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ AA S +EGF IDLFDN+L+D A + RPS
Sbjct  174  KRQRLAAAASSSEGFIIDLFDNSLYDSAAMCRPS  207



>gb|KJB07723.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=662

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLPIKR+E +EENG ER+PS D  YDEK VSLIRRIDFAWA+E ++    
Sbjct  1    MDGNLEISLDKLPIKRLESIEENGVERYPS-DSSYDEKRVSLIRRIDFAWALEDDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              +             A+  W WQS+VENLQLAHQELSVIIDLINTV+ANDAVTVA MTR
Sbjct  56   --ERERKKRQKKSSKDASATWQWQSMVENLQLAHQELSVIIDLINTVDANDAVTVAGMTR  113

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDLAVS  TKLQ +R  GKYFKQSAKALE+Q+AREARFYGALIRLQQNWK+
Sbjct  114  PKPLPNEVLSDLAVSAATKLQCYRQLGKYFKQSAKALEEQIAREARFYGALIRLQQNWKV  173

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ AA S +EGF IDLFDN+L+D A + RPS
Sbjct  174  KRQRLAAAASSSEGFIIDLFDNSLYDSAAMCRPS  207



>ref|XP_006475818.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Citrus sinensis]
 gb|KDO80287.1| hypothetical protein CISIN_1g006207mg [Citrus sinensis]
Length=657

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 171/214 (80%), Gaps = 6/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M  +L+IS+DKLP+KR++ +EE G ERFP  DVGYDEK  SLIRRIDFAWAVE++D    
Sbjct  1    MNGNLEISVDKLPVKRLDAIEETGAERFPP-DVGYDEKRESLIRRIDFAWAVEKDD----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              K    SS  S  ++   PW WQ++VENLQ AHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  56   -NKRLKKSSKESSSSATTTPWQWQNMVENLQFAHQELSVIIDLINTVEANDAVTVAGMTR  114

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDL+VS  TKLQ +RH G YFKQSAK+LE+Q+A+EARFYGALIRLQQNWK+
Sbjct  115  PKALPNEVLSDLSVSAATKLQCYRHLGIYFKQSAKSLEQQIAKEARFYGALIRLQQNWKV  174

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A  SGNEGF IDLFDN+L+D A V RPS
Sbjct  175  KRQRVAAPASGNEGFTIDLFDNSLYDSAPVSRPS  208



>ref|XP_006450970.1| hypothetical protein CICLE_v10007689mg [Citrus clementina]
 gb|ESR64210.1| hypothetical protein CICLE_v10007689mg [Citrus clementina]
Length=657

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M  +L+IS+DKLP+KR++ +EE G ERFP  DVGYDEK  SLIRRIDFAWAVE++D    
Sbjct  1    MNGNLEISVDKLPVKRLDAIEETGAERFPP-DVGYDEKRESLIRRIDFAWAVEKDD----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
              K     S  S  ++   PW WQ++VENLQ AHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  56   -NKRLKKRSKESSSSATTTPWQWQNMVENLQFAHQELSVIIDLINTVEANDAVTVAGMTR  114

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDL+VS  TKLQ +RH G YFKQSAK+LE+Q+A+EARFYGALIRLQQNWK+
Sbjct  115  PKALPNEVLSDLSVSAATKLQCYRHLGIYFKQSAKSLEQQIAKEARFYGALIRLQQNWKV  174

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A  SGNEGF IDLFDN+L+D A V RPS
Sbjct  175  KRQRVAAPASGNEGFTIDLFDNSLYDSAPVSRPS  208



>gb|AIU49750.1| RNA polymerase II transcription mediator, partial [Solanum tuberosum]
Length=516

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 160/208 (77%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            IS+DKLPIKR+EF+EE G ERFPS D+GYDEKTV+LIRRIDFAWAV              
Sbjct  1    ISVDKLPIKRLEFIEEQGAERFPS-DIGYDEKTVNLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQSLVENL+LAHQEL VIIDLI+TVEANDAVTVASMTRPKQLPN
Sbjct  46   --------------WQWQSLVENLRLAHQELQVIIDLIHTVEANDAVTVASMTRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E LSDLAVSM TKLQ FRH GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+K HR  
Sbjct  92   EHLSDLAVSMATKLQCFRHLGKYFKQSAKALEQQVAREARFYGALIRLQQNWKVKWHR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                GNEGFYIDLFD +L+DPA   RPS
Sbjct  150  ----GNEGFYIDLFDTSLYDPA---RPS  170



>ref|XP_011007274.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Populus euphratica]
 ref|XP_011007275.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Populus euphratica]
 ref|XP_011007276.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Populus euphratica]
Length=667

 Score =   287 bits (734),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 177/214 (83%), Gaps = 3/214 (1%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+  L++SLDKLP+KR+E +EENG ERFP+ D+GYDEK VSLIRRIDFAWA+E+E   K+
Sbjct  1    MDGKLEMSLDKLPVKRLESIEENGVERFPT-DIGYDEKQVSLIRRIDFAWALEKE--DKE  57

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            +K+      SS + +S   PWPWQ++VENL LAHQEL+VI+DLI+TVEANDAVTVA MTR
Sbjct  58   KKQKKKQKKSSRESSSTTTPWPWQNMVENLHLAHQELTVIVDLIHTVEANDAVTVAGMTR  117

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+L+DLAVS  TKLQ +R+ GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+
Sbjct  118  PKPLPNEILADLAVSTATKLQCYRNLGKYFKQSAKALEQQVAREARFYGALIRLQQNWKV  177

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A   GNEGF IDLFDN+L+D   VF PS
Sbjct  178  KRQRVAAIAPGNEGFMIDLFDNSLYDSVAVFHPS  211



>gb|AIU49760.1| RNA polymerase II transcription mediator, partial [Solanum lycopersicum]
Length=516

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 159/208 (76%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            IS+DKLPIKR+E++EE G ERFPS D+GYDEKTV+LIRRIDFAWAV              
Sbjct  1    ISVDKLPIKRLEYIEEQGAERFPS-DIGYDEKTVNLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQSLVENL+LAHQEL VIIDLI+TVEANDAVTVA MTRPKQLPN
Sbjct  46   --------------WQWQSLVENLRLAHQELQVIIDLIHTVEANDAVTVAGMTRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E LSDLAVSM TKLQ FRH GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+K HR  
Sbjct  92   EHLSDLAVSMATKLQCFRHLGKYFKQSAKALEQQVAREARFYGALIRLQQNWKVKWHR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                GNEGFYIDLFD +L+DPA   RPS
Sbjct  150  ----GNEGFYIDLFDTSLYDPA---RPS  170



>ref|XP_006400585.1| hypothetical protein EUTSA_v10012923mg [Eutrema salsugineum]
 gb|ESQ42038.1| hypothetical protein EUTSA_v10012923mg [Eutrema salsugineum]
Length=650

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 169/214 (79%), Gaps = 8/214 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG ERFPS DV YD+K VSLIRRIDFAWA+E E     
Sbjct  1    MDSDMEISLDRLPIKRLESIEENGAERFPS-DVNYDDKRVSLIRRIDFAWALEEE-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                            +++ W W+ +VENLQLAHQELSVIIDLINTVEANDAVTVA MT+
Sbjct  55   --DELKKKKQKKSSKESSEQWQWKGMVENLQLAHQELSVIIDLINTVEANDAVTVAGMTK  112

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK +PNELLSDLAVS  TKLQS+RH GKYFKQSAKALE++V REARFYGALIRLQ+NWK+
Sbjct  113  PKPMPNELLSDLAVSTATKLQSYRHLGKYFKQSAKALEQKVNREARFYGALIRLQRNWKV  172

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R++A+ + NEGF IDL D++L+DP   FRPS
Sbjct  173  KRQRVLASNASNEGFTIDLSDSSLYDPTSGFRPS  206



>ref|XP_002873986.1| hypothetical protein ARALYDRAFT_351112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50245.1| hypothetical protein ARALYDRAFT_351112 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 175/214 (82%), Gaps = 8/214 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG ERFPS DVGYD+K VSLIRRIDFAWA+E ED  KK
Sbjct  1    MDSDMEISLDRLPIKRLESIEENGAERFPS-DVGYDDKRVSLIRRIDFAWALEEEDELKK  59

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            +K+  +   S+       + W W+ +VENLQLAHQELSVIIDLI+TV+ANDAVTVA MTR
Sbjct  60   KKQKKSSKDSA-------EQWKWKGMVENLQLAHQELSVIIDLIDTVQANDAVTVAGMTR  112

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDLAVS  TKLQ +R+ G YFKQSAKALE+++ REARFYGALIRLQ+NWK+
Sbjct  113  PKPLPNEILSDLAVSTATKLQGYRNLGNYFKQSAKALEQKINREARFYGALIRLQRNWKV  172

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM+A+ + NEGF IDL D++LHDP   FRPS
Sbjct  173  KRQRMLASNASNEGFTIDLSDSSLHDPTSGFRPS  206



>gb|KFK26261.1| hypothetical protein AALP_AA8G224100 [Arabis alpina]
Length=650

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 167/214 (78%), Gaps = 8/214 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG E FPS DVGYD+K VSLIRRIDFAWA+E ED    
Sbjct  1    MDSDMEISLDRLPIKRLESIEENGAEHFPS-DVGYDDKRVSLIRRIDFAWALEEED----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                            +++ WPW+ ++ENL LA+QELSVIIDLINTVEANDAVTV  MTR
Sbjct  56   ---DLKTKKQKKSSKESSEQWPWKGMIENLHLANQELSVIIDLINTVEANDAVTVTGMTR  112

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK L +E+L+DLAVS  TKLQS+RH GKYF QS+KALE+++ REARFYGALIRLQ+NWK+
Sbjct  113  PKPLASEILADLAVSTATKLQSYRHLGKYFNQSSKALEQKIDREARFYGALIRLQRNWKV  172

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM+A+ + NEGF IDL D++L+DP   FRPS
Sbjct  173  KRQRMLASNASNEGFTIDLSDSSLYDPTSGFRPS  206



>ref|XP_010493125.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Camelina sativa]
Length=653

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 167/214 (78%), Gaps = 8/214 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG E FPS DVGYD+K VSLIRRIDFAWA+E E     
Sbjct  1    MDNDMEISLDRLPIKRLESIEENGAEHFPS-DVGYDDKRVSLIRRIDFAWALEEE-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                             ++ W W+ +VENLQLAHQELSVIIDLI+TV+ANDAVTVA MTR
Sbjct  55   --DELKKKKQKKSSKDTSEQWKWKGMVENLQLAHQELSVIIDLIDTVQANDAVTVAGMTR  112

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK +PNE+LSDLAVS  TKLQ +R+ GKYFKQSAKALE+++ REARFYGALIRLQ+NWK+
Sbjct  113  PKPMPNEILSDLAVSTATKLQGYRNLGKYFKQSAKALEQKINREARFYGALIRLQRNWKV  172

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM+A+ + NEGF IDL D++L+DP   FRPS
Sbjct  173  KRQRMLASNASNEGFTIDLSDSSLYDPTSGFRPS  206



>gb|AIU49763.1| RNA polymerase II transcription mediator, partial [Vitis vinifera]
Length=516

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 156/208 (75%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR++ +EENG ERFP+ DVGYD+K VSLIRRIDFAWAV              
Sbjct  1    ISLDKLPIKRLDAIEENGAERFPT-DVGYDDKRVSLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQSLVENL+LAHQELSVIIDLI+TVEANDAVTVASMTRPK LPN
Sbjct  46   --------------WPWQSLVENLRLAHQELSVIIDLISTVEANDAVTVASMTRPKPLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDL VS  TKLQ FRH  KYFKQSAKALE+Q+AREARFYGALIRLQQNWK+KR R  
Sbjct  92   EVLSDLGVSAATKLQCFRHLSKYFKQSAKALEQQIAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                GNEGF IDLF N+LHDP    RPS
Sbjct  150  ----GNEGFSIDLFSNSLHDPV---RPS  170



>gb|EPS70468.1| hypothetical protein M569_04289, partial [Genlisea aurea]
Length=582

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 158/184 (86%), Gaps = 6/184 (3%)
 Frame = +3

Query  132  SDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssadsssssketsANQPWPWQSLVENL  311
            S+VGY+EK VSLIR+IDFAWAVEREDPSKKQK    ++SS      + Q W WQSLVE+L
Sbjct  1    SNVGYEEKRVSLIRKIDFAWAVEREDPSKKQKTDGKEASS------SQQHWQWQSLVESL  54

Query  312  QLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYF  491
            +LAHQELSVIIDLINTVEANDAVTVA MTRPK L NE LSDL+VS+ TKLQ FR  GKYF
Sbjct  55   RLAHQELSVIIDLINTVEANDAVTVAGMTRPKLLLNESLSDLSVSIATKLQCFRSLGKYF  114

Query  492  KQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFV  671
            KQSAKALE+Q AREARFYGALIRLQQNWKIKRHR++AA SGNEGFYIDLFDN+LHD A V
Sbjct  115  KQSAKALEEQTAREARFYGALIRLQQNWKIKRHRLVAAASGNEGFYIDLFDNSLHDLAVV  174

Query  672  FRPS  683
            FRPS
Sbjct  175  FRPS  178



>ref|XP_003525658.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X1 [Glycine max]
 ref|XP_006579749.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X2 [Glycine max]
 gb|KHN27409.1| hypothetical protein glysoja_022118 [Glycine soja]
Length=659

 Score =   276 bits (707),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 158/208 (76%), Gaps = 11/208 (5%)
 Frame = +3

Query  54   LQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkks  233
            LQISLDKLPIKR++ +EENG ERFP  DV YDEK +SLIRRIDFAWAVE++         
Sbjct  7    LQISLDKLPIKRLDSIEENGIERFPP-DVDYDEKRLSLIRRIDFAWAVEKD---------  56

Query  234  sadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQL  413
                         + PW WQ +VENLQLAHQELSVIIDLINTVEANDAVTVASMTRPK L
Sbjct  57   EEKKKKQKSSKETSTPWQWQGMVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKLL  116

Query  414  PNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHR  593
            PNE LSDLAVS  TKLQ +RH GKYFKQSAKA E+QVAREARFYGALIRLQQNWK+KR R
Sbjct  117  PNEALSDLAVSAATKLQCYRHVGKYFKQSAKAFEQQVAREARFYGALIRLQQNWKVKRQR  176

Query  594  MMAATSGNEGFYIDLFDNTLHDPAFVFR  677
              A   GNEGF  DLFDN+ +D A + R
Sbjct  177  QAAIVPGNEGFTFDLFDNS-YDQAAIIR  203



>ref|XP_010454320.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Camelina sativa]
Length=653

