BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF027C12

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADE42972.1|  putative 60S ribosomal protein L18a                     263   4e-92   Gardenia jasminoides
ref|XP_004241806.1|  PREDICTED: 60S ribosomal protein L18a              264   5e-92   Solanum lycopersicum
emb|CDP06299.1|  unnamed protein product                                261   1e-91   Coffea canephora [robusta coffee]
ref|NP_001275107.1|  60S ribosomal protein L18a-like                    263   1e-91   Solanum tuberosum [potatoes]
ref|XP_009799848.1|  PREDICTED: 60S ribosomal protein L18a              264   2e-91   Nicotiana sylvestris
ref|XP_006363066.1|  PREDICTED: 60S ribosomal protein L18a-like         263   2e-91   Solanum tuberosum [potatoes]
ref|XP_010324737.1|  PREDICTED: 60S ribosomal protein L18a-like         262   3e-91   Solanum lycopersicum
ref|XP_008229704.1|  PREDICTED: uncharacterized protein LOC103329046    259   3e-91   Prunus mume [ume]
ref|XP_009609142.1|  PREDICTED: 60S ribosomal protein L18a              263   4e-91   Nicotiana tomentosiformis
ref|NP_001275252.1|  uncharacterized protein LOC102577837               260   5e-91   Solanum tuberosum [potatoes]
ref|NP_001275234.1|  60S ribosomal protein L18a-like                    261   5e-91   Solanum tuberosum [potatoes]
ref|XP_011071121.1|  PREDICTED: 60S ribosomal protein L18a              262   6e-91   Sesamum indicum [beniseed]
ref|XP_006595492.1|  PREDICTED: uncharacterized protein LOC100305...    262   7e-91   
ref|XP_009598886.1|  PREDICTED: 60S ribosomal protein L18a-like         261   8e-91   Nicotiana tomentosiformis
ref|XP_006387417.1|  60S ribosomal protein L18a-1                       260   9e-91   
gb|ABB29925.1|  unknown                                                 260   9e-91   Solanum tuberosum [potatoes]
ref|XP_009782492.1|  PREDICTED: 60S ribosomal protein L18a-like         262   1e-90   Nicotiana sylvestris
ref|XP_011096544.1|  PREDICTED: 60S ribosomal protein L18a-like         258   2e-90   Sesamum indicum [beniseed]
ref|XP_006574359.1|  PREDICTED: uncharacterized protein LOC100527...    260   2e-90   
ref|XP_002528496.1|  60S ribosomal protein L18a, putative               261   2e-90   Ricinus communis
ref|XP_006477944.1|  PREDICTED: 60S ribosomal protein L18a-like i...    257   3e-90   Citrus sinensis [apfelsine]
ref|XP_009406265.1|  PREDICTED: 60S ribosomal protein L18a              260   3e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008465452.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    256   4e-90   Cucumis melo [Oriental melon]
ref|XP_007215058.1|  hypothetical protein PRUPE_ppa012231mg             258   5e-90   
gb|ABK92715.1|  unknown                                                 260   5e-90   Populus trichocarpa [western balsam poplar]
ref|XP_004166596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    256   6e-90   
ref|XP_002317384.1|  60S ribosomal protein L18a-1                       259   6e-90   Populus trichocarpa [western balsam poplar]
ref|XP_011009655.1|  PREDICTED: 60S ribosomal protein L18a-2            260   7e-90   Populus euphratica
ref|XP_004134633.1|  PREDICTED: 60S ribosomal protein L18a-like         257   8e-90   Cucumis sativus [cucumbers]
ref|XP_009389413.1|  PREDICTED: 60S ribosomal protein L18a-like         262   1e-89   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004147412.1|  PREDICTED: 60S ribosomal protein L18a-like         257   1e-89   
ref|XP_010924380.1|  PREDICTED: 60S ribosomal protein L18a              259   1e-89   Elaeis guineensis
gb|KHG02356.1|  60S ribosomal L18a                                      257   1e-89   Gossypium arboreum [tree cotton]
ref|XP_006449674.1|  hypothetical protein CICLE_v10016900mg             256   1e-89   Citrus clementina [clementine]
gb|KHN38335.1|  60S ribosomal protein L18a                              260   1e-89   Glycine soja [wild soybean]
ref|XP_008798296.1|  PREDICTED: 60S ribosomal protein L18a              260   1e-89   Phoenix dactylifera
ref|XP_011074018.1|  PREDICTED: 60S ribosomal protein L18a-2-like       263   2e-89   Sesamum indicum [beniseed]
ref|XP_008811096.1|  PREDICTED: 60S ribosomal protein L18a              258   2e-89   Phoenix dactylifera
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748    255   2e-89   
ref|XP_011002051.1|  PREDICTED: 60S ribosomal protein L18a-like         257   2e-89   Populus euphratica
gb|KCW89756.1|  hypothetical protein EUGRSUZ_A02018                     258   2e-89   Eucalyptus grandis [rose gum]
ref|XP_008444078.1|  PREDICTED: 60S ribosomal protein L18a              256   2e-89   Cucumis melo [Oriental melon]
ref|XP_006442292.1|  hypothetical protein CICLE_v10022114mg             254   2e-89   Citrus clementina [clementine]
ref|XP_008439644.1|  PREDICTED: 60S ribosomal protein L18a              255   2e-89   Cucumis melo [Oriental melon]