 Score =   276 bits (706),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 168/214 (79%), Gaps = 8/214 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG E FPS DVGYD+K VSLIRRIDFAWA+E E     
Sbjct  1    MDSDMEISLDRLPIKRLESIEENGAEHFPS-DVGYDDKRVSLIRRIDFAWALEEE-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                            +++ W W+ +VENLQLAHQELSVIIDLI+TV+ANDAVTVA MTR
Sbjct  55   --DELKKKKQKKSSKDSSEQWKWKGMVENLQLAHQELSVIIDLIDTVQANDAVTVAGMTR  112

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK +PNE+LSDLAVS  TKLQ +R+ GKYFKQSAKALE+++ REARFYGALIRLQ+NWK+
Sbjct  113  PKPMPNEILSDLAVSTATKLQGYRNLGKYFKQSAKALEQKINREARFYGALIRLQRNWKV  172

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM+A+ + NEGF IDL D++L+DP   FRPS
Sbjct  173  KRQRMLASNASNEGFTIDLSDSSLYDPTSGFRPS  206



>gb|AIU49748.1| RNA polymerase II transcription mediator, partial [Manihot esculenta]
Length=517

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 156/208 (75%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLP+KR+E +EENG ERFP+ D+GYDEK VSLIRRIDFAWAV              
Sbjct  1    ISLDKLPVKRLEAIEENGVERFPT-DIGYDEKRVSLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQS+VENLQLA QELSV+IDLINTVEANDAVTVASMTRPK LPN
Sbjct  46   --------------WPWQSMVENLQLALQELSVVIDLINTVEANDAVTVASMTRPKPLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E L+DLAVS  TKLQ +RH GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+KR R  
Sbjct  92   EHLADLAVSTATKLQCYRHLGKYFKQSAKALEQQVAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                 NEGF IDLFDN+L+D A   RPS
Sbjct  150  ----SNEGFTIDLFDNSLYDSA---RPS  170



>ref|XP_006286416.1| hypothetical protein CARUB_v10002972mg [Capsella rubella]
 gb|EOA19314.1| hypothetical protein CARUB_v10002972mg [Capsella rubella]
Length=651

 Score =   274 bits (700),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 166/214 (78%), Gaps = 8/214 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG E FPS DV YD+K VSLIRRIDFAWA+E E     
Sbjct  1    MDSDMEISLDRLPIKRLESIEENGAEHFPS-DVDYDDKRVSLIRRIDFAWALEEE-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                            + + W W+ +VENLQLAHQELSVIIDLI+TV+ANDAVTVA MTR
Sbjct  55   --DELKKKKQKKSSKDSTEQWKWKGMVENLQLAHQELSVIIDLIDTVQANDAVTVAGMTR  112

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK +PNE+LSDLAVS  TKLQ +R+ GKYFKQSAKALE+++ REARFYGALIRLQ+NWK+
Sbjct  113  PKPMPNEILSDLAVSTATKLQGYRNLGKYFKQSAKALEQKINREARFYGALIRLQRNWKV  172

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM+A+ + NEGF IDL D++L+DP   FRPS
Sbjct  173  KRQRMLASNASNEGFTIDLSDSSLYDPTSGFRPS  206



>ref|XP_007013390.1| RNA polymerase II transcription mediators isoform 1 [Theobroma 
cacao]
 ref|XP_007013391.1| RNA polymerase II transcription mediators isoform 1 [Theobroma 
cacao]
 gb|EOY31009.1| RNA polymerase II transcription mediators isoform 1 [Theobroma 
cacao]
 gb|EOY31010.1| RNA polymerase II transcription mediators isoform 1 [Theobroma 
cacao]
Length=663

 Score =   274 bits (701),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 171/214 (80%), Gaps = 10/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLP++ ++ +EENG ER+P  ++ YDEK VSLIRRIDFAWA+E ++  ++
Sbjct  1    MDGNLEISLDKLPVRALDAIEENGVERYPH-ELSYDEKRVSLIRRIDFAWALETDEERER  59

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            +KK    +S       A   W    LVENLQLAHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  60   KKKQKKKNSKD-----ATATW----LVENLQLAHQELSVIIDLINTVEANDAVTVAGMTR  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDLAVS  TKLQ +RH GKYFKQSAKALE+Q+AREARFYGALIRLQQNWK+
Sbjct  111  PKPLPNEVLSDLAVSAATKLQCYRHLGKYFKQSAKALEQQIAREARFYGALIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+ A +S NEGF IDLFDN+L+D A + RPS
Sbjct  171  KRQRVAAPSSSNEGFTIDLFDNSLYDSATISRPS  204



>ref|XP_003549778.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X1 [Glycine max]
 ref|XP_006600757.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X2 [Glycine max]
 gb|KHN15120.1| hypothetical protein glysoja_011738 [Glycine soja]
Length=660

 Score =   274 bits (701),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 157/209 (75%), Gaps = 10/209 (5%)
 Frame = +3

Query  54   LQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkks  233
            LQISLDKLPIKR++ +EENG ERFP  DV YDEK +SLIRRIDFAWAVE++         
Sbjct  7    LQISLDKLPIKRLDSIEENGIERFPL-DVDYDEKRLSLIRRIDFAWAVEKD--------E  57

Query  234  sadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQL  413
                         + PW WQ +VENLQLAHQELSVIIDLINTVEANDAVTVASMTRPK L
Sbjct  58   EKKKKKQKSSKETSAPWQWQGMVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKLL  117

Query  414  PNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHR  593
            PNE LSDLAVS  TKLQ +RH GKYFKQSAKA E+QVAREARFYGALIRLQQNWK+KR R
Sbjct  118  PNEALSDLAVSAATKLQCYRHVGKYFKQSAKAFEQQVAREARFYGALIRLQQNWKVKRQR  177

Query  594  MMAATSGNEGFYIDLFDNTLHDPAFVFRP  680
              A   GNEGF  DL DN+ +D A + R 
Sbjct  178  QAAIVPGNEGFTFDLLDNS-YDQAAIIRS  205



>ref|XP_010420856.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X1 [Camelina sativa]
Length=653

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 168/214 (79%), Gaps = 8/214 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG E FPS DVGYD+K VSLIRRIDFAWA+E E     
Sbjct  1    MDSDIEISLDRLPIKRLESIEENGAEHFPS-DVGYDDKRVSLIRRIDFAWALEEE-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                            +++ W W+ +VENLQLA+QELSVIIDLI+TV+ANDAVTVA MTR
Sbjct  55   --DELKKKKQKKSSKDSSEQWKWKGMVENLQLANQELSVIIDLIDTVQANDAVTVAGMTR  112

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK +PNE+LSDLAVS  TKLQ +R+ GKYFKQSAKALE+++ REARFYGALIRLQ+NWK+
Sbjct  113  PKPMPNEILSDLAVSTATKLQGYRNLGKYFKQSAKALEQKINREARFYGALIRLQRNWKV  172

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM+A+ + NEGF IDL D++L+DP   FRPS
Sbjct  173  KRQRMLASNASNEGFTIDLSDSSLYDPTSGFRPS  206



>ref|NP_197517.3| RNA polymerase II transcription mediator [Arabidopsis thaliana]
 sp|F4K460.1|MED17_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
17 [Arabidopsis thaliana]
 gb|AED92808.1| RNA polymerase II transcription mediator [Arabidopsis thaliana]
Length=653

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 173/214 (81%), Gaps = 8/214 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ D++ISLD+LPIKR+E +EENG ERFPS DV YD+K VSLIRRIDFAWA+E ED  KK
Sbjct  1    MDSDMEISLDRLPIKRLESIEENGAERFPS-DVDYDDKRVSLIRRIDFAWALEEEDELKK  59

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            +K+  +   S        + W W+ +VENLQLAHQEL+VIIDLI+TV+ANDAVTVA MTR
Sbjct  60   KKQKKSSKDSV-------EQWKWKGMVENLQLAHQELTVIIDLIDTVQANDAVTVAGMTR  112

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK +PNE+LSDLAVS  TKLQ +R+ G YFKQSAKALE+++ REARFYGALIRLQ+NWK+
Sbjct  113  PKPMPNEILSDLAVSTATKLQGYRNLGNYFKQSAKALEQKINREARFYGALIRLQRNWKV  172

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM+A+ + NEGF IDL D++L+DP   FRPS
Sbjct  173  KRQRMLASNASNEGFTIDLSDSSLYDPTSGFRPS  206



>ref|XP_007154971.1| hypothetical protein PHAVU_003G161800g [Phaseolus vulgaris]
 gb|ESW26965.1| hypothetical protein PHAVU_003G161800g [Phaseolus vulgaris]
Length=663

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 158/209 (76%), Gaps = 11/209 (5%)
 Frame = +3

Query  51   DLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkk  230
            DLQISLDKLPIKR++ +EENG ERFP  DV YDEK +SLIRRIDFAWA+E++        
Sbjct  6    DLQISLDKLPIKRLDSIEENGMERFPP-DVDYDEKRLSLIRRIDFAWAIEKD--------  56

Query  231  ssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQ  410
                          + PW WQS+VENLQLAHQELSVIIDLINTVEANDAVTVASMTRPK 
Sbjct  57   -EEKKKQKKSSKETSTPWQWQSMVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKL  115

Query  411  LPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRH  590
             PNE LSDLAVS  +KLQ +R  GKYFKQSAKA E+QVAREARFYGALIRLQQNWK+KR 
Sbjct  116  QPNEALSDLAVSAASKLQCYRQVGKYFKQSAKAFEQQVAREARFYGALIRLQQNWKVKRQ  175

Query  591  RMMAATSGNEGFYIDLFDNTLHDPAFVFR  677
            R  A   GNEGF  DLFDN+ +D A + R
Sbjct  176  RQAAIVPGNEGFTFDLFDNS-YDQASIIR  203



>gb|AES91489.2| RNA polymerase II transcription mediators protein [Medicago truncatula]
Length=660

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 162/216 (75%), Gaps = 14/216 (6%)
 Frame = +3

Query  42   MEE--DLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPs  215
            MEE  +LQ+SLDKLPIKR++ +EENG+ERFP  DV YDEK VSLIRRIDFAWA+E++   
Sbjct  1    MEEGMELQLSLDKLPIKRLDSIEENGNERFPL-DVDYDEKRVSLIRRIDFAWAIEKD---  56

Query  216  kkqkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASM  395
                    +     K +    PW WQ +VENLQLAHQELSVIID INTVE NDAVTVASM
Sbjct  57   -------EEKKKQKKSSKETTPWQWQGMVENLQLAHQELSVIIDFINTVETNDAVTVASM  109

Query  396  TRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNW  575
            TRPK LPNE LSDLAVS  TKLQ +R  GKYFKQSAKA E+QVAREARFYGALIRLQQNW
Sbjct  110  TRPKSLPNEALSDLAVSAATKLQCYRQVGKYFKQSAKAFEQQVAREARFYGALIRLQQNW  169

Query  576  KIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            K+KR R  +   GNEGF  DLFDN+ +D   + R S
Sbjct  170  KVKRQRQTSLVPGNEGFTFDLFDNS-YDQGAIVRSS  204



>gb|AIU49751.1| RNA polymerase II transcription mediator, partial [Populus trichocarpa]
Length=517

 Score =   267 bits (683),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 153/200 (77%), Gaps = 35/200 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            +SLDKLP+KR+E +EENG ERFP+ D+GYDEK V+LIRRIDFAWAV              
Sbjct  1    MSLDKLPVKRLESIEENGFERFPT-DIGYDEKQVALIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQ++VENL LAHQELSVIIDLINTVEANDAVTVA MTRPK LPN
Sbjct  46   --------------WPWQNMVENLHLAHQELSVIIDLINTVEANDAVTVAGMTRPKPLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+L+DLAVS  TKLQ +R+ GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+KR R  
Sbjct  92   EILADLAVSTATKLQCYRNLGKYFKQSAKALEQQVAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHD  659
                GNEGF IDLFDN+L+D
Sbjct  150  ----GNEGFMIDLFDNSLYD  165



>gb|AIU49749.1| RNA polymerase II transcription mediator, partial [Erythranthe 
guttata]
Length=512

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 154/208 (74%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR+E +EE G ERFPS DV YDEK V+LIRRIDFAWAV              
Sbjct  1    ISLDKLPIKRLESIEEFGSERFPS-DVDYDEKRVNLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W W+SLVENLQLAHQELSVIIDLINTVE NDAVTVA MTRPK LPN
Sbjct  46   --------------WQWKSLVENLQLAHQELSVIIDLINTVETNDAVTVAGMTRPKPLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E LSDLAVS  TKLQ FR  GKYFKQSAKALE+Q+AREARFYGALIRLQQNWKIK+HR  
Sbjct  92   EHLSDLAVSTATKLQCFRSLGKYFKQSAKALEEQIAREARFYGALIRLQQNWKIKQHR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                GNEGFYIDLFDN+L++ A   RPS
Sbjct  150  ----GNEGFYIDLFDNSLYNSA---RPS  170



>gb|KJB54060.1| hypothetical protein B456_009G019100 [Gossypium raimondii]
 gb|KJB54061.1| hypothetical protein B456_009G019100 [Gossypium raimondii]
Length=671

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 166/216 (77%), Gaps = 8/216 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLP+KR++ +EENG ER+P  +  YDEK VSLIRRIDFAWAVE +     
Sbjct  1    MDGNLEISLDKLPVKRLDAIEENGLERYPP-ESSYDEKRVSLIRRIDFAWAVEED-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            ++K        +    A+  W WQS+VENLQLAHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  55   EEKERKKKQKKNSSKDASATWQWQSMVENLQLAHQELSVIIDLINTVEANDAVTVAGMTR  114

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNEL+SDLAVS  TKLQ +RH GKYFKQSA ALE+Q+AREARFYGALIRLQQNWK+
Sbjct  115  PKPLPNELMSDLAVSAATKLQCYRHLGKYFKQSANALEQQIAREARFYGALIRLQQNWKV  174

Query  582  KRHRMM--AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+      S NEGF IDLFDN+L+    + RPS
Sbjct  175  KRQRVAGPGPASSNEGFTIDLFDNSLYSSTPMSRPS  210



>gb|AIU49752.1| RNA polymerase II transcription mediator, partial [Prunus persica]
Length=515

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 154/208 (74%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR++ +EENG ERFP  DVGY+EK  SLIRRIDFAWAV              
Sbjct  1    ISLDKLPIKRLDVIEENGLERFPP-DVGYEEKRQSLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQS+VENLQLAHQELSVIIDLINTVE NDAVTVASMTRPK   +
Sbjct  46   --------------WQWQSMVENLQLAHQELSVIIDLINTVETNDAVTVASMTRPKPFHD  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E++SDLAVS  TKLQ FRH GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+KR R  
Sbjct  92   EVMSDLAVSAATKLQCFRHLGKYFKQSAKALERQVAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                GNEGF IDLFD++L+DPA   RPS
Sbjct  150  ----GNEGFTIDLFDSSLYDPA---RPS  170



>gb|AIU49767.1| RNA polymerase II transcription mediator, partial [Platanus x 
acerifolia]
Length=517