gb|KCW75929.1|  hypothetical protein EUGRSUZ_D00304                     258   3e-89   Eucalyptus grandis [rose gum]
ref|XP_010918885.1|  PREDICTED: 60S ribosomal protein L18a-like         260   3e-89   
gb|KDO51884.1|  hypothetical protein CISIN_1g030276mg                   254   3e-89   Citrus sinensis [apfelsine]
ref|XP_009394206.1|  PREDICTED: 60S ribosomal protein L18a-like         257   3e-89   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002300869.1|  60S ribosomal protein L18a-1                       257   4e-89   Populus trichocarpa [western balsam poplar]
ref|XP_010655647.1|  PREDICTED: 60S ribosomal protein L18a isofor...    252   4e-89   Vitis vinifera
ref|XP_008789456.1|  PREDICTED: 60S ribosomal protein L18a-2            262   5e-89   Phoenix dactylifera
ref|XP_010542333.1|  PREDICTED: 60S ribosomal protein L18a isofor...    255   5e-89   Tarenaya hassleriana [spider flower]
gb|KHG16522.1|  60S ribosomal L18a                                      258   5e-89   Gossypium arboreum [tree cotton]
gb|EYU33348.1|  hypothetical protein MIMGU_mgv1a014797mg                256   6e-89   Erythranthe guttata [common monkey flower]
ref|XP_010053843.1|  PREDICTED: 60S ribosomal protein L18a              257   6e-89   
gb|EYU36633.1|  hypothetical protein MIMGU_mgv1a014793mg                253   6e-89   Erythranthe guttata [common monkey flower]
ref|XP_007025105.1|  Ribosomal protein L18ae/LX family protein          256   7e-89   
ref|XP_010052071.1|  PREDICTED: 60S ribosomal protein L18a-like i...    257   9e-89   Eucalyptus grandis [rose gum]
ref|XP_006437137.1|  hypothetical protein CICLE_v10032878mg             253   1e-88   
gb|ACS96446.1|  60S ribosomal protein L18a                              255   1e-88   Jatropha curcas
ref|XP_002276260.1|  PREDICTED: 60S ribosomal protein L18a              252   1e-88   Vitis vinifera
gb|KHG16962.1|  60S ribosomal L18a                                      256   1e-88   Gossypium arboreum [tree cotton]
gb|KHG29727.1|  60S ribosomal L18a                                      253   1e-88   Gossypium arboreum [tree cotton]
ref|XP_010538246.1|  PREDICTED: 60S ribosomal protein L18a-like         254   1e-88   Tarenaya hassleriana [spider flower]
ref|XP_009399317.1|  PREDICTED: 60S ribosomal protein L18a-like         258   2e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796386.1|  PREDICTED: 60S ribosomal protein L18a-like         260   2e-88   Phoenix dactylifera
gb|KJB10614.1|  hypothetical protein B456_001G211400                    256   2e-88   Gossypium raimondii
ref|XP_002268750.1|  PREDICTED: 60S ribosomal protein L18a              253   2e-88   Vitis vinifera
gb|ABK94361.1|  unknown                                                 254   3e-88   Populus trichocarpa [western balsam poplar]
gb|KJB42782.1|  hypothetical protein B456_007G174800                    257   4e-88   Gossypium raimondii
ref|XP_007048983.1|  Ribosomal protein L18ae/LX family protein          256   5e-88   Theobroma cacao [chocolate]
gb|EYU43268.1|  hypothetical protein MIMGU_mgv1a013972mg                249   5e-88   Erythranthe guttata [common monkey flower]
ref|NP_001237207.1|  uncharacterized protein LOC100527007               254   6e-88   
ref|XP_004491319.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    251   6e-88   
ref|NP_001237679.1|  uncharacterized protein LOC100306365               252   6e-88   Glycine max [soybeans]
gb|KJB57268.1|  hypothetical protein B456_009G155900                    251   9e-88   Gossypium raimondii
gb|KHG26670.1|  60S ribosomal L18a                                      255   1e-87   Gossypium arboreum [tree cotton]
ref|XP_003617399.1|  60S ribosomal protein L18a                         248   1e-87   
gb|KJB69800.1|  hypothetical protein B456_011G042900                    253   2e-87   Gossypium raimondii
ref|NP_001238728.1|  uncharacterized protein LOC100306174               251   2e-87   Glycine max [soybeans]
ref|XP_010540563.1|  PREDICTED: 60S ribosomal protein L18a              251   2e-87   Tarenaya hassleriana [spider flower]
ref|XP_010552158.1|  PREDICTED: 60S ribosomal protein L18a              250   2e-87   Tarenaya hassleriana [spider flower]
ref|XP_006410594.1|  hypothetical protein EUTSA_v10017304mg             251   2e-87   Eutrema salsugineum [saltwater cress]
ref|XP_009407842.1|  PREDICTED: 60S ribosomal protein L18a-like         254   3e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010263115.1|  PREDICTED: 60S ribosomal protein L18a-2            256   3e-87   Nelumbo nucifera [Indian lotus]
sp|Q9ATF5.1|RL18A_CASSA  RecName: Full=60S ribosomal protein L18a       248   3e-87   Castanea sativa
emb|CDX97587.1|  BnaA05g24920D                                          257   3e-87   
ref|XP_004486036.1|  PREDICTED: 60S ribosomal protein L18a-like         253   4e-87   Cicer arietinum [garbanzo]
emb|CDX75778.1|  BnaC03g38610D                                          256   4e-87   
ref|NP_001236918.1|  uncharacterized protein LOC100500108               250   4e-87   Glycine max [soybeans]
ref|XP_007212144.1|  hypothetical protein PRUPE_ppa012251mg             256   5e-87   Prunus persica
gb|AFK40398.1|  unknown                                                 253   5e-87   Medicago truncatula
ref|XP_008380196.1|  PREDICTED: 60S ribosomal protein L18a-2-like       254   5e-87   Malus domestica [apple tree]
gb|AFK44558.1|  unknown                                                 250   5e-87   Lotus japonicus
gb|KHG27228.1|  60S ribosomal L18a                                      252   8e-87   Gossypium arboreum [tree cotton]
gb|AFK33651.1|  unknown                                                 251   1e-86   Lotus japonicus
ref|XP_007136179.1|  hypothetical protein PHAVU_009G024800g             250   1e-86   Phaseolus vulgaris [French bean]
gb|AFK46978.1|  unknown                                                 251   2e-86   Lotus japonicus
ref|XP_008371596.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    255   2e-86   Malus domestica [apple tree]
ref|XP_007159262.1|  hypothetical protein PHAVU_002G223200g             247   2e-86   Phaseolus vulgaris [French bean]
ref|XP_007147889.1|  hypothetical protein PHAVU_006G163400g             247   3e-86   Phaseolus vulgaris [French bean]
ref|XP_006467486.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    254   3e-86   Citrus sinensis [apfelsine]
emb|CDX79564.1|  BnaC03g19000D                                          253   4e-86   
ref|XP_006841639.1|  hypothetical protein AMTR_s00003p00234980          251   4e-86   Amborella trichopoda
ref|XP_010542335.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    253   5e-86   Tarenaya hassleriana [spider flower]
ref|XP_006407062.1|  hypothetical protein EUTSA_v10021546mg             255   5e-86   Eutrema salsugineum [saltwater cress]
ref|XP_004488610.1|  PREDICTED: 60S ribosomal protein L18a-like i...    249   7e-86   Cicer arietinum [garbanzo]
ref|XP_009146339.1|  PREDICTED: 60S ribosomal protein L18a-2            256   8e-86   Brassica rapa
ref|XP_002276545.1|  PREDICTED: 60S ribosomal protein L18a isofor...    250   9e-86   Vitis vinifera
ref|XP_009135390.1|  PREDICTED: 60S ribosomal protein L18a-2-like       256   1e-85   Brassica rapa
ref|XP_009132991.1|  PREDICTED: 60S ribosomal protein L18a-2-like       251   2e-85   Brassica rapa
ref|XP_009360876.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    254   2e-85   Pyrus x bretschneideri [bai li]
ref|XP_010052072.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    254   2e-85   Eucalyptus grandis [rose gum]
gb|KEH33554.1|  60S ribosomal protein L18a-3                            253   2e-85   Medicago truncatula
ref|XP_008225468.1|  PREDICTED: 60S ribosomal protein L18a isofor...    255   2e-85   
gb|KFK36339.1|  hypothetical protein AALP_AA4G109800                    251   3e-85   Arabis alpina [alpine rockcress]
ref|XP_011085620.1|  PREDICTED: 60S ribosomal protein L18a-like         258   3e-85   
ref|XP_008371597.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    254   3e-85   Malus domestica [apple tree]
ref|XP_002519698.1|  60S ribosomal protein L18a, putative               256   3e-85   Ricinus communis
ref|XP_006298665.1|  hypothetical protein CARUB_v10014756mg             253   3e-85   Capsella rubella
ref|XP_006601742.1|  PREDICTED: uncharacterized protein LOC100306...    252   3e-85   
ref|XP_006387416.1|  hypothetical protein POPTR_1064s00200g             261   4e-85   
ref|XP_003597433.1|  60S ribosomal protein L18a                         247   6e-85   
ref|XP_006295085.1|  hypothetical protein CARUB_v10024156mg             250   6e-85   Capsella rubella
ref|XP_010465351.1|  PREDICTED: 60S ribosomal protein L18a-3            254   7e-85   Camelina sativa [gold-of-pleasure]
ref|XP_009141387.1|  PREDICTED: 60S ribosomal protein L18a-2            252   8e-85   Brassica rapa
ref|XP_004488609.1|  PREDICTED: 60S ribosomal protein L18a-like i...    249   8e-85   
ref|XP_006407063.1|  hypothetical protein EUTSA_v10021546mg             256   2e-84   
ref|NP_180995.1|  60S ribosomal protein L18a-2                          250   2e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004303886.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    249   2e-84   Fragaria vesca subsp. vesca
ref|XP_010504908.1|  PREDICTED: 60S ribosomal protein L18a-2            250   3e-84   Camelina sativa [gold-of-pleasure]
gb|KFK44821.1|  hypothetical protein AALP_AA1G307200                    250   5e-84   Arabis alpina [alpine rockcress]
gb|KJB34967.1|  hypothetical protein B456_006G092900                    258   1e-83   Gossypium raimondii
ref|XP_006415527.1|  hypothetical protein EUTSA_v10009933mg             252   1e-83   