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 154/208 (74%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR++ +E+NG ERFP  D+G+DEK +SLIRRIDFAWAV              
Sbjct  1    ISLDKLPIKRLDAIEDNGLERFPP-DIGHDEKWLSLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQSLVENLQLAHQELSVIIDLINTVEANDAV VA MTRPKQLPN
Sbjct  46   --------------WPWQSLVENLQLAHQELSVIIDLINTVEANDAVAVAGMTRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSD+AVS  TKLQ FRH G+YFKQSAKALE+QVA EARFYG+LIRLQQNWK+KR R  
Sbjct  92   EVLSDIAVSAATKLQCFRHLGRYFKQSAKALEQQVAVEARFYGSLIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                G+EGF IDLFDN+L D     RPS
Sbjct  150  ----GSEGFTIDLFDNSLSDST---RPS  170



>gb|KHN46923.1| hypothetical protein glysoja_031223 [Glycine soja]
Length=486

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 159/209 (76%), Gaps = 12/209 (6%)
 Frame = +3

Query  54   LQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkks  233
            LQISLDKLPIKR++ +EENG ERFP  D+ YD K +SLIR+IDFAWAVE+++  KKQK S
Sbjct  3    LQISLDKLPIKRLDSIEENGVERFPP-DLDYDAKRLSLIRQIDFAWAVEKDEEKKKQKSS  61

Query  234  sadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQL  413
                         +  W WQ LVENLQLAHQELSVIIDLIN VEANDAVTVASMTRPK L
Sbjct  62   RE----------TSTTWQWQDLVENLQLAHQELSVIIDLINIVEANDAVTVASMTRPKLL  111

Query  414  PNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHR  593
            PNE LSD AVS   KLQ +RH GKYFKQSAKA E+QVAREARFYGALIRLQQNWK+KR R
Sbjct  112  PNEALSDRAVSAAIKLQCYRHVGKYFKQSAKAFEQQVAREARFYGALIRLQQNWKVKRQR  171

Query  594  MMAATSGNEGFYIDLFDNTLHDPAFVFRP  680
              A   GNEGF  DLFDN+ +D A + R 
Sbjct  172  QAAIVPGNEGFTFDLFDNS-YDQAAIIRS  199



>ref|XP_003609292.1| hypothetical protein MTR_4g114100 [Medicago truncatula]
Length=856

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 162/216 (75%), Gaps = 14/216 (6%)
 Frame = +3

Query  42   MEE--DLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPs  215
            MEE  +LQ+SLDKLPIKR++ +EENG+ERFP  DV YDEK VSLIRRIDFAWA+E++   
Sbjct  1    MEEGMELQLSLDKLPIKRLDSIEENGNERFPL-DVDYDEKRVSLIRRIDFAWAIEKD---  56

Query  216  kkqkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASM  395
                    +     K +    PW WQ +VENLQLAHQELSVIID INTVE NDAVTVASM
Sbjct  57   -------EEKKKQKKSSKETTPWQWQGMVENLQLAHQELSVIIDFINTVETNDAVTVASM  109

Query  396  TRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNW  575
            TRPK LPNE LSDLAVS  TKLQ +R  GKYFKQSAKA E+QVAREARFYGALIRLQQNW
Sbjct  110  TRPKSLPNEALSDLAVSAATKLQCYRQVGKYFKQSAKAFEQQVAREARFYGALIRLQQNW  169

Query  576  KIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            K+KR R  +   GNEGF  DLFDN+ +D   + R S
Sbjct  170  KVKRQRQTSLVPGNEGFTFDLFDNS-YDQGAIVRSS  204



>ref|XP_004508515.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X1 [Cicer arietinum]
 ref|XP_004508516.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X2 [Cicer arietinum]
 ref|XP_004508517.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X3 [Cicer arietinum]
 ref|XP_004508518.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X4 [Cicer arietinum]
Length=658

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 160/216 (74%), Gaps = 13/216 (6%)
 Frame = +3

Query  42   MEE--DLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPs  215
            MEE  +LQ+SLDKLPIKR++ +EENG ERFP  +  YDEK +SLIRRIDFAWA+E++   
Sbjct  1    MEEGMELQLSLDKLPIKRLDSIEENGMERFPL-NADYDEKRISLIRRIDFAWAIEKD---  56

Query  216  kkqkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASM  395
                               + PW WQ +V+NL+LAHQELSVIIDLINTVEANDAVTVASM
Sbjct  57   ------EEKKKQKKSSKETSTPWQWQGMVDNLKLAHQELSVIIDLINTVEANDAVTVASM  110

Query  396  TRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNW  575
            TRPK LPNE LSDLAVS  TKLQ +R  GKYFKQSAKA E+Q+AREARFYGALIRLQQNW
Sbjct  111  TRPKPLPNEALSDLAVSAATKLQCYRQVGKYFKQSAKAFEQQLAREARFYGALIRLQQNW  170

Query  576  KIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            K+KR R  +   GNEGF  DLFDN+ +D   + R S
Sbjct  171  KVKRQRQASIVPGNEGFTFDLFDNS-YDQGAIIRSS  205



>gb|AIU49727.1| RNA polymerase II transcription mediator, partial [Theobroma 
cacao]
Length=517

 Score =   260 bits (664),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 153/208 (74%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLP++ ++ +EENG ER+P  ++ YDEK VSLIRRIDFAWA+              
Sbjct  1    ISLDKLPVRALDAIEENGVERYPH-ELSYDEKRVSLIRRIDFAWAL--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQS+VENLQLAHQELSVIIDLINTVEANDAVTVA MTRPK LPN
Sbjct  46   --------------WQWQSMVENLQLAHQELSVIIDLINTVEANDAVTVAGMTRPKPLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TKLQ +RH GKYFKQSAKALE+Q+AREARFYGALIRLQQNWK+KR R  
Sbjct  92   EVLSDLAVSAATKLQCYRHLGKYFKQSAKALEQQIAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                 NEGF IDLFDN+L+D A   RPS
Sbjct  150  ----SNEGFTIDLFDNSLYDSA---RPS  170



>gb|AIU49736.1| RNA polymerase II transcription mediator, partial [Glycine max]
Length=515

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 145/197 (74%), Gaps = 35/197 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR++ +EENG ERFP  DV YDEK +SLIRRIDFAWAV              
Sbjct  1    ISLDKLPIKRLDSIEENGIERFPP-DVDYDEKRLSLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQ +VENLQLAHQELSVIIDLINTVEANDAVTVASMTRPK LPN
Sbjct  46   --------------WQWQGMVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKLLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E LSDLAVS  TKLQ +RH GKYFKQSAKA E+QVAREARFYGALIRLQQNWK+KR R  
Sbjct  92   EALSDLAVSAATKLQCYRHVGKYFKQSAKAFEQQVAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNT  650
                GNEGF  DLFDN+
Sbjct  150  ----GNEGFTFDLFDNS  162



>ref|XP_007013395.1| RNA polymerase II transcription mediators isoform 6, partial 
[Theobroma cacao]
 gb|EOY31014.1| RNA polymerase II transcription mediators isoform 6, partial 
[Theobroma cacao]
Length=527

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 155/202 (77%), Gaps = 10/202 (5%)
 Frame = +3

Query  78   PIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssadsssss  257
            P++ ++ +EENG ER+P  ++ YDEK VSLIRRIDFAWA+E ++     ++         
Sbjct  1    PVRALDAIEENGVERYPH-ELSYDEKRVSLIRRIDFAWALETDE-----ERERKKKQKKK  54

Query  258  ketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPNELLSDL  437
                A   W    LVENLQLAHQELSVIIDLINTVEANDAVTVA MTRPK LPNE+LSDL
Sbjct  55   NSKDATATW----LVENLQLAHQELSVIIDLINTVEANDAVTVAGMTRPKPLPNEVLSDL  110

Query  438  AVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSGN  617
            AVS  TKLQ +RH GKYFKQSAKALE+Q+AREARFYGALIRLQQNWK+KR R+ A +S N
Sbjct  111  AVSAATKLQCYRHLGKYFKQSAKALEQQIAREARFYGALIRLQQNWKVKRQRVAAPSSSN  170

Query  618  EGFYIDLFDNTLHDPAFVFRPS  683
            EGF IDLFDN+L+D A + RPS
Sbjct  171  EGFTIDLFDNSLYDSATISRPS  192



>gb|AIU49762.1| RNA polymerase II transcription mediator, partial [Schrenkiella 
parvula]
Length=512

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 153/208 (74%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLD+LPIKR+E +EENG ERFPS DV YD+K VSLIRRIDFAWA+              
Sbjct  1    ISLDRLPIKRLESIEENGAERFPS-DVNYDDKRVSLIRRIDFAWAL--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W W+ +VENLQLAHQELSVIIDLINTVEANDAVTVA MT+PK +PN
Sbjct  46   --------------WQWKGMVENLQLAHQELSVIIDLINTVEANDAVTVAGMTKPKPMPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            ELLSDLAVS  TKLQS+RH GKYFKQSAKALE++V REARFYGALIRLQ+NWK+KR R  
Sbjct  92   ELLSDLAVSTATKLQSYRHLGKYFKQSAKALEQKVNREARFYGALIRLQRNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                 NEGF IDL D++L+DP    RPS
Sbjct  150  ----SNEGFTIDLSDSSLYDPT---RPS  170



>gb|AIU49730.1| RNA polymerase II transcription mediator, partial [Citrus clementina]
Length=516

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 152/208 (73%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            IS+DKLP+KR++ +EE G ERFP  DVGYDEK  SLIRRIDFAWAV              
Sbjct  1    ISVDKLPVKRLDAIEETGAERFPP-DVGYDEKRESLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQ++VENLQ AHQELSVIIDLINTVEANDAVTVA MTRPK LPN
Sbjct  46   --------------WQWQNMVENLQFAHQELSVIIDLINTVEANDAVTVAGMTRPKALPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDL+VS  TKLQ +RH G YFKQSAK+LE+Q+A+EARFYGALIRLQQNWK+KR R  
Sbjct  92   EVLSDLSVSAATKLQCYRHLGIYFKQSAKSLEQQIAKEARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                GNEGF IDLFDN+L+D A   RPS
Sbjct  150  ----GNEGFTIDLFDNSLYDSA---RPS  170



>gb|AIU49734.1| RNA polymerase II transcription mediator, partial [Citrus sinensis]
Length=516

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 152/208 (73%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            IS+DKLP+KR++ +EE G ERFP  DVGYDEK  SLIRRIDFAWAV              
Sbjct  1    ISVDKLPVKRLDAIEETGAERFPP-DVGYDEKRESLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQ++VENLQ AHQELSVIIDLINTVEANDAVTVA MTRPK LPN
Sbjct  46   --------------WQWQNMVENLQFAHQELSVIIDLINTVEANDAVTVAGMTRPKALPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDL+VS  TKLQ +RH G YFKQSAK+LE+Q+A+EARFYGALIRLQQNWK+KR R  
Sbjct  92   EVLSDLSVSAATKLQCYRHLGIYFKQSAKSLEQQIAKEARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                GNEGF IDLFDN+L+D A   RPS
Sbjct  150  ----GNEGFTIDLFDNSLYDSA---RPS  170



>gb|AIU49735.1| RNA polymerase II transcription mediator, partial [Eucalyptus 
grandis]
Length=517

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 153/208 (74%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            +SLDKLP+KR+EF+EE+G ERFP+ DV YDEK +SLIRRIDFAWA+              
Sbjct  1    VSLDKLPVKRLEFIEESGAERFPT-DVSYDEKRLSLIRRIDFAWAL--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQS+VENLQLA QELSV++DLINTVEANDAVTVAS+TRPK LP+
Sbjct  46   --------------WQWQSMVENLQLAQQELSVVLDLINTVEANDAVTVASITRPKALPH  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSD AVS  TKLQ FRH GKYFKQSAKALE+QVA+EARFYGALIRLQQNWK+KR R  
Sbjct  92   EVLSDHAVSAATKLQCFRHLGKYFKQSAKALEQQVAKEARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                G E F IDLFDN++ DP    RPS
Sbjct  150  ----GGESFTIDLFDNSITDPT---RPS  170



>gb|AIU49719.1| RNA polymerase II transcription mediator, partial [Aquilegia 
coerulea]
Length=514

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 147/201 (73%), Gaps = 35/201 (17%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            I LDKLPIKR++ +EENG E+FP  D+GYD+K +  IRRIDFAWAV              
Sbjct  1    IDLDKLPIKRLDVIEENGLEKFPH-DIGYDQKRLESIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVA MTRPK LPN
Sbjct  46   --------------WPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVAGMTRPKPLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDL++S  TKLQ FRH GKYFKQSAK LE+Q+AREARFYGALIRLQ+NWK+KR R  
Sbjct  92   EVLSDLSISSATKLQCFRHLGKYFKQSAKGLEQQIAREARFYGALIRLQKNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDP  662
                 +EGF IDL DN+L DP
Sbjct  150  ----SSEGFTIDLCDNSLSDP  166



>ref|XP_006842865.1| hypothetical protein AMTR_s00081p00160620 [Amborella trichopoda]
 gb|ERN04540.1| hypothetical protein AMTR_s00081p00160620 [Amborella trichopoda]
Length=668

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 161/211 (76%), Gaps = 11/211 (5%)
 Frame = +3

Query  51   DLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkk  230
            ++++SLDKLPI+RV+ V+ENG E FP SDV  DEK +SL+RRIDF   VE++        
Sbjct  5    NIKLSLDKLPIRRVDAVDENGTEHFPPSDVNQDEKYLSLLRRIDFTPVVEKD--------  56

Query  231  ssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQ  410
              A     S+E  A+Q WPWQSLVENL+ AH ELSVIIDL++ VEANDAV VA MTRPK 
Sbjct  57   --AKKQKVSRENQASQQWPWQSLVENLRQAHHELSVIIDLVHNVEANDAVAVAGMTRPKP  114

Query  411  LPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRH  590
            LPNE+LSDLA+S +TKLQ F+H GKY KQSAKALE QVAREARFYG+LIRLQQNWK+KR 
Sbjct  115  LPNEVLSDLAISTSTKLQCFQHVGKYLKQSAKALEHQVAREARFYGSLIRLQQNWKVKRQ  174

Query  591  RMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            R +AA SG+EGF  DL D +L DP  +FR S
Sbjct  175  RALAAPSGSEGFTFDLSDISLSDP-LLFRTS  204



>gb|AIU49731.1| RNA polymerase II transcription mediator, partial [Gossypium 
raimondii]
Length=517

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 147/199 (74%), Gaps = 35/199 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLP+KR++ +EENG ER+P  +  YDEK VSLIRRIDFAWAV              
Sbjct  1    ISLDKLPVKRLDAIEENGLERYPP-ESSYDEKRVSLIRRIDFAWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQS+VENLQLAHQELSVIIDLINTVEANDAVTVA MTRPK LPN
Sbjct  46   --------------WQWQSMVENLQLAHQELSVIIDLINTVEANDAVTVAGMTRPKPLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            EL+SDLAVS  TKLQ +RH GKYFKQSA ALE+Q+AREARFYGALIRLQQNWK+KR R  
Sbjct  92   ELMSDLAVSAATKLQCYRHLGKYFKQSANALEQQIAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLH  656
                 NEGF IDLFDN+L+
Sbjct  150  ----SNEGFTIDLFDNSLY  164