ref|XP_002440257.1|  hypothetical protein SORBIDRAFT_09g028590          240   1e-83   Sorghum bicolor [broomcorn]
gb|KJB10615.1|  hypothetical protein B456_001G211400                    257   1e-83   Gossypium raimondii
gb|KJB69797.1|  hypothetical protein B456_011G042800                    257   1e-83   Gossypium raimondii
emb|CDX98480.1|  BnaC05g38950D                                          257   1e-83   
ref|XP_002449311.1|  hypothetical protein SORBIDRAFT_05g007540          242   2e-83   Sorghum bicolor [broomcorn]
ref|NP_001237792.1|  uncharacterized protein LOC100305604               257   2e-83   
ref|NP_001056335.1|  Os05g0565000                                       240   3e-83   
emb|CDX82474.1|  BnaA03g33470D                                          256   3e-83   
ref|XP_010499515.1|  PREDICTED: 60S ribosomal protein L18a-1            249   3e-83   Camelina sativa [gold-of-pleasure]
gb|EMS54441.1|  60S ribosomal protein L18a                              244   3e-83   Triticum urartu
ref|XP_010501986.1|  PREDICTED: 60S ribosomal protein L18a-3-like       251   3e-83   Camelina sativa [gold-of-pleasure]
gb|ABK26330.1|  unknown                                                 240   3e-83   Picea sitchensis
ref|NP_188078.1|  60S ribosomal protein L18a-3                          248   4e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004303885.2|  PREDICTED: 60S ribosomal protein L18a-2 isof...    249   5e-83   Fragaria vesca subsp. vesca
gb|EYU33347.1|  hypothetical protein MIMGU_mgv1a014797mg                256   5e-83   Erythranthe guttata [common monkey flower]
gb|ADU56180.1|  hypothetical protein                                    256   5e-83   Jatropha curcas
gb|ACG30921.1|  60S ribosomal protein L18a                              238   5e-83   Zea mays [maize]
ref|NP_001149475.1|  LOC100283101                                       240   7e-83   Zea mays [maize]
ref|NP_001148024.1|  60S ribosomal protein L18a                         238   8e-83   Zea mays [maize]
ref|XP_002882886.1|  60S ribosomal protein L18A                         247   8e-83   
ref|XP_006654794.1|  PREDICTED: 60S ribosomal protein L18a-like         238   9e-83   Oryza brachyantha
gb|EMT07340.1|  60S ribosomal protein L18a                              242   1e-82   
ref|XP_006306031.1|  hypothetical protein CARUB_v10011327mg             249   1e-82   
ref|XP_006644488.1|  PREDICTED: 60S ribosomal protein L18a-like         239   1e-82   Oryza brachyantha
ref|XP_010679799.1|  PREDICTED: 60S ribosomal protein L18a-2            242   1e-82   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM65890.1|  putative 60S ribosomal protein L18A                     246   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969468.1|  PREDICTED: 60S ribosomal protein L18a-like         238   2e-82   Setaria italica
ref|XP_003567891.1|  PREDICTED: 60S ribosomal protein L18a-like         242   2e-82   Brachypodium distachyon [annual false brome]
gb|ACN28455.1|  unknown                                                 236   2e-82   Zea mays [maize]
ref|XP_010460775.1|  PREDICTED: 60S ribosomal protein L18a-1-like       247   2e-82   Camelina sativa [gold-of-pleasure]
dbj|BAJ85943.1|  predicted protein                                      242   2e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF78859.1|  unknown                                                 238   2e-82   Zea mays [maize]
ref|NP_001043805.2|  Os01g0666900                                       238   2e-82   
gb|EMT24993.1|  60S ribosomal protein L18a                              241   2e-82   
emb|CDX84313.1|  BnaC04g10750D                                          254   3e-82   
emb|CDX84643.1|  BnaA03g15870D                                          254   3e-82   
ref|NP_001044264.1|  Os01g0752300                                       239   4e-82   
ref|NP_001152227.1|  60S ribosomal protein L18a                         237   4e-82   Zea mays [maize]
ref|XP_004979031.1|  PREDICTED: 60S ribosomal protein L18a-like         237   5e-82   Setaria italica
emb|CDY43672.1|  BnaA04g20190D                                          253   8e-82   Brassica napus [oilseed rape]
ref|XP_003569521.1|  PREDICTED: 60S ribosomal protein L18a-like         239   8e-82   Brachypodium distachyon [annual false brome]
ref|XP_010940708.1|  PREDICTED: 60S ribosomal protein L18a-2-like       239   9e-82   Elaeis guineensis
ref|XP_009109630.1|  PREDICTED: 60S ribosomal protein L18a-2            244   1e-81   Brassica rapa
ref|XP_010936051.1|  PREDICTED: 60S ribosomal protein L18a-2            238   1e-81   Elaeis guineensis
ref|XP_006828776.1|  hypothetical protein AMTR_s00001p00102800          252   1e-81   
emb|CDY35269.1|  BnaC03g59540D                                          245   4e-81   Brassica napus [oilseed rape]
ref|NP_849729.1|  ribosomal protein L18ae/LX family protein             243   9e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004961208.1|  PREDICTED: 60S ribosomal protein L18a-like         238   1e-80   
ref|XP_010666370.1|  PREDICTED: 60S ribosomal protein L18a-like         236   3e-80   Beta vulgaris subsp. vulgaris [field beet]
gb|ACG47612.1|  60S ribosomal protein L18a                              229   3e-80   Zea mays [maize]
dbj|BAH20340.1|  AT3G14600                                              249   3e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001152434.1|  LOC100286074                                       233   3e-80   
ref|XP_010549484.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    252   5e-80   Tarenaya hassleriana [spider flower]
ref|XP_002893593.1|  60S ribosomal protein L18A-1                       244   5e-80   
ref|XP_006387717.1|  hypothetical protein POPTR_0647s00210g             248   8e-80   
dbj|BAB90499.1|  ribosomal protein L18a-like                            238   2e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569823.1|  PREDICTED: 60S ribosomal protein L18a              232   2e-79   Brachypodium distachyon [annual false brome]
ref|NP_001077626.1|  60S ribosomal protein L18a-1                       242   5e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003617398.1|  60S ribosomal protein L18a                         245   6e-79   
ref|XP_001762693.1|  predicted protein                                  233   2e-78   
ref|XP_001765218.1|  predicted protein                                  231   5e-78   
gb|EEE55145.1|  hypothetical protein OsJ_02939                          223   6e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004144680.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    219   7e-78   
ref|XP_009419339.1|  PREDICTED: 60S ribosomal protein L18a-like         228   1e-77   
ref|XP_001752605.1|  predicted protein                                  230   2e-77   
ref|XP_001760636.1|  predicted protein                                  232   1e-76   
gb|AAG52055.1|AC022455_9  60S ribosomal protein L18A, putative; 2...    233   1e-76   Arabidopsis thaliana [mouse-ear cress]
pdb|3IZS|S  Chain S, Localization Of The Large Subunit Ribosomal ...    221   2e-76   Saccharomyces cerevisiae [brewer's yeast]
ref|XP_011460183.1|  PREDICTED: 60S ribosomal protein L18a              226   9e-75   Fragaria vesca subsp. vesca
ref|XP_002961150.1|  hypothetical protein SELMODRAFT_227198             224   5e-74   Selaginella moellendorffii
ref|XP_007146225.1|  hypothetical protein PHAVU_006G022700g             196   2e-71   Phaseolus vulgaris [French bean]
ref|XP_006384076.1|  60S ribosomal protein L18a-1                       223   1e-70   
gb|KDO49364.1|  hypothetical protein CISIN_1g028910mg                   223   2e-70   Citrus sinensis [apfelsine]
ref|XP_005652280.1|  60S ribosomal protein L18a-2                       210   3e-68   Coccomyxa subellipsoidea C-169
ref|XP_005848088.1|  hypothetical protein CHLNCDRAFT_30965              206   2e-67   Chlorella variabilis
gb|AFW81143.1|  hypothetical protein ZEAMMB73_376835                    213   2e-66   
ref|XP_009144150.1|  PREDICTED: 60S ribosomal protein L18a-2-like       210   2e-65   
gb|AAT08714.1|  ribosomal protein L18A                                  210   1e-64   Hyacinthus orientalis [common hyacinth]
gb|KCW89757.1|  hypothetical protein EUGRSUZ_A02018                     173   5e-64   Eucalyptus grandis [rose gum]
gb|KIZ01204.1|  60S ribosomal protein L18a-2                            206   3e-63   Monoraphidium neglectum
gb|ACN30573.1|  unknown                                                 203   7e-63   Zea mays [maize]
ref|XP_011401286.1|  60S ribosomal protein L18a-2                       187   7e-61   Auxenochlorella protothecoides
ref|XP_001689743.1|  ribosomal protein L18a, component of cytosol...    189   9e-61   Chlamydomonas reinhardtii
gb|KHN49096.1|  60S ribosomal protein L18a-2                            197   3e-60   Glycine soja [wild soybean]
ref|XP_002948508.1|  ribosomal protein L18A component of cytosoli...    187   6e-60   Volvox carteri f. nagariensis
gb|KDD75676.1|  ribosomal protein L18ae/LX                              188   2e-59   Helicosporidium sp. ATCC 50920
emb|CDY71447.1|  BnaAnng37490D                                          189   1e-57   Brassica napus [oilseed rape]
ref|XP_007508296.1|  unknown                                            170   3e-53   Bathycoccus prasinos
ref|XP_001418811.1|  Ribosomal protein L18a, component of cytosol...    166   2e-52   Ostreococcus lucimarinus CCE9901
ref|XP_008880083.1|  hypothetical protein H310_14105                    164   3e-51   Aphanomyces invadans
gb|ADV03035.1|  ribosomal protein L18A                                  162   4e-51   Karlodinium veneficum
emb|CEF98555.1|  Ribosomal protein L18ae                                159   1e-50   Ostreococcus tauri