>ref|XP_010520585.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 isoform X1 [Tarenaya hassleriana]
Length=658

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 167/214 (78%), Gaps = 9/214 (4%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ DL+ISLDKLPIKR+E +EENG ERFPS DV YD+K VSLIRRIDFAWAVE ED  KK
Sbjct  1    MDGDLEISLDKLPIKRLEVIEENGAERFPS-DVDYDDKRVSLIRRIDFAWAVEEEDDEKK  59

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            +K+  +   SS ++        WQ +VENL+LAHQELSV+IDLINTVEAND  TVA MTR
Sbjct  60   KKQKKSSKESSGQQ--------WQGMVENLRLAHQELSVVIDLINTVEANDVATVAGMTR  111

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE LSDLAVS  TKLQ++R  GKYFKQSA+ALE Q+ REARFYGALIRLQ+NWK+
Sbjct  112  PKLLPNESLSDLAVSTATKLQAYRQLGKYFKQSAQALEHQINREARFYGALIRLQRNWKV  171

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R++A++  NEGF IDL D +L + A   R S
Sbjct  172  KRQRVVASSPSNEGFVIDLSDISLCNSASALRQS  205



>gb|AIU49723.1| RNA polymerase II transcription mediator, partial [Magnolia denudata]
Length=516

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 151/208 (73%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR++ +EE+G ERFP  ++GYDE+ ++LIRRIDF   V              
Sbjct  1    ISLDKLPIKRLDSIEESGIERFPP-EIGYDERRLALIRRIDFTPVV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVA MTRPKQLPN
Sbjct  46   --------------WPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVAGMTRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TK Q FRH G+YFKQSAKALE+QVAREARFYGALIRLQQNWK+KR R  
Sbjct  92   EVLSDLAVSAATKPQCFRHLGRYFKQSAKALEQQVAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                G+EGF IDLFDN L D     RPS
Sbjct  150  ----GSEGFTIDLFDNLLSDST---RPS  170



>gb|AIU49742.1| RNA polymerase II transcription mediator, partial [Chimonanthus 
praecox]
Length=517

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 150/208 (72%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR++ +EENG ERFP  ++G DEK ++LIRRIDF   V              
Sbjct  1    ISLDKLPIKRLDAIEENGAERFPP-EIGPDEKRLALIRRIDFTPLV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQSLVENLQLAHQELSVI+DLINTVEANDAVTVA MTRPKQLPN
Sbjct  46   --------------WPWQSLVENLQLAHQELSVILDLINTVEANDAVTVAGMTRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TKLQ FRH GKYFKQSAKALE+QVAREARFYG LIRLQQNWK+KR R  
Sbjct  92   EVLSDLAVSAATKLQCFRHLGKYFKQSAKALEQQVAREARFYGGLIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                G+EGF IDL D +L DP    RPS
Sbjct  150  ----GSEGFTIDLLDISLSDPT---RPS  170



>gb|AIU49766.1| RNA polymerase II transcription mediator, partial [Cinnamomum 
camphora]
Length=517

 Score =   254 bits (650),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 152/208 (73%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR++ ++++G ERFP  ++G DEK +SLIRRIDF   V              
Sbjct  1    ISLDKLPIKRLDAIDDSGIERFPH-EIGPDEKRLSLIRRIDFTPLV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQSLVENLQLAHQELSVI+DLINTVEANDAVTVA MTRPKQLPN
Sbjct  46   --------------WPWQSLVENLQLAHQELSVIVDLINTVEANDAVTVACMTRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TKLQ FRH G+YFKQSAKALE+QVAREARFYGALIRLQQNWK+KR R  
Sbjct  92   EVLSDLAVSAATKLQCFRHLGRYFKQSAKALEQQVAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                G+EGF IDLFDN+L D     RPS
Sbjct  150  ----GSEGFTIDLFDNSLLD---TVRPS  170



>gb|AIU49720.1| RNA polymerase II transcription mediator, partial [Arabidopsis 
lyrata]
Length=513

 Score =   254 bits (650),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 152/208 (73%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLD+LPIKR+E +EENG ERFPS DVGYD+K VSLIRRIDFAWA+              
Sbjct  1    ISLDRLPIKRLESIEENGAERFPS-DVGYDDKRVSLIRRIDFAWAL--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W W+ +VENLQLAHQELSVIIDLI+TV+ANDAVTVA MTRPK LPN
Sbjct  46   --------------WKWKGMVENLQLAHQELSVIIDLIDTVQANDAVTVAGMTRPKPLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TKLQ +R+ G YFKQSAKALE+++ REARFYGALIRLQ+NWK+KR R  
Sbjct  92   EILSDLAVSTATKLQGYRNLGNYFKQSAKALEQKINREARFYGALIRLQRNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                 NEGF IDL D++LHDP    RPS
Sbjct  150  ----SNEGFTIDLSDSSLHDPT---RPS  170



>gb|AIU49746.1| RNA polymerase II transcription mediator, partial [Medicago truncatula]
Length=515

 Score =   254 bits (650),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 143/197 (73%), Gaps = 35/197 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            +SLDKLPIKR++ +EENG+ERFP  DV YDEK VSLIRRIDFAWA+              
Sbjct  1    LSLDKLPIKRLDSIEENGNERFPL-DVDYDEKRVSLIRRIDFAWAI--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQ +VENLQLAHQELSVIID INTVE NDAVTVASMTRPK LPN
Sbjct  46   --------------WQWQGMVENLQLAHQELSVIIDFINTVETNDAVTVASMTRPKSLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E LSDLAVS  TKLQ +R  GKYFKQSAKA E+QVAREARFYGALIRLQQNWK+KR R  
Sbjct  92   EALSDLAVSAATKLQCYRQVGKYFKQSAKAFEQQVAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNT  650
                GNEGF  DLFDN+
Sbjct  150  ----GNEGFTFDLFDNS  162



>gb|AIU49754.1| RNA polymerase II transcription mediator, partial [Phaseolus 
vulgaris]
Length=515

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 144/197 (73%), Gaps = 35/197 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR++ +EENG ERFP  DV YDEK +SLIRRIDFAWA+              
Sbjct  1    ISLDKLPIKRLDSIEENGMERFPP-DVDYDEKRLSLIRRIDFAWAI--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQS+VENLQLAHQELSVIIDLINTVEANDAVTVASMTRPK  PN
Sbjct  46   --------------WQWQSMVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKLQPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E LSDLAVS  +KLQ +R  GKYFKQSAKA E+QVAREARFYGALIRLQQNWK+KR R  
Sbjct  92   EALSDLAVSAASKLQCYRQVGKYFKQSAKAFEQQVAREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNT  650
                GNEGF  DLFDN+
Sbjct  150  ----GNEGFTFDLFDNS  162



>gb|AIU49741.1| RNA polymerase II transcription mediator, partial [Ceratophyllum 
demersum]
 gb|AIU49765.1| RNA polymerase II transcription mediator, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=516

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 148/202 (73%), Gaps = 34/202 (17%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLP++R++ +E+NG E FP +++G+DEK +SL+RRIDF   V              
Sbjct  1    ISLDKLPLRRIDAIEDNGVEHFPPNEIGHDEKQISLVRRIDFTPIV--------------  46

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQSLVENLQLAHQELSVIIDLINTVE NDAV V  MTRPKQLP+
Sbjct  47   --------------WPWQSLVENLQLAHQELSVIIDLINTVETNDAVAVIGMTRPKQLPS  92

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+L+D +VS+ TKLQ FRH GKYFKQS+K LE+QVAREARFYGALIRLQQNWK+KR R  
Sbjct  93   EVLADFSVSVATKLQCFRHLGKYFKQSSKTLEQQVAREARFYGALIRLQQNWKVKRQR--  150

Query  600  AATSGNEGFYIDLFDNTLHDPA  665
                G+EGF IDLFDN+L DP+
Sbjct  151  ----GSEGFTIDLFDNSLSDPS  168



>gb|AIU49740.1| RNA polymerase II transcription mediator, partial [Chloranthus 
japonicus]
Length=520

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 149/201 (74%), Gaps = 35/201 (17%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR+E +EENG ER+P +++  DEK ++LIRRIDF  AV              
Sbjct  1    ISLDKLPIKRLESIEENGFERYPPTEISEDEKRLALIRRIDFTPAV--------------  46

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQS+VENLQLAHQELSVIIDLINTVEANDAVTVA M +PKQLPN
Sbjct  47   --------------WPWQSVVENLQLAHQELSVIIDLINTVEANDAVTVAGMIKPKQLPN  92

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALI-RLQQNWKIKRHRM  596
            E+L+DL++S  TKLQ FRH GKYFKQSAKALE+QVAREARFYGALI RLQQNWK+KR R 
Sbjct  93   EVLADLSISAATKLQCFRHLGKYFKQSAKALEQQVAREARFYGALIDRLQQNWKVKRQR-  151

Query  597  MAATSGNEGFYIDLFDNTLHD  659
                 G+EGF IDLFDN+L D
Sbjct  152  -----GSEGFTIDLFDNSLLD  167



>gb|AIU49729.1| RNA polymerase II transcription mediator, partial [Sarcandra 
glabra]
Length=519

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 147/202 (73%), Gaps = 34/202 (17%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR+E +EENG ER+P +++  DEK ++LIRRIDF   V              
Sbjct  1    ISLDKLPIKRLESIEENGFERYPPTEISEDEKRLALIRRIDFTQTV--------------  46

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQS+VENLQ AHQELSVI+DLINTVEANDAVTVA M +PKQLPN
Sbjct  47   --------------WPWQSVVENLQQAHQELSVIMDLINTVEANDAVTVAGMIKPKQLPN  92

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+L+DL++S  TKLQ FRH GKYFKQSAKALE+QVAREARFYGALIRLQQNWK+KR R  
Sbjct  93   EVLADLSISAATKLQCFRHLGKYFKQSAKALEQQVAREARFYGALIRLQQNWKVKRQR--  150

Query  600  AATSGNEGFYIDLFDNTLHDPA  665
                G+EGF IDL DN+L DP 
Sbjct  151  ----GSEGFTIDLSDNSLLDPT  168



>ref|XP_010688034.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Beta vulgaris subsp. vulgaris]
Length=652

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 156/209 (75%), Gaps = 13/209 (6%)
 Frame = +3

Query  51   DLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkk  230
            D++ISLDKLPIKR++ +EE+G ERFP  ++ Y+EKTV+LIRRIDFAWA+ER+        
Sbjct  6    DMEISLDKLPIKRLDIIEESGLERFPP-EIEYEEKTVNLIRRIDFAWALERD--------  56

Query  231  ssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQ  410
                S    K   A+ P  WQ ++ENL+ AHQELSVIIDLINTVEANDAVTVA M RPK 
Sbjct  57   ----SKKQKKAKEASAPSTWQGMIENLKSAHQELSVIIDLINTVEANDAVTVAHMNRPKP  112

Query  411  LPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRH  590
            LPNE L+DLAVS  TKLQ +RH  KYFKQSAK+LE Q++REARFYGALIRLQQNWK+K H
Sbjct  113  LPNESLNDLAVSAATKLQCYRHLSKYFKQSAKSLEHQISREARFYGALIRLQQNWKVKWH  172

Query  591  RMMAATSGNEGFYIDLFDNTLHDPAFVFR  677
            R+ A    ++GF IDL +   H+ + V R
Sbjct  173  RLAANAPSSDGFLIDLSNKAAHEQSAVAR  201



>gb|AIU49733.1| RNA polymerase II transcription mediator, partial [Capsella rubella]
Length=512

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 151/208 (73%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLD+LPIKR+E +EENG E FPS DV YD+K VSLIRRIDFAWA+              
Sbjct  1    ISLDRLPIKRLESIEENGAEHFPS-DVDYDDKRVSLIRRIDFAWAL--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W W+ +VENLQLAHQELSVIIDLI+TV+ANDAVTVA MTRPK +PN
Sbjct  46   --------------WKWKGMVENLQLAHQELSVIIDLIDTVQANDAVTVAGMTRPKPMPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TKLQ +R+ GKYFKQSAKALE+++ REARFYGALIRLQ+NWK+KR R  
Sbjct  92   EILSDLAVSTATKLQGYRNLGKYFKQSAKALEQKINREARFYGALIRLQRNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                 NEGF IDL D++L+DP    RPS
Sbjct  150  ----SNEGFTIDLSDSSLYDPT---RPS  170



>gb|AIU49721.1| RNA polymerase II transcription mediator, partial [Arabidopsis 
thaliana]
Length=512

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 151/208 (73%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLD+LPIKR+E +EENG ERFPS DV YD+K VSLIRRIDFAWA+              
Sbjct  1    ISLDRLPIKRLESIEENGAERFPS-DVDYDDKRVSLIRRIDFAWAL--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W W+ +VENLQLAHQEL+VIIDLI+TV+ANDAVTVA MTRPK +PN
Sbjct  46   --------------WKWKGMVENLQLAHQELTVIIDLIDTVQANDAVTVAGMTRPKPMPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TKLQ +R+ G YFKQSAKALE+++ REARFYGALIRLQ+NWK+KR R  
Sbjct  92   EILSDLAVSTATKLQGYRNLGNYFKQSAKALEQKINREARFYGALIRLQRNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                 NEGF IDL D++L+DP    RPS
Sbjct  150  ----SNEGFTIDLSDSSLYDPT---RPS  170



>ref|XP_010910117.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Elaeis guineensis]
Length=675

 Score =   250 bits (639),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 167/214 (78%), Gaps = 5/214 (2%)
 Frame = +3

Query  45   EEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkq  224
            E  ++I LDKLPIKR++ ++E G+E+FP  ++G++EK +S+IRRIDF++ V ++    KQ
Sbjct  4    ERSVRIDLDKLPIKRLDAIDELGNEQFPP-EIGHEEKRLSMIRRIDFSFVVGKD---AKQ  59

Query  225  kkssadsssssketsANQP-WPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
             K S ++++++   +  QP WPWQ LVENLQLAHQELSVI+DLINTVEANDAV VA M R
Sbjct  60   AKRSKEAAAAAAAAAVQQPAWPWQGLVENLQLAHQELSVIMDLINTVEANDAVAVAGMQR  119

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+LSDLAVS  TKLQ  RH G+YFKQS+KA+E+QV+R+ARFYG+LIRLQQNWK+
Sbjct  120  PKPLPNEVLSDLAVSAATKLQRLRHLGRYFKQSSKAMEQQVSRDARFYGSLIRLQQNWKV  179

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM A   G+EGF  DL DN+  D   + RPS
Sbjct  180  KRQRMAAMGPGSEGFSFDLLDNSFVDLTALSRPS  213



>gb|AIU49737.1| RNA polymerase II transcription mediator, partial [Illicium henryi]
Length=516

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 144/202 (71%), Gaps = 34/202 (17%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLPIKR+  +EENG E +P S++  D+K ++L++RIDF  AV              
Sbjct  1    ISLDKLPIKRLAAIEENGIEHYPPSEISQDDKRLALLQRIDFTPAV--------------  46

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQSLVENLQ AHQEL VIIDLINTVE NDAVTVA MTRPKQLPN
Sbjct  47   --------------WPWQSLVENLQQAHQELQVIIDLINTVETNDAVTVAMMTRPKQLPN  92

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E++SDLA+S +TKLQ FRH G+Y KQSAKALE QVAREARFYGALIRLQQNWK+KR R  
Sbjct  93   EVMSDLAISASTKLQCFRHLGRYLKQSAKALEHQVAREARFYGALIRLQQNWKVKRQR--  150

Query  600  AATSGNEGFYIDLFDNTLHDPA  665
                G+EGF IDL DNTL DP 
Sbjct  151  ----GSEGFTIDLSDNTLLDPT  168



>gb|AIU49728.1| RNA polymerase II transcription mediator, partial [Acorus calamus]
Length=514

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 143/202 (71%), Gaps = 35/202 (17%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            I LDKLPIKR++ +EENG E FP  DVG DEK + LIRRIDF   V              
Sbjct  1    IDLDKLPIKRLDAIEENGIEHFPP-DVGQDEKRLDLIRRIDFTPIV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                           PWQSL+ENLQLAHQELSV+IDLINTVE NDAVTVA MTRPKQLPN
Sbjct  46   --------------LPWQSLMENLQLAHQELSVVIDLINTVETNDAVTVAGMTRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+L+DL+VS  TKLQ FRH GKYFKQS+KALE+Q  REARFYGALIRLQQNWK+KR R  
Sbjct  92   EVLADLSVSAATKLQHFRHLGKYFKQSSKALEQQTVREARFYGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPA  665
                GNEGF IDLFDN+L D A
Sbjct  150  ----GNEGFTIDLFDNSLADAA  167



>ref|XP_008354374.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 17-like [Malus domestica]
Length=647

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 157/214 (73%), Gaps = 20/214 (9%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+  ++ISLDKLPIKR+E +EENG ERFP  DVGYDEK  SLIRRIDFAWAVE+++    
Sbjct  1    MDRKMEISLDKLPIKRLEVIEENGLERFPP-DVGYDEKRQSLIRRIDFAWAVEKDE----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                +     SSKE++A Q    ++LVENLQL  +ELSVI   INTVE  DAVTVASMTR
Sbjct  56   ----NKKQKKSSKESAATQWAMGRALVENLQLGTRELSVIXXXINTVETKDAVTVASMTR  111

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE LSDLAVS  TKLQ FRH GKYFKQS           ARFYGA IRLQQNWK+
Sbjct  112  PKPLPNEALSDLAVSAATKLQCFRHLGKYFKQS-----------ARFYGAPIRLQQNWKV  160

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR RM A+ SGNEGF IDLFDN+L+DPA +F PS
Sbjct  161  KRXRMAASXSGNEGFTIDLFDNSLYDPAAIFWPS  194



>gb|AIU49769.1| RNA polymerase II transcription mediator, partial [Houttuynia 
cordata]
Length=518

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 146/208 (70%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            +S+DKLPIKR++ ++E G ERF S +VG DEK ++LIRRIDF   V              
Sbjct  1    VSVDKLPIKRLDAIDETGIERF-SPEVGPDEKRLALIRRIDFTPLV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQ LVENLQLA QELSVIIDLINTVEANDAVTVA MTRPKQLPN
Sbjct  46   --------------WPWQGLVENLQLAQQELSVIIDLINTVEANDAVTVAMMTRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TKLQ FR+ G+YF QS KALE QVAREARFY ALIRLQQ+WKIKRHR  
Sbjct  92   EVLSDLAVSAATKLQCFRNLGRYFNQSKKALENQVAREARFYSALIRLQQSWKIKRHR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                G+EGF IDL DN++ DP    RPS
Sbjct  150  ----GSEGFTIDLLDNSISDPT---RPS  170



>gb|AIU49745.1| RNA polymerase II transcription mediator, partial [Aristolochia 
tagala]
Length=518

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 142/201 (71%), Gaps = 35/201 (17%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            IS+DKLPIKR++ +EENG ER+P  D+G D+K ++ IRRIDF   V              
Sbjct  1    ISVDKLPIKRLDVIEENGIERYP-PDIGEDDKRLAQIRRIDFTPLVS-------------  46

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                           PWQS+VENLQLAHQELSVIIDLINTVEANDAVTVA M+RPKQ   
Sbjct  47   ---------------PWQSMVENLQLAHQELSVIIDLINTVEANDAVTVAGMSRPKQTAG  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TKLQ FRH G+Y KQSAKALEKQVAREARF+GALIRLQQNWK+KR R  
Sbjct  92   EMLSDLAVSAATKLQCFRHLGRYLKQSAKALEKQVAREARFFGALIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDP  662
                  EGF IDLFD++L DP
Sbjct  150  ----SGEGFSIDLFDSSLSDP  166



>gb|AIU49757.1| RNA polymerase II transcription mediator, partial [Dioscorea 
oppositifolia]
Length=517

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 145/202 (72%), Gaps = 35/202 (17%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            + LDKLPIKR++ +EE+G E FP  ++GY+EK +S+IRRIDF+  +              
Sbjct  1    VDLDKLPIKRLDAIEESGVEHFPP-EIGYEEKRLSMIRRIDFSSVL--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQ LVENLQLAHQELS+IIDLI TVEANDAVTVA M RPKQLPN
Sbjct  46   --------------WPWQGLVENLQLAHQELSIIIDLIATVEANDAVTVAGMQRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            ELLSDLA+S  TKLQ  RH G+YFKQS+KALE+QVAREARFYG+LIRLQQNWKIKR R  
Sbjct  92   ELLSDLAISAATKLQRLRHLGRYFKQSSKALEQQVAREARFYGSLIRLQQNWKIKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPA  665
                G++GF IDL D++L D +
Sbjct  150  ----GSDGFTIDLLDSSLLDTS  167



>ref|XP_009389497.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Musa acuminata subsp. malaccensis]
Length=672

 Score =   240 bits (612),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 158/217 (73%), Gaps = 9/217 (4%)
 Frame = +3

Query  42   MEEDLQ---ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDP  212
            MEE+ +   + LD+LPIKR++ ++E G+E+FP  DV ++EK + +IRRIDF+  V     
Sbjct  1    MEENAKRNRVDLDRLPIKRLDAIDEAGNEQFPP-DVSHEEKRLGMIRRIDFSNVVAEN--  57

Query  213  skkqkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVAS  392
                 +     S      +  Q WPWQSLVENLQLAHQELS+IIDLINTVEANDAV VA 
Sbjct  58   --TDTRKKQKKSPKEAAPAPQQAWPWQSLVENLQLAHQELSIIIDLINTVEANDAVAVAG  115

Query  393  MTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQN  572
            M RPKQLPNE+LSDLAVS  TKLQ  R+ G+YFKQS+KA+E++V++EARFYG+LIRLQQ+
Sbjct  116  MQRPKQLPNEILSDLAVSAATKLQRLRNLGRYFKQSSKAMEQKVSKEARFYGSLIRLQQH  175

Query  573  WKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            WK+KR R++AA  G+EGF  D+ DN   D   + RPS
Sbjct  176  WKVKRQRLLAAGPGSEGFTFDMLDNPA-DTTMISRPS  211



>ref|XP_008809751.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 isoform X1 [Phoenix dactylifera]
Length=671

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 166/215 (77%), Gaps = 5/215 (2%)
 Frame = +3

Query  42   MEE-DLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPsk  218
            MEE  ++I LDKLPIKR++ ++E G+E+FP  ++G++EK +S+IRRIDF++ V +++   
Sbjct  2    MEEGSVRIDLDKLPIKRLDAIDELGNEQFPP-EIGHEEKRLSMIRRIDFSFVVGKDEKQA  60

Query  219  kqkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMT  398
            K  K +A +++++ +  A     WQ LVENLQLAHQELS+IIDLINTVEANDAV VA M 
Sbjct  61   KSSKETAAAAAAAAQQPAWP---WQGLVENLQLAHQELSIIIDLINTVEANDAVAVAGMQ  117

Query  399  RPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWK  578
            RPK LPNE+LSDL+VS  TKLQ  RH G+YFKQS+KA+E+QV+R+ARFYG+LIRLQQNWK
Sbjct  118  RPKPLPNEVLSDLSVSAATKLQRLRHLGRYFKQSSKAMEQQVSRDARFYGSLIRLQQNWK  177

Query  579  IKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            +KR RM A   G+EGF  DL DN+  D   + RPS
Sbjct  178  VKRQRMAAIGPGSEGFSFDLLDNSFLDLTALSRPS  212



>gb|AIU49739.1| RNA polymerase II transcription mediator, partial [Iris japonica]
Length=517

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 143/200 (72%), Gaps = 35/200 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            I LDKLPIKR++ ++E G+E+FP+ D+GY+EK + +IRRIDF+  V              
Sbjct  1    IDLDKLPIKRLQAIDEAGNEQFPA-DIGYEEKRLDMIRRIDFSLVV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQSLVENLQLA QELS+I+DLINTVEANDAVTVA M RPKQLP+
Sbjct  46   --------------WPWQSLVENLQLAQQELSIILDLINTVEANDAVTVAGMQRPKQLPH  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E LSD+AVS  TKLQ  RH G+YFKQS+KALE+QVAREARFYG+LIRLQ+NWK+KR R  
Sbjct  92   ESLSDIAVSAATKLQRLRHLGRYFKQSSKALEQQVAREARFYGSLIRLQRNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHD  659
                G+E F IDL DN+  D
Sbjct  150  ----GSESFTIDLLDNSTAD  165



>gb|AIU49758.1| RNA polymerase II transcription mediator, partial [Yucca filamentosa]
Length=517

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 144/208 (69%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            I LDKLPIKR+E +EE G E F SS++  +E  +++IRRIDF+W V              
Sbjct  1    IDLDKLPIKRLEAIEEAGTEHF-SSEISNEETRLNMIRRIDFSWIVS-------------  46

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                           PWQSL+ENL+ AHQELSV++DLINTVEANDAVTVASM RPKQLPN
Sbjct  47   ---------------PWQSLMENLRQAHQELSVVMDLINTVEANDAVTVASMQRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS   KLQ  RH G+YFKQS+KALE+QVAREARFYG+LIRLQQNWK+KR R  
Sbjct  92   EVLSDLAVSAAIKLQRLRHLGRYFKQSSKALEQQVAREARFYGSLIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                G+E F IDL DN++ D     RPS
Sbjct  150  ----GSESFTIDLQDNSISDGT---RPS  170



>gb|AIU49747.1| RNA polymerase II transcription mediator, partial [Canna indica]
Length=516

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 146/208 (70%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            I LD+LPIKR++ ++E G+E+FP  D  ++EK + ++RRIDF+  V              
Sbjct  1    IDLDRLPIKRLDAIDEIGNEQFPP-DTSHEEKRLGMLRRIDFSHVV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQ LVENLQLAHQELS+I+DLINTVEANDAVTVA M RPKQLPN
Sbjct  46   --------------WPWQGLVENLQLAHQELSIIMDLINTVEANDAVTVAGMQRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TKLQ  R+ G+YFKQS+KA+E++V+REA+FYG+LIRLQQNWK+KR R  
Sbjct  92   EILSDLAVSAATKLQRLRNLGRYFKQSSKAMEQKVSREAKFYGSLIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                G+EGF  DL DNTL D +   RPS
Sbjct  150  ----GSEGFTFDLLDNTLSDTS---RPS  170



>gb|AIU49724.1| RNA polymerase II transcription mediator, partial [Musa acuminata]
Length=515

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 145/208 (70%), Gaps = 39/208 (19%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            + LD+LPIKR++ ++E G+E+FP  DV ++EK + +IRRIDF+                 
Sbjct  1    VDLDRLPIKRLDAIDEAGNEQFPP-DVSHEEKRLGMIRRIDFS-----------------  42

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                       N  WPWQSLVENLQLAHQELS+IIDLINTVEANDAV VA M RPKQLPN
Sbjct  43   -----------NVVWPWQSLVENLQLAHQELSIIIDLINTVEANDAVAVAGMQRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLAVS  TKLQ  R+ G+YFKQS+KA+E++V++EARFYG+LIRLQQ+WK+KR R  
Sbjct  92   EILSDLAVSAATKLQRLRNLGRYFKQSSKAMEQKVSKEARFYGSLIRLQQHWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                G+EGF  D+ DN    PA   RPS
Sbjct  150  ----GSEGFTFDMLDN----PADTTRPS  169



>gb|KJB54063.1| hypothetical protein B456_009G019100 [Gossypium raimondii]
Length=581

 Score =   224 bits (572),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 137/173 (79%), Gaps = 6/173 (3%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLP+KR++ +EENG ER+P  +  YDEK VSLIRRIDFAWAVE +     
Sbjct  1    MDGNLEISLDKLPVKRLDAIEENGLERYPP-ESSYDEKRVSLIRRIDFAWAVEED-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            ++K        +    A+  W WQS+VENLQLAHQELSVIIDLINTVEANDAVTVA MTR
Sbjct  55   EEKERKKKQKKNSSKDASATWQWQSMVENLQLAHQELSVIIDLINTVEANDAVTVAGMTR  114

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIR  560
            PK LPNEL+SDLAVS  TKLQ +RH GKYFKQSA ALE+Q+AREARFYGALIR
Sbjct  115  PKPLPNELMSDLAVSAATKLQCYRHLGKYFKQSANALEQQIAREARFYGALIR  167



>ref|XP_002524467.1| hypothetical protein RCOM_0221540 [Ricinus communis]
 gb|EEF37907.1| hypothetical protein RCOM_0221540 [Ricinus communis]
Length=407

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 146/213 (69%), Gaps = 40/213 (19%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            ME  ++ISLDKLP+KR+E +EENG ERFP+ DVGYDEK VSLIRRIDF WAVE++   +K
Sbjct  1    MEGKVEISLDKLPVKRLEAIEENGVERFPT-DVGYDEKRVSLIRRIDFGWAVEKQ-DEEK  58

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
             K+     + SSKE+S++ PWPWQS+VENLQLAHQELSVIIDLINT              
Sbjct  59   NKEKKKQKTKSSKESSSSTPWPWQSMVENLQLAHQELSVIIDLINT--------------  104

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
                                    H GKYFKQSAKA E+Q+AREARFYGALIRLQQNWK+
Sbjct  105  ------------------------HLGKYFKQSAKAFEQQIAREARFYGALIRLQQNWKV  140