gb|KHN11975.1|  60S ribosomal protein L18a-2                            169   5e-50   Glycine soja [wild soybean]
ref|XP_009831602.1|  hypothetical protein H257_07690                    159   9e-50   Aphanomyces astaci
emb|CBI30857.3|  unnamed protein product                                120   2e-49   Vitis vinifera
ref|XP_008604133.1|  50S ribosomal protein L18Ae                        157   2e-49   Saprolegnia diclina VS20
ref|XP_003062312.1|  predicted protein                                  151   7e-49   Micromonas pusilla CCMP1545
gb|KGN65560.1|  hypothetical protein Csa_1G448420                       166   8e-49   Cucumis sativus [cucumbers]
gb|KHF99199.1|  60S ribosomal L18a                                      168   9e-49   Gossypium arboreum [tree cotton]
gb|ABQ42114.1|  60S ribosomal protein L18a                              159   1e-48   Sonneratia caseolaris
gb|ABQ42113.1|  60S ribosomal protein L18a                              157   2e-48   Sonneratia alba
gb|EMS66554.1|  60S ribosomal protein L18a                              165   1e-47   Triticum urartu
ref|XP_002501229.1|  predicted protein                                  155   4e-47   Micromonas commoda
ref|XP_005702735.1|  60S ribosomal protein L18Ae                        155   2e-46   Galdieria sulphuraria
gb|ADV03042.1|  ribosomal protein L18A                                  148   7e-46   Amphidinium carterae
gb|ACS68696.1|  60S RPL18aB                                             153   1e-44   Sonneratia alba
gb|ELK19170.1|  60S ribosomal protein L18a                              146   2e-44   Pteropus alecto
ref|XP_637982.2|  S60 ribosomal protein L18a                            144   3e-44   Dictyostelium discoideum AX4
emb|CCI45297.1|  unnamed protein product                                144   3e-44   Albugo candida
ref|XP_004354799.1|  hypothetical protein DFA_09450                     139   4e-44   Cavenderia fasciculata
gb|KFH68950.1|  60S ribosomal protein L20                               139   5e-44   Mortierella verticillata NRRL 6337
emb|CCA22335.1|  60S ribosomal protein L18a putative                    143   8e-44   Albugo laibachii Nc14
gb|ELK32292.1|  60S ribosomal protein L18a                              146   1e-43   Myotis davidii
emb|CBN79653.1|  ribosomal protein L18                                  158   1e-43   Ectocarpus siliculosus
gb|KFH68928.1|  large subunit ribosomal protein L18Ae                   139   1e-43   Mortierella verticillata NRRL 6337
gb|EPZ32213.1|  60S ribosomal protein L20-B                             144   2e-43   Rozella allomycis CSF55
dbj|GAM28311.1|  hypothetical protein SAMD00019534_114870               142   2e-43   Acytostelium subglobosum LB1
ref|XP_001362363.1|  PREDICTED: 60S ribosomal protein L18a              149   2e-43   Monodelphis domestica
gb|KFM72761.1|  60S ribosomal protein L18a                              149   3e-43   Stegodyphus mimosarum
ref|XP_004616713.1|  PREDICTED: 60S ribosomal protein L18a              149   3e-43   Sorex araneus [Eurasian shrew]
ref|XP_009521845.1|  hypothetical protein PHYSODRAFT_354168             147   3e-43   Phytophthora sojae
gb|EHH59357.1|  hypothetical protein EGM_09444                          145   4e-43   Macaca fascicularis [crab eating macaque]
ref|XP_004761042.1|  PREDICTED: 60S ribosomal protein L18a isofor...    146   5e-43   
ref|XP_005604175.1|  PREDICTED: 60S ribosomal protein L18a              146   5e-43   
ref|XP_006633700.1|  PREDICTED: 60S ribosomal protein L18a-like         148   6e-43   Lepisosteus oculatus
ref|XP_005242188.1|  PREDICTED: uncharacterized protein LOC101921474    147   6e-43   
gb|ACO51977.1|  60S ribosomal protein L18a                              152   6e-43   Rana catesbeiana [bullfrog]
ref|XP_416064.3|  PREDICTED: 60S ribosomal protein L18a                 145   7e-43   
ref|XP_005654963.1|  PREDICTED: 60S ribosomal protein L18a isofor...    146   8e-43   
ref|NP_001090206.1|  ribosomal protein L18a                             148   9e-43   Xenopus laevis [clawed frog]
ref|XP_320252.4|  AGAP012284-PA                                         148   9e-43   Anopheles gambiae str. PEST
gb|AAH42256.1|  RPL18A protein                                          148   1e-42   Xenopus laevis [clawed frog]
ref|XP_005682245.1|  PREDICTED: 60S ribosomal protein L18a              146   1e-42   
ref|NP_001016690.1|  ribosomal protein L18a                             147   1e-42   Xenopus tropicalis [western clawed frog]
ref|XP_002108947.1|  expressed hypothetical protein                     146   1e-42   Trichoplax adhaerens
ref|XP_006898371.1|  PREDICTED: 60S ribosomal protein L18a-like         145   1e-42   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|AGE89254.1|  60S ribosomal protein L18a                              142   1e-42   Cryptocaryon irritans