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRP  680
            KR RM A    NEGF IDLFDN+L+D A +FRP
Sbjct  141  KRQRMAATALSNEGFTIDLFDNSLYDSASLFRP  173



>gb|AIU49744.1| RNA polymerase II transcription mediator, partial [Asparagus 
officinalis]
Length=517

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 143/208 (69%), Gaps = 38/208 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            I LDKLPIKR+E +EE+G E FPS ++  +E  ++ IRR+DF+  +              
Sbjct  1    IDLDKLPIKRIEAIEESGVEHFPS-EISNEETRLNAIRRVDFSSII--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQSLVENL+ AHQEL+V+IDLINTVEANDAVTVA M RPKQLPN
Sbjct  46   --------------WPWQSLVENLRQAHQELNVVIDLINTVEANDAVTVAWMQRPKQLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDL+VS  TKLQ  RH G+YFKQS+KAL++QV+REARFYG+LIRLQ NWK+KR R  
Sbjct  92   EVLSDLSVSAATKLQWLRHLGRYFKQSSKALDQQVSREARFYGSLIRLQHNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
                GNE F IDL DN++ D     RPS
Sbjct  150  ----GNESFTIDLQDNSILDGP---RPS  170



>gb|AIU49768.1| RNA polymerase II transcription mediator, partial [Ginkgo biloba]
Length=513

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 139/200 (70%), Gaps = 35/200 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            +++D+LPIKR+  +EE+G ER  + ++  +EK ++L+RRIDF  ++              
Sbjct  1    VTVDRLPIKRLNAIEEDGTERI-APEISQEEKPLALLRRIDFGMSI--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQ LVENL  A QELS+IIDLIN VEANDAVTVA MTRPKQLP+
Sbjct  46   --------------WPWQGLVENLHQARQELSIIIDLINHVEANDAVTVAGMTRPKQLPS  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+LSDLA+S +TK QSFRH GKY KQ+AKALE+QVAREARFYGAL+RLQ+NWK+KR R  
Sbjct  92   EVLSDLAISASTKFQSFRHIGKYLKQTAKALEQQVAREARFYGALMRLQRNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNTLHD  659
                GN GF IDL D+T  D
Sbjct  150  ----GNAGFTIDLSDHTSTD  165



>ref|XP_010520586.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 isoform X2 [Tarenaya hassleriana]
Length=645

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 141/184 (77%), Gaps = 8/184 (4%)
 Frame = +3

Query  132  SDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssadsssssketsANQPWPWQSLVENL  311
            SDV YD+K VSLIRRIDFAWAVE ED  KK+K+  +   SS ++        WQ +VENL
Sbjct  17   SDVDYDDKRVSLIRRIDFAWAVEEEDDEKKKKQKKSSKESSGQQ--------WQGMVENL  68

Query  312  QLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYF  491
            +LAHQELSV+IDLINTVEAND  TVA MTRPK LPNE LSDLAVS  TKLQ++R  GKYF
Sbjct  69   RLAHQELSVVIDLINTVEANDVATVAGMTRPKLLPNESLSDLAVSTATKLQAYRQLGKYF  128

Query  492  KQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFV  671
            KQSA+ALE Q+ REARFYGALIRLQ+NWK+KR R++A++  NEGF IDL D +L + A  
Sbjct  129  KQSAQALEHQINREARFYGALIRLQRNWKVKRQRVVASSPSNEGFVIDLSDISLCNSASA  188

Query  672  FRPS  683
             R S
Sbjct  189  LRQS  192



>ref|XP_003569428.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Brachypodium distachyon]
Length=656

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 150/214 (70%), Gaps = 11/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+E +++ LDKLPIKR++ ++E G+E +P  D   +E+ ++ IRR+DF+W +ER+     
Sbjct  1    MDEGVRLDLDKLPIKRLDAIDEAGNEHYPP-DTSSEEQRLAAIRRVDFSWVIERD-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                 A  +  + E +A Q W WQ L+E+LQ A QEL+V++DLI+TVEANDAV V + ++
Sbjct  55   -----AKKAKKAAEDTAQQSWQWQGLMESLQQAQQELTVVLDLISTVEANDAVAVTTTSK  109

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LPNE+L D+AVS  TKLQ  RH G+YFKQSAK +E+Q  +EARFYG+LIRLQQNWK+
Sbjct  110  PKSLPNEVLDDMAVSAATKLQRLRHLGRYFKQSAKTMEQQFQKEARFYGSLIRLQQNWKV  169

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KRHR  A   G++ F  D+ D +  D A + R S
Sbjct  170  KRHRFGATGPGSDSFMFDVVDTSQLDTAAMPRMS  203



>ref|NP_001145828.1| uncharacterized protein LOC100279335 [Zea mays]
 gb|ACF86486.1| unknown [Zea mays]
 gb|ACL52667.1| unknown [Zea mays]
 gb|AFW79766.1| hypothetical protein ZEAMMB73_523859 [Zea mays]
Length=661

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 151/215 (70%), Gaps = 12/215 (6%)
 Frame = +3

Query  42   MEE-DLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPsk  218
            MEE ++++ LDKLPIKR+E +EE G+E +P  D   +E+ ++ IRRIDF+W +E++    
Sbjct  1    MEEGNVRVDLDKLPIKRLEAIEETGNEHYPP-DTSNEEQRLAAIRRIDFSWVIEKD----  55

Query  219  kqkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMT  398
                 +  +  +++  +A Q WPWQ L+E+LQ AHQELSV+IDLI TVEANDAV VAS T
Sbjct  56   -----AKKAKKAAEADTAQQAWPWQGLMESLQQAHQELSVVIDLIGTVEANDAVAVASTT  110

Query  399  RPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWK  578
            +PK  PNE+L D+AVS  TKLQ  RH   YFKQSAK +E+Q  +E RFYG+LIRLQQNWK
Sbjct  111  KPKSQPNEILVDMAVSAATKLQRLRHLSWYFKQSAKTMEQQFQKETRFYGSLIRLQQNWK  170

Query  579  IKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            +KR R +  + G+EGF  DL D++  D   V R S
Sbjct  171  VKRQRAV-GSPGSEGFMFDLVDSSQLDTTTVLRLS  204



>ref|XP_010232920.1| PREDICTED: serine/threonine-protein kinase ATM [Brachypodium 
distachyon]
Length=4646

 Score =   217 bits (552),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 150/215 (70%), Gaps = 11/215 (5%)
 Frame = +3

Query  39    NMEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPsk  218
              M+E +++ LDKLPIKR++ ++E G+E +P  D   +E+ ++ IRR+DF+W +ER+    
Sbjct  991   GMDEGVRLDLDKLPIKRLDAIDEAGNEHYPP-DTSSEEQRLAAIRRVDFSWVIERD----  1045

Query  219   kqkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMT  398
                   A  +  + E +A Q W WQ L+E+LQ A QEL+V++DLI+TVEANDAV V + +
Sbjct  1046  ------AKKAKKAAEDTAQQSWQWQGLMESLQQAQQELTVVLDLISTVEANDAVAVTTTS  1099

Query  399   RPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWK  578
             +PK LPNE+L D+AVS  TKLQ  RH G+YFKQSAK +E+Q  +EARFYG+LIRLQQNWK
Sbjct  1100  KPKSLPNEVLDDMAVSAATKLQRLRHLGRYFKQSAKTMEQQFQKEARFYGSLIRLQQNWK  1159

Query  579   IKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
             +KRHR  A   G++ F  D+ D +  D A + R S
Sbjct  1160  VKRHRFGATGPGSDSFMFDVVDTSQLDTAAMPRMS  1194



>ref|XP_004967947.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Setaria italica]
Length=661

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 147/214 (69%), Gaps = 10/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            +E D+ + LDKLPIKR+E ++E G+E +P  D    E+ ++ IRRIDF+W +E++     
Sbjct  2    VEGDVLLDLDKLPIKRLEAIDEAGNEHYPP-DTSNKEQHLAAIRRIDFSWVIEKD-----  55

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                +  +  +++  +A Q WPWQ L+E+LQ A QELSV+IDLI TVEANDAV VAS T+
Sbjct  56   ----AKKAKKAAEADTAQQAWPWQGLMESLQQAQQELSVVIDLIGTVEANDAVAVASTTK  111

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK  PNE+L D+AVS  TKLQ  RH  +YFKQSAK +E+Q  +E RFY +LIRLQQNWK+
Sbjct  112  PKSQPNEILVDMAVSAATKLQRLRHLSRYFKQSAKTMEQQFQKETRFYNSLIRLQQNWKV  171

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R++ +  G+EGF  DL D+   D   + R S
Sbjct  172  KRQRVVGSGPGSEGFMFDLVDSYQLDTTTMPRVS  205



>ref|NP_001067381.1| Os12g0638600 [Oryza sativa Japonica Group]
 gb|ABA99606.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF30400.1| Os12g0638600 [Oryza sativa Japonica Group]
 dbj|BAG89558.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69746.1| hypothetical protein OsI_39278 [Oryza sativa Indica Group]
Length=655

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 143/214 (67%), Gaps = 10/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            MEE +++ LDKLPIKR+  ++E G+E +P  D   +E+ +S IRRIDF+W ++++     
Sbjct  1    MEEAVRVDLDKLPIKRLHAIDEAGNEHYPP-DTSSEEQRLSAIRRIDFSWVIDKD-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                +      + +    Q WPWQ ++E+LQ A QELSV+IDLI+TVEANDAV VA M +
Sbjct  55   ----AKKPKKDTAQQQQQQAWPWQGMMESLQQAQQELSVVIDLISTVEANDAVAVAGMLK  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LP E L D AVS  TKLQ  RH  +YFKQSAK +E+Q  +E+RFYG+LIRLQQNWK+
Sbjct  111  PKSLPTETLVDTAVSAATKLQRVRHLSRYFKQSAKTMEQQFQKESRFYGSLIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R   +  G+EGF  DL D +  D A + R S
Sbjct  171  KRQRFGGSGPGSEGFMFDLIDTSQLDTAAMPRLS  204



>ref|XP_002457523.1| hypothetical protein SORBIDRAFT_03g008700 [Sorghum bicolor]
 gb|EES02643.1| hypothetical protein SORBIDRAFT_03g008700 [Sorghum bicolor]
Length=659

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 148/213 (69%), Gaps = 11/213 (5%)
 Frame = +3

Query  45   EEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkq  224
            ++D+++ LDKLPIKR+E ++E G+E +P  D   +E+ ++ IRRIDF+W +E++      
Sbjct  3    KDDVRVDLDKLPIKRLEAIDEIGNEHYPP-DTSNEEQRLAAIRRIDFSWVIEKD------  55

Query  225  kkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRP  404
               +  +  +++  +  Q WPWQ L+E+LQ AH ELSV+IDLI TVEANDAV VAS T+P
Sbjct  56   ---AKKAKKAAEADTTQQVWPWQGLMESLQQAHHELSVVIDLIGTVEANDAVAVASTTKP  112

Query  405  KQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIK  584
            K  PNE+L D+AVS  TKLQ  RH  +YFKQSA+ +E+Q  +E RFY +LIRLQQNWK+K
Sbjct  113  KSQPNEILVDMAVSAATKLQRLRHLSRYFKQSARTMEQQFQKETRFYSSLIRLQQNWKVK  172

Query  585  RHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            R R + +  G+EGF  DL D++  D   + R S
Sbjct  173  RQRAVGS-PGSEGFMFDLVDSSQLDTTTMPRLS  204



>gb|AIU49770.1| RNA polymerase II transcription mediator, partial [Zea mays]
Length=516

 Score =   202 bits (513),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 128/197 (65%), Gaps = 35/197 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            + LDKLPIKR+E +EE G+E +P  D   +E+ ++ IRRIDF+W +              
Sbjct  1    VDLDKLPIKRLEAIEETGNEHYPP-DTSNEEQRLAAIRRIDFSWVI--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQ L+E+LQ AHQELSV+IDLI TVEANDAV VAS T+PK  PN
Sbjct  46   --------------WPWQGLMESLQQAHQELSVVIDLIGTVEANDAVAVASTTKPKSQPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+L D+AVS  TKLQ  RH   YFKQSAK +E+Q  +E RFYG+LIRLQQNWK+KR R  
Sbjct  92   EILVDMAVSAATKLQRLRHLSWYFKQSAKTMEQQFQKETRFYGSLIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNT  650
                G+EGF  DL D++
Sbjct  150  ----GSEGFMFDLVDSS  162



>ref|NP_001288373.1| mediator of RNA polymerase II transcription subunit 17-like [Zea 
mays]
 ref|XP_008679945.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X1 [Zea mays]
 gb|ACN26952.1| unknown [Zea mays]
 gb|AFW66512.1| hypothetical protein ZEAMMB73_010825 [Zea mays]
 gb|AFW66513.1| hypothetical protein ZEAMMB73_010825 [Zea mays]
Length=660

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 143/211 (68%), Gaps = 11/211 (5%)
 Frame = +3

Query  51   DLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkk  230
            D+ + LDKLP+KR+E ++E G+E +P  D   +E+ ++ IRRIDF+W +E++        
Sbjct  5    DVLVDLDKLPMKRLEAIDETGNEHYPP-DTSNEEQRLAAIRRIDFSWVIEKD--------  55

Query  231  ssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQ  410
             +  +  +++  +  Q WPWQ L+E+LQ AHQELSV+IDLI TVEANDA+ VAS T+PK 
Sbjct  56   -AKKAKKAAEADTTQQAWPWQGLMESLQQAHQELSVVIDLIGTVEANDAMAVASTTKPKS  114

Query  411  LPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRH  590
             PNE+L D+AV   TKLQ  RH  +YFKQSA  +E+Q  +E RFY +LIRLQQNWK+KR 
Sbjct  115  QPNEILVDMAVCAATKLQCLRHLSRYFKQSATTMEQQFQKETRFYSSLIRLQQNWKVKRQ  174

Query  591  RMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            R + +  G+EGF  DL D +  D   + R S
Sbjct  175  RSVGS-PGSEGFMFDLVDTSQLDTTTMPRLS  204



>gb|AIU49756.1| RNA polymerase II transcription mediator, partial [Ricinus communis]
Length=326

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 119/202 (59%), Gaps = 73/202 (36%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            ISLDKLP+KR+E +EENG ERFP+ DVGYDEK VSLIRRIDF WAV              
Sbjct  1    ISLDKLPVKRLEAIEENGVERFPT-DVGYDEKRVSLIRRIDFGWAV--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQS+VENLQLAHQELSVIIDLINT                    
Sbjct  46   --------------WPWQSMVENLQLAHQELSVIIDLINT--------------------  71

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
                              H GKYFKQSAKA E+Q+AREARFYGALIRLQQNWK+KR R  
Sbjct  72   ------------------HLGKYFKQSAKAFEQQIAREARFYGALIRLQQNWKVKRQR--  111