ref|XP_008897642.1|  hypothetical protein PPTG_05682                    145   1e-42   Phytophthora parasitica INRA-310
gb|KFB49813.1|  AGAP012284-PA-like protein                              148   2e-42   Anopheles sinensis
ref|XP_007433473.1|  PREDICTED: 60S ribosomal protein L18a-like         147   2e-42   Python bivittatus
ref|XP_003292885.1|  ribosomal protein L18a                             139   2e-42   Dictyostelium purpureum
ref|XP_003413070.1|  PREDICTED: 60S ribosomal protein L18a              146   2e-42   Loxodonta africana [African bush elephant]
ref|XP_005370652.1|  PREDICTED: 60S ribosomal protein L18a              145   2e-42   Microtus ochrogaster [prairie voles]
ref|XP_004009216.1|  PREDICTED: 60S ribosomal protein L18a              146   2e-42   
ref|XP_006035334.1|  PREDICTED: 60S ribosomal protein L18a-like         146   2e-42   Alligator sinensis
ref|XP_006876351.1|  PREDICTED: 60S ribosomal protein L18a              146   2e-42   
gb|AFW79178.1|  hypothetical protein ZEAMMB73_449231                    150   2e-42   
ref|XP_005988719.1|  PREDICTED: 60S ribosomal protein L18a-like i...    146   2e-42   
ref|XP_002808227.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    146   2e-42   
gb|EDL28885.1|  mCG14783, isoform CRA_a                                 146   2e-42   
ref|XP_001652207.1|  AAEL006785-PB                                      145   2e-42   
ref|XP_003465225.2|  PREDICTED: 60S ribosomal protein L18a              146   2e-42   
ref|XP_002897608.1|  60S ribosomal protein L18a                         144   2e-42   
dbj|BAG34717.1|  unnamed protein product                                145   3e-42   
dbj|BAD96367.1|  ribosomal protein L18a variant                         146   3e-42   
ref|XP_533877.1|  PREDICTED: 60S ribosomal protein L18a isoform 1       146   3e-42   
ref|XP_005303239.1|  PREDICTED: 60S ribosomal protein L18a              146   3e-42   
ref|XP_005444139.1|  PREDICTED: 60S ribosomal protein L18a-like         145   3e-42   
ref|NP_000971.1|  60S ribosomal protein L18a                            146   3e-42   
ref|XP_005588457.1|  PREDICTED: 60S ribosomal protein L18a isofor...    146   3e-42   
ref|XP_003123559.3|  PREDICTED: 60S ribosomal protein L18a isoformX1    146   3e-42   
gb|ACO51820.1|  60S ribosomal protein L18a                              147   3e-42   
ref|XP_006890332.1|  PREDICTED: 60S ribosomal protein L18a-like         145   3e-42   
ref|XP_005499868.1|  PREDICTED: 60S ribosomal protein L18a-like         145   3e-42   
gb|EDL28886.1|  mCG14783, isoform CRA_b                                 145   3e-42   
ref|NP_001291810.1|  ribosomal protein L18a                             145   3e-42   
gb|KFV71518.1|  60S ribosomal protein L18a                              145   4e-42   
ref|XP_008822798.1|  PREDICTED: 60S ribosomal protein L18a isofor...    145   4e-42   
ref|NP_997675.1|  60S ribosomal protein L18a                            145   4e-42   
gb|ELR54862.1|  60S ribosomal protein L18a                              145   4e-42   
ref|XP_006894400.1|  PREDICTED: 60S ribosomal protein L18a-like         145   4e-42   
ref|XP_006887480.1|  PREDICTED: 60S ribosomal protein L18a-like         145   4e-42   
gb|AAV90708.1|  60S ribosomal protein L18a                              144   5e-42   
gb|EMC81423.1|  60S ribosomal protein L18a                              145   5e-42   
sp|Q8WQI7.1|RL18A_SPOFR  RecName: Full=60S ribosomal protein L18a       145   5e-42   
ref|XP_004423023.1|  PREDICTED: 60S ribosomal protein L18a              145   5e-42   
gb|EFB19107.1|  hypothetical protein PANDA_000535                       145   5e-42   
ref|XP_007116964.1|  PREDICTED: 60S ribosomal protein L18a              145   6e-42   
ref|NP_001037219.1|  ribosomal protein L18A                             146   6e-42   
ref|NP_957354.1|  60S ribosomal protein L18a                            144   6e-42   
ref|XP_005972333.1|  PREDICTED: 60S ribosomal protein L18a              144   6e-42   
gb|KFP08674.1|  60S ribosomal protein L18a                              145   6e-42   
gb|KFV06361.1|  60S ribosomal protein L18a                              145   6e-42   
ref|XP_002783609.1|  60S ribosomal protein L18A-2, putative             138   7e-42   
ref|XP_002187596.1|  PREDICTED: 60S ribosomal protein L18a-like i...    145   7e-42   
gb|EHH29801.1|  hypothetical protein EGK_10314                          145   7e-42   
ref|XP_005148123.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    144   7e-42   
ref|XP_004277609.1|  PREDICTED: 60S ribosomal protein L18a              144   8e-42   
gb|KFP71409.1|  60S ribosomal protein L18a                              144   8e-42   
ref|XP_005480619.1|  PREDICTED: 60S ribosomal protein L18a-like         144   8e-42   
gb|KFV79623.1|  60S ribosomal protein L18a                              144   9e-42   
ref|XP_008950341.1|  PREDICTED: 60S ribosomal protein L18a-like         145   9e-42   