Query  600  AATSGNEGFYIDLFDNTLHDPA  665
                 NEGF IDLFDN+L+D A
Sbjct  112  ----SNEGFTIDLFDNSLYDSA  129



>gb|AIU49761.1| RNA polymerase II transcription mediator, partial [Sorghum bicolor]
Length=517

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 127/197 (64%), Gaps = 35/197 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            + LDKLPIKR+E ++E G+E +P  D   +E+ ++ IRRIDF+W +              
Sbjct  1    VDLDKLPIKRLEAIDEIGNEHYPP-DTSNEEQRLAAIRRIDFSWVI--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQ L+E+LQ AH ELSV+IDLI TVEANDAV VAS T+PK  PN
Sbjct  46   --------------WPWQGLMESLQQAHHELSVVIDLIGTVEANDAVAVASTTKPKSQPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+L D+AVS  TKLQ  RH  +YFKQSA+ +E+Q  +E RFY +LIRLQQNWK+KR R  
Sbjct  92   EILVDMAVSAATKLQRLRHLSRYFKQSARTMEQQFQKETRFYSSLIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDNT  650
                G+EGF  DL D++
Sbjct  150  ----GSEGFMFDLVDSS  162



>gb|AIU49753.1| RNA polymerase II transcription mediator, partial [Panicum virgatum]
Length=517

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 126/196 (64%), Gaps = 35/196 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            + LDKLPIKR+E ++E G+E +P  D   +E+ ++ IRRIDF+W +              
Sbjct  1    VDLDKLPIKRLEAIDEAGNEHYPP-DTSNEEQRLAAIRRIDFSWVI--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQ L+E+LQ A QELSV+IDLI TVEANDAV VAS T+PK  PN
Sbjct  46   --------------WPWQGLMESLQQAQQELSVVIDLIGTVEANDAVAVASTTKPKPQPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+L D+AVS  TKLQ  RH  +YFKQSAK +E+Q  +E RFY +LIRLQQNWK+KR R  
Sbjct  92   EILVDMAVSAATKLQRLRHLSRYFKQSAKTMEQQFQKETRFYNSLIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDN  647
                G+EGF  DL D+
Sbjct  150  ----GSEGFMFDLVDS  161



>gb|AIU49759.1| RNA polymerase II transcription mediator, partial [Setaria italica]
Length=517

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 125/196 (64%), Gaps = 35/196 (18%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            + LDKLPIKR+E ++E G+E +P  D    E+ ++ IRRIDF+W +              
Sbjct  1    LDLDKLPIKRLEAIDEAGNEHYPP-DTSNKEQHLAAIRRIDFSWVI--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          WPWQ L+E+LQ A QELSV+IDLI TVEANDAV VAS T+PK  PN
Sbjct  46   --------------WPWQGLMESLQQAQQELSVVIDLIGTVEANDAVAVASTTKPKSQPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+L D+AVS  TKLQ  RH  +YFKQSAK +E+Q  +E RFY +LIRLQQNWK+KR R  
Sbjct  92   EILVDMAVSAATKLQRLRHLSRYFKQSAKTMEQQFQKETRFYNSLIRLQQNWKVKRQR--  149

Query  600  AATSGNEGFYIDLFDN  647
                G+EGF  DL D+
Sbjct  150  ----GSEGFMFDLVDS  161



>gb|AIU49772.1| RNA polymerase II transcription mediator, partial [Trachycarpus 
fortunei]
Length=471

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 107/134 (80%), Gaps = 9/134 (7%)
 Frame = +3

Query  282  WPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPNELLSDLAVSMTTKL  461
            WPWQ LVENLQLAHQELS+I+DLINTVEANDAV VA M RPK LPNE+LSDLAVS  TKL
Sbjct  1    WPWQGLVENLQLAHQELSIILDLINTVEANDAVAVAGMQRPKPLPNEVLSDLAVSAATKL  60

Query  462  QSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSGNEGFYIDLF  641
            Q  RH G+YFKQS+KA+E+QV+R+ARFYG+LIRLQQNWK+KR R      G EGF  DL 
Sbjct  61   QRLRHLGRYFKQSSKAMEQQVSRDARFYGSLIRLQQNWKVKRQR------GREGFSFDLL  114

Query  642  DNTLHDPAFVFRPS  683
            DN+  D   + RPS
Sbjct  115  DNSFLD---LTRPS  125



>gb|AIU49726.1| RNA polymerase II transcription mediator, partial [Brachypodium 
distachyon]
Length=516

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 131/202 (65%), Gaps = 35/202 (17%)
 Frame = +3

Query  60   ISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssa  239
            + LDKLPIKR++ ++E G+E +P  D   +E+ ++ IRR+DF+W +              
Sbjct  1    LDLDKLPIKRLDAIDEAGNEHYPP-DTSSEEQRLAAIRRVDFSWVI--------------  45

Query  240  dsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPN  419
                          W WQ L+E+LQ A QEL+V++DLI+TVEANDAV V + ++PK LPN
Sbjct  46   --------------WQWQGLMESLQQAQQELTVVLDLISTVEANDAVAVTTTSKPKSLPN  91

Query  420  ELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMM  599
            E+L D+AVS  TKLQ  RH G+YFKQSAK +E+Q  +EARFYG+LIRLQQNWK+KRHR  
Sbjct  92   EVLDDMAVSAATKLQRLRHLGRYFKQSAKTMEQQFQKEARFYGSLIRLQQNWKVKRHR--  149

Query  600  AATSGNEGFYIDLFDNTLHDPA  665
                G++ F  D+ D +  D A
Sbjct  150  ----GSDSFMFDVVDTSQLDTA  167



>gb|EEE53678.1| hypothetical protein OsJ_37013 [Oryza sativa Japonica Group]
Length=655

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 143/214 (67%), Gaps = 10/214 (5%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            MEE +++ LDKLPIKR+  ++E G+E +P  D   +E+ +S IRRIDF+W ++++     
Sbjct  1    MEEAVRVDLDKLPIKRLHAIDEAGNEHYPP-DTSSEEQRLSAIRRIDFSWVIDKD-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
                +     +   +S+++    + ++E+LQ A QELSV+IDLI+TVEANDAV VA M +
Sbjct  55   ----AKKPKRTPPSSSSSRHGRGRGMMESLQQAQQELSVVIDLISTVEANDAVAVAGMLK  110

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
            PK LP E L D AVS  TKLQ  RH  +YFKQSAK +E+Q  +E+RFYG+LIRLQQNWK+
Sbjct  111  PKSLPTETLVDTAVSAATKLQRVRHLSRYFKQSAKTMEQQFQKESRFYGSLIRLQQNWKV  170

Query  582  KRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R   +  G+EGF  DL D +  D A + R S
Sbjct  171  KRQRFGGSGPGSEGFMFDLIDTSQLDTAAMPRLS  204



>gb|KJB54064.1| hypothetical protein B456_009G019100 [Gossypium raimondii]
Length=604

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 133/216 (62%), Gaps = 46/216 (21%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLP+KR++ +EENG ER+P  +  YDEK VSLIRRIDFAWAVE +     
Sbjct  1    MDGNLEISLDKLPVKRLDAIEENGLERYPP-ESSYDEKRVSLIRRIDFAWAVEED-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            ++K        +    A+  W WQS+VENLQLAHQELSVIIDLINT              
Sbjct  55   EEKERKKKQKKNSSKDASATWQWQSMVENLQLAHQELSVIIDLINT--------------  100

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
                                    H GKYFKQSA ALE+Q+AREARFYGALIRLQQNWK+
Sbjct  101  ------------------------HLGKYFKQSANALEQQIAREARFYGALIRLQQNWKV  136

Query  582  KRHRMM--AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+      S NEGF IDLFDN+L+    + RPS
Sbjct  137  KRQRVAGPGPASSNEGFTIDLFDNSLYSSTPMSRPS  172



>gb|KJB54062.1| hypothetical protein B456_009G019100 [Gossypium raimondii]
Length=633

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 133/216 (62%), Gaps = 46/216 (21%)
 Frame = +3

Query  42   MEEDLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskk  221
            M+ +L+ISLDKLP+KR++ +EENG ER+P  +  YDEK VSLIRRIDFAWAVE +     
Sbjct  1    MDGNLEISLDKLPVKRLDAIEENGLERYPP-ESSYDEKRVSLIRRIDFAWAVEED-----  54

Query  222  qkkssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTR  401
            ++K        +    A+  W WQS+VENLQLAHQELSVIIDLINT              
Sbjct  55   EEKERKKKQKKNSSKDASATWQWQSMVENLQLAHQELSVIIDLINT--------------  100

Query  402  PKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKI  581
                                    H GKYFKQSA ALE+Q+AREARFYGALIRLQQNWK+
Sbjct  101  ------------------------HLGKYFKQSANALEQQIAREARFYGALIRLQQNWKV  136

Query  582  KRHRMM--AATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            KR R+      S NEGF IDLFDN+L+    + RPS
Sbjct  137  KRQRVAGPGPASSNEGFTIDLFDNSLYSSTPMSRPS  172



>gb|EMT09196.1| hypothetical protein F775_08586 [Aegilops tauschii]
Length=668

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 141/207 (68%), Gaps = 16/207 (8%)
 Frame = +3

Query  78   PIKRVEFVEENGDERFP-----SSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkssad  242
            PIKR+E ++E G+E +P     + D   +E+ ++ IRR+DF+W VER+         +  
Sbjct  13   PIKRLEAIDEAGNEHYPPPARRNRDTSSEEQRLAAIRRVDFSWVVERD---------AKK  63

Query  243  sssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPNE  422
            +  ++ E +A + WPWQ L E+LQLA QEL+V++DLI+TVEAND V VA++++P+ LP+E
Sbjct  64   AKKAAAEDAAQKAWPWQGLHESLQLAQQELTVVLDLISTVEANDTVAVATISKPRPLPDE  123

Query  423  LLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMA  602
            +L D+AVS  TKLQ  RH G+YFKQSAK +++Q  +EARFYG+LIRLQQNWK+KR R  A
Sbjct  124  VLVDMAVSAATKLQRLRHLGRYFKQSAKTMQQQFQKEARFYGSLIRLQQNWKVKRQRGNA  183

Query  603  ATSGNEGFYIDLFDNTLHDPAFVFRPS  683
               G   F  D+ D +  D A + R S
Sbjct  184  P--GINSFMFDVVDTSQLDTAAMPRMS  208



>gb|AIU49722.1| RNA polymerase II transcription mediator, partial [Lilium brownii]
Length=461

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 99/123 (80%), Gaps = 6/123 (5%)
 Frame = +3

Query  279  PWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPNELLSDLAVSMTTK  458
            PWPWQ  V++LQLA QELSVI+DLINTVEANDAVTVA M RPKQLPNE+LSDLAVS  TK
Sbjct  2    PWPWQGFVDDLQLAQQELSVIMDLINTVEANDAVTVAGMQRPKQLPNEVLSDLAVSAATK  61

Query  459  LQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSGNEGFYIDL  638
            LQ  R  G+YFKQS+KAL  QVAREA FYG+L RLQQNWKIKR R      G+EGF +DL
Sbjct  62   LQRLRLLGRYFKQSSKALGVQVAREAIFYGSLNRLQQNWKIKRQR------GSEGFTVDL  115

Query  639  FDN  647
             DN
Sbjct  116  VDN  118



>gb|KJB07727.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=565

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +3

Query  360  VEANDAVTVASMTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREAR  539
            V+ANDAVTVA MTRPK LPNE+LSDLAVS  TKLQ +R  GKYFKQSAKALE+Q+AREAR
Sbjct  2    VDANDAVTVAGMTRPKPLPNEVLSDLAVSAATKLQCYRQLGKYFKQSAKALEEQIAREAR  61

Query  540  FYGALIRLQQNWKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            FYGALIRLQQNWK+KR R+ AA S +EGF IDLFDN+L+D A + RPS
Sbjct  62   FYGALIRLQQNWKVKRQRLAAAASSSEGFIIDLFDNSLYDSAAMCRPS  109



>ref|XP_001782525.1| predicted protein [Physcomitrella patens]
 gb|EDQ52677.1| predicted protein [Physcomitrella patens]
Length=626

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 133/196 (68%), Gaps = 8/196 (4%)
 Frame = +3

Query  54   LQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkks  233
            +++SLD LP+KRV  +EE+G E  P  +   +EK+++L+ R+DF    ++       KK 
Sbjct  1    MEVSLDPLPLKRVLAMEESGTELLPP-EPSQEEKSLALLGRLDFGQEFKK------IKKE  53

Query  234  sadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQL  413
               +    KE    Q WPWQ LV++LQ AH EL++I+D+IN VEA +AV VA M RPK  
Sbjct  54   EDGNKKEEKEKEIVQVWPWQGLVDHLQQAHHELAIILDMINHVEAGEAVAVARMERPKLQ  113

Query  414  PNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHR  593
            P E+ SD+A+  ++KL  FR+ GKY K+SA++LE+QV REA FYGAL+RLQ+NWK+KR R
Sbjct  114  PQEICSDVALRASSKLHHFRNVGKYLKRSAQSLEQQVEREAVFYGALMRLQRNWKVKRQR  173

Query  594  MMAAT-SGNEGFYIDL  638
             +AA   G+ GF ID+
Sbjct  174  GVAAGPGGSAGFSIDV  189



>ref|XP_007013392.1| RNA polymerase II transcription mediators isoform 3 [Theobroma 
cacao]
 ref|XP_007013394.1| RNA polymerase II transcription mediators isoform 3 [Theobroma 
cacao]
 gb|EOY31011.1| RNA polymerase II transcription mediators isoform 3 [Theobroma 
cacao]
 gb|EOY31013.1| RNA polymerase II transcription mediators isoform 3 [Theobroma 
cacao]
Length=527

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQN  572
            MTRPK LPNE+LSDLAVS  TKLQ +RH GKYFKQSAKALE+Q+AREARFYGALIRLQQN
Sbjct  1    MTRPKPLPNEVLSDLAVSAATKLQCYRHLGKYFKQSAKALEQQIAREARFYGALIRLQQN  60

Query  573  WKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            WK+KR R+ A +S NEGF IDLFDN+L+D A + RPS
Sbjct  61   WKVKRQRVAAPSSSNEGFTIDLFDNSLYDSATISRPS  97



>ref|XP_007013393.1| RNA polymerase II transcription mediators isoform 4 [Theobroma 
cacao]
 gb|EOY31012.1| RNA polymerase II transcription mediators isoform 4 [Theobroma 
cacao]
Length=556

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQN  572
            MTRPK LPNE+LSDLAVS  TKLQ +RH GKYFKQSAKALE+Q+AREARFYGALIRLQQN
Sbjct  1    MTRPKPLPNEVLSDLAVSAATKLQCYRHLGKYFKQSAKALEQQIAREARFYGALIRLQQN  60

Query  573  WKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            WK+KR R+ A +S NEGF IDLFDN+L+D A + RPS
Sbjct  61   WKVKRQRVAAPSSSNEGFTIDLFDNSLYDSATISRPS  97



>ref|XP_006664786.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Oryza brachyantha]
Length=583

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +3

Query  300  VENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPNELLSDLAVSMTTKLQSFRHF  479
            +E+LQ A QELS++IDLI+TVEANDAV VA M +PK LPNE L D AVS  TKLQ  RH 
Sbjct  1    MESLQQAQQELSIVIDLISTVEANDAVAVAGMLKPKSLPNETLVDTAVSAATKLQRLRHL  60

Query  480  GKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSGNEGFYIDLFDNTLHD  659
            G+YFKQSAK +E+Q  +E+RFYG+LIRLQQNWK+KR R   +  G+EGF  DL D++  D
Sbjct  61   GRYFKQSAKTMEQQFQKESRFYGSLIRLQQNWKVKRQRFGGSGPGSEGFMFDLVDSSQLD  120

Query  660  PAFVFRPS  683
             + + R S
Sbjct  121  TSVMPRLS  128



>gb|KJB07726.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=553

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQN  572
            MTRPK LPNE+LSDLAVS  TKLQ +R  GKYFKQSAKALE+Q+AREARFYGALIRLQQN
Sbjct  1    MTRPKPLPNEVLSDLAVSAATKLQCYRQLGKYFKQSAKALEEQIAREARFYGALIRLQQN  60

Query  573  WKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            WK+KR R+ AA S +EGF IDLFDN+L+D A + RPS
Sbjct  61   WKVKRQRLAAAASSSEGFIIDLFDNSLYDSAAMCRPS  97



>gb|KDO80288.1| hypothetical protein CISIN_1g006207mg [Citrus sinensis]
Length=546

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQN  572
            MTRPK LPNE+LSDL+VS  TKLQ +RH G YFKQSAK+LE+Q+A+EARFYGALIRLQQN
Sbjct  1    MTRPKALPNEVLSDLSVSAATKLQCYRHLGIYFKQSAKSLEQQIAKEARFYGALIRLQQN  60

Query  573  WKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            WK+KR R+ A  SGNEGF IDLFDN+L+D A V RPS
Sbjct  61   WKVKRQRVAAPASGNEGFTIDLFDNSLYDSAPVSRPS  97



>ref|XP_002991906.1| hypothetical protein SELMODRAFT_430185 [Selaginella moellendorffii]
 gb|EFJ07017.1| hypothetical protein SELMODRAFT_430185 [Selaginella moellendorffii]
Length=738

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 130/206 (63%), Gaps = 14/206 (7%)
 Frame = +3

Query  57   QISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkss  236
            +++LD LP+KRV  +EE+G E +P  +   DEK +SL++ +DF    E+E          
Sbjct  3    KVTLDSLPLKRVLALEESGIELYPP-ESSQDEKPLSLLQSLDFERPDEKE----------  51

Query  237  adsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLP  416
                S S +  A+Q WPWQ L+E+   A +EL  ++D I  VE+N+A+TV  M +PK LP
Sbjct  52   -AKKSKSGKDGASQ-WPWQGLIEHFHQAREELMTLLDFIAHVESNEALTVTHMMKPKPLP  109

Query  417  NELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRM  596
            NE  +DLA+   +K +S++    Y K++AK+LE+QV RE+ FYGAL+RLQ+NWKIKR R 
Sbjct  110  NEAGADLALRTASKSRSYKEIASYLKRNAKSLERQVERESVFYGALMRLQRNWKIKRQRG  169

Query  597  MAATSGNE-GFYIDLFDNTLHDPAFV  671
            ++A  G + GF IDL      DP+ +
Sbjct  170  VSAGPGGKAGFLIDLSFPLSVDPSLI  195



>ref|XP_002980116.1| hypothetical protein SELMODRAFT_419660 [Selaginella moellendorffii]
 gb|EFJ18986.1| hypothetical protein SELMODRAFT_419660 [Selaginella moellendorffii]
Length=697

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 130/206 (63%), Gaps = 14/206 (7%)
 Frame = +3

Query  57   QISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkkss  236
            +++LD LP+KRV  +EE+G E +P  +   DEK +SL++ +DF    E+E          
Sbjct  3    KVTLDSLPLKRVLALEESGIELYPP-ESSQDEKPLSLLQSLDFERPDEKE----------  51

Query  237  adsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLP  416
                S S +  A+Q WPWQ L+E+   A +EL  ++D I  VE+N+A+TV  M +PK LP
Sbjct  52   -AKKSKSGKDGASQ-WPWQGLIEHFHQAREELMTLLDFIAHVESNEALTVTHMMKPKPLP  109

Query  417  NELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRM  596
            NE  +DLA+   +K +S++    Y K++AK+LE+QV RE+ FYGAL+RLQ+NWKIKR R 
Sbjct  110  NEAGADLALRTASKSRSYKEIASYLKRNAKSLERQVERESVFYGALMRLQRNWKIKRQRG  169

Query  597  MAATSGNE-GFYIDLFDNTLHDPAFV  671
            ++A  G + GF +DL      DP+ +
Sbjct  170  VSAGPGGKAGFLMDLSFPLSVDPSLI  195



>ref|XP_010420857.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X2 [Camelina sativa]
Length=544

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQN  572
            MTRPK +PNE+LSDLAVS  TKLQ +R+ GKYFKQSAKALE+++ REARFYGALIRLQ+N
Sbjct  1    MTRPKPMPNEILSDLAVSTATKLQGYRNLGKYFKQSAKALEQKINREARFYGALIRLQRN  60

Query  573  WKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            WK+KR RM+A+ + NEGF IDL D++L+DP   FRPS
Sbjct  61   WKVKRQRMLASNASNEGFTIDLSDSSLYDPTSGFRPS  97



>dbj|BAK08012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +3

Query  291  QSLVENLQLAHQELSVIIDLINTVEANDAVTVASMTRPKQLPNELLSDLAVSMTTKLQSF  470
            Q L E+LQLAHQEL+V++DLI+TVEAND VTVA+ ++PK+  +++L ++AVS  TKLQ  
Sbjct  1    QGLHESLQLAHQELTVVLDLISTVEANDTVTVATFSKPKKRLDKVLVNMAVSAATKLQRL  60

Query  471  RHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSGNEGFYIDLFDNT  650
            RH G+YFKQSAK +E+Q  +EARFYG+LIRLQQNWK+ R        G+  F  D+ D +
Sbjct  61   RHLGRYFKQSAKTMEQQFQKEARFYGSLIRLQQNWKVNRQ--CGNAPGSNSFMFDVVDTS  118

Query  651  LHDPAFVFRPS  683
              D A + R S
Sbjct  119  HLDTAVMPRSS  129



>gb|KEH32115.1| RNA polymerase II transcription mediators protein [Medicago truncatula]
Length=552

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  393  MTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQN  572
            MTRPK LPNE LSDLAVS  TKLQ +R  GKYFKQSAKA E+QVAREARFYGALIRLQQN
Sbjct  1    MTRPKSLPNEALSDLAVSAATKLQCYRQVGKYFKQSAKAFEQQVAREARFYGALIRLQQN  60

Query  573  WKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            WK+KR R  +   GNEGF  DLFDN+ +D   + R S
Sbjct  61   WKVKRQRQTSLVPGNEGFTFDLFDNS-YDQGAIVRSS  96



>ref|XP_008809755.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 isoform X2 [Phoenix dactylifera]
Length=556

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQN  572
            M RPK LPNE+LSDL+VS  TKLQ  RH G+YFKQS+KA+E+QV+R+ARFYG+LIRLQQN
Sbjct  1    MQRPKPLPNEVLSDLSVSAATKLQRLRHLGRYFKQSSKAMEQQVSRDARFYGSLIRLQQN  60

Query  573  WKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            WK+KR RM A   G+EGF  DL DN+  D   + RPS
Sbjct  61   WKVKRQRMAAIGPGSEGFSFDLLDNSFLDLTALSRPS  97



>gb|EMS61166.1| hypothetical protein TRIUR3_03686 [Triticum urartu]
Length=570

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = +3

Query  360  VEANDAVTVASMTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREAR  539
            VEAND V VA++++P+ LP+E+L D+AVS  TKLQ  RH G+YFKQSAK +++Q  +EAR
Sbjct  3    VEANDTVAVATISKPRPLPDEVLVDMAVSAATKLQRLRHLGRYFKQSAKTMQQQFQKEAR  62

Query  540  FYGALIRLQQNWKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            FYG+LIRLQQNWK+KR R  A   G   F  D+ D +  D A + R S
Sbjct  63   FYGSLIRLQQNWKVKRQRGNAP--GINSFMFDVVDTSQLDTAAMPRMS  108



>gb|AIU49738.1| RNA polymerase II transcription mediator, partial [Buxus sinica]
Length=415

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 60/77 (78%), Gaps = 9/77 (12%)
 Frame = +3

Query  453  TKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSGNEGFYI  632
            TKLQ FRH GKYFKQSAK LEKQVAREARFYG+LIRLQQNWK+KR R       +EGF I
Sbjct  2    TKLQCFRHLGKYFKQSAKGLEKQVAREARFYGSLIRLQQNWKVKRQR------SSEGFTI  55

Query  633  DLFDNTLHDPAFVFRPS  683
            DLFDN+L DP    RPS
Sbjct  56   DLFDNSLSDPT---RPS  69



>dbj|BAJ93746.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  360  VEANDAVTVASMTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREAR  539
            VEAND VTVA+ ++PK+  +++L ++AVS  TKLQ  RH G+YFKQSAK +E+Q  +EAR
Sbjct  15   VEANDTVTVATFSKPKKRLDKVLVNMAVSAATKLQRLRHLGRYFKQSAKTMEQQFQKEAR  74

Query  540  FYGALIRLQQNWKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            FYG+LIRLQQNWK+ R        G+  F  D+ D +  D A + R S
Sbjct  75   FYGSLIRLQQNWKVNRQ--CGNAPGSNSFMFDVVDTSHLDTAVMPRSS  120



>ref|XP_008679946.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X2 [Zea mays]
Length=557

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +3

Query  378  VTVASMTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALI  557
            + VAS T+PK  PNE+L D+AV   TKLQ  RH  +YFKQSA  +E+Q  +E RFY +LI
Sbjct  1    MAVASTTKPKSQPNEILVDMAVCAATKLQCLRHLSRYFKQSATTMEQQFQKETRFYSSLI  60

Query  558  RLQQNWKIKRHRMMAATSGNEGFYIDLFDNTLHDPAFVFRPS  683
            RLQQNWK+KR R + +  G+EGF  DL D +  D   + R S
Sbjct  61   RLQQNWKVKRQRSVGS-PGSEGFMFDLVDTSQLDTTTMPRLS  101



>ref|XP_008654792.1| PREDICTED: uncharacterized protein LOC100279335 isoform X1 [Zea 
mays]
Length=539

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  435  LAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSG  614
            +AVS  TKLQ  RH   YFKQSAK +E+Q  +E RFYG+LIRLQQNWK+KR R +  + G
Sbjct  1    MAVSAATKLQRLRHLSWYFKQSAKTMEQQFQKETRFYGSLIRLQQNWKVKRQRAV-GSPG  59

Query  615  NEGFYIDLFDNTLHDPAFVFRPS  683
            +EGF  DL D++  D   V R S
Sbjct  60   SEGFMFDLVDSSQLDTTTVLRLS  82



>gb|EMT20869.1| hypothetical protein F775_22791 [Aegilops tauschii]
Length=549

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 2/83 (2%)
 Frame = +3

Query  435  LAVSMTTKLQSFRHFGKYFKQSAKALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSG  614
            +AVS  TKLQ  RH G+YFKQSAK +E+Q  +EARFYG+LIRLQQNWK+KR R  A   G
Sbjct  1    MAVSAATKLQRLRHLGQYFKQSAKTMEQQFQKEARFYGSLIRLQQNWKVKRQRGNAP--G  58

Query  615  NEGFYIDLFDNTLHDPAFVFRPS  683
            +  F  D+ D +  D   + R S
Sbjct  59   SNSFMFDVVDTSQLDTTAMSRLS  81



>emb|CBI38915.3| unnamed protein product [Vitis vinifera]
Length=269

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = +3

Query  54   LQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVERE  206
            ++ISLDKLPIKR++ +EENG ERFP+ DVGYD+K VSLIRRIDFAWAVE++
Sbjct  70   MEISLDKLPIKRLDAIEENGVERFPT-DVGYDDKWVSLIRRIDFAWAVEKD  119



>gb|AIU49773.1| RNA polymerase II transcription mediator, partial [Cabomba caroliniana]
Length=397

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 41/55 (75%), Gaps = 6/55 (11%)
 Frame = +3

Query  504  KALEKQVAREARFYGALIRLQQNWKIKRHRMMAATSGNEGFYIDLFDNTLHDPAF  668
            KALE+QVARE+RFYGAL RLQQNWK+KR R      GNEGF IDL DN+  DP  
Sbjct  1    KALEQQVARESRFYGALSRLQQNWKVKRQR------GNEGFTIDLSDNSSSDPTL  49



>emb|CAN63371.1| hypothetical protein VITISV_031279 [Vitis vinifera]
Length=348

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = +3

Query  72   KLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVERE  206
            KLPIKR++ +EENG ERFP+ DV YD+K VSLI RIDFAWAVE +
Sbjct  178  KLPIKRLDAIEENGVERFPT-DVCYDDKWVSLIWRIDFAWAVEND  221



>ref|XP_009861198.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Ciona intestinalis]
Length=653

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/197 (22%), Positives = 87/197 (44%), Gaps = 34/197 (17%)
 Frame = +3

Query  51   DLQISLDKLPIKRVEFVEENGDERFPSSDVGYDEKTVSLIRRIDFAWAVEREDPskkqkk  230
            +++ISL  L   +++ +  NG E F    +   E    L  RI+F    E +        
Sbjct  6    NVKISLQPLSETKIQEIAYNGRETFIPP-LSMSESLTDLANRINFLAEDESD--------  56

Query  231  ssadsssssketsANQPWPWQSLVENLQLAHQELSVIIDLINTVEANDAVT---------  383
                     ++ +  + WPW+++  +LQ A  E++V++D++   +  D+ +         
Sbjct  57   ---VDQDVERKLTPGKQWPWENIRSHLQSALIEMNVLVDVMAIAQNKDSTSKDKQESTDP  113

Query  384  -----VASMTRPKQLPNELLSDLAVSMTTKLQSFRHFGKYFKQSAKALEK---QVAREAR  539
                  +S+ +  + P  +L      M TK +     GK     A+ L K   +V+ +  
Sbjct  114  NRYLMFSSVAKEAETPKPML-----QMITKKRCLGAAGKILLDGAERLNKARNEVSTQQN  168

Query  540  FYGALIRLQQNWKIKRH  590
            F+  L++L+Q W+++RH
Sbjct  169  FHAQLLKLRQRWRVRRH  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060