ref|XP_006886772.1|  PREDICTED: 60S ribosomal protein L18a-like         144   9e-42   
gb|KFO58423.1|  60S ribosomal protein L18a                              144   9e-42   
ref|XP_006886145.1|  PREDICTED: 60S ribosomal protein L18a-like         145   1e-41   
gb|KFM08760.1|  60S ribosomal protein L18a                              144   1e-41   
gb|AGH70166.1|  60S ribosomal protein L18a                              144   1e-41   
ref|XP_006889246.1|  PREDICTED: 60S ribosomal protein L18a-like         144   1e-41   
ref|XP_004873387.1|  PREDICTED: 60S ribosomal protein L18a              144   1e-41   
gb|AAI61335.1|  LOC549444 protein                                       147   1e-41   
ref|NP_523774.1|  ribosomal protein L18A                                147   1e-41   
ref|XP_007636083.1|  PREDICTED: 60S ribosomal protein L18a isofor...    144   1e-41   
gb|AAR09828.1|  similar to Drosophila melanogaster RpL18A               147   1e-41   
ref|XP_003898411.1|  PREDICTED: 60S ribosomal protein L18a-like         143   1e-41   
ref|XP_007611098.1|  PREDICTED: 60S ribosomal protein L18a isofor...    143   2e-41   
gb|AEL28892.1|  ribosomal protein L18A                                  145   2e-41   
gb|EDL39919.1|  mCG14017                                                143   2e-41   
ref|XP_001960744.1|  GF13512                                            146   2e-41   
gb|KFR06619.1|  60S ribosomal protein L18a                              143   2e-41   
ref|XP_008109288.1|  PREDICTED: 60S ribosomal protein L18a              143   2e-41   
gb|ERE89015.1|  60S ribosomal protein L18a-like protein                 143   2e-41   
ref|XP_008508109.1|  PREDICTED: 60S ribosomal protein L18a isofor...    143   2e-41   
ref|XP_002063423.1|  GK21403                                            146   2e-41   
gb|ADT80712.1|  ribosomal protein L18A                                  144   2e-41   
ref|XP_004384453.1|  PREDICTED: 60S ribosomal protein L18a              143   2e-41   
dbj|BAE40206.1|  unnamed protein product                                145   2e-41   
gb|EAW97746.1|  hCG2015272                                              143   2e-41   
gb|ADX97197.1|  60S ribosomal protein l18a                              142   3e-41   
ref|XP_010604767.1|  PREDICTED: 60S ribosomal protein L18a isofor...    149   3e-41   
ref|XP_002006863.1|  GI21298                                            145   3e-41   
ref|XP_006882833.1|  PREDICTED: 60S ribosomal protein L18a-like         144   4e-41   
gb|AFK10877.1|  60S ribosomal protein L18a-like protein                 140   4e-41   
ref|XP_010086852.1|  60S ribosomal protein L18a                         152   4e-41   
ref|XP_006680278.1|  hypothetical protein BATDEDRAFT_17251              134   4e-41   
ref|XP_011203338.1|  PREDICTED: 60S ribosomal protein L18a              146   5e-41   
gb|AFM89633.1|  60S ribosomal protein L18a-like protein                 140   5e-41   
gb|EFA83144.1|  S60 ribosomal protein L18a                              131   5e-41   
ref|XP_005174872.1|  PREDICTED: 60S ribosomal protein L18a              145   6e-41   
ref|XP_004417384.1|  PREDICTED: 60S ribosomal protein L18a-like         141   6e-41   
ref|XP_011177993.1|  PREDICTED: 60S ribosomal protein L18a              146   6e-41   
emb|CDR97128.1|  60S ribosomal protein L18ae, putative                  140   6e-41   
ref|XP_005830017.1|  large subunit ribosomal protein L18Ae, cytop...    149   7e-41   
ref|XP_003976423.1|  PREDICTED: 60S ribosomal protein L18a-like         141   7e-41   
emb|CAF89492.1|  unnamed protein product                                141   8e-41   
ref|NP_001279187.1|  ribosomal protein L18a                             140   8e-41   
emb|CBK25105.2|  unnamed protein product                                135   8e-41   
ref|XP_004520736.1|  PREDICTED: 60S ribosomal protein L18a-like         145   9e-41   
ref|XP_011111918.1|  hypothetical protein H072_6117                     127   9e-41   
ref|XP_004087014.1|  PREDICTED: 60S ribosomal protein L18a              140   9e-41   
dbj|BAC56406.1|  similar to ribosomal protein L18a                      140   1e-40   
ref|XP_005715079.1|  unnamed protein product                            141   1e-40   
gb|AFM90776.1|  60S ribosomal protein L18a-like protein                 139   1e-40   
ref|XP_001360626.1|  GA19650                                            144   1e-40   
ref|XP_004277364.1|  PREDICTED: 60S ribosomal protein L18a-like         142   1e-40   
ref|XP_010706034.1|  PREDICTED: 60S ribosomal protein L18a              147   1e-40   
ref|XP_008313517.1|  PREDICTED: 60S ribosomal protein L18a              140   1e-40   
gb|AFM87268.1|  60S ribosomal protein L18a-like protein                 139   2e-40   
ref|XP_010896328.1|  PREDICTED: 60S ribosomal protein L18a              139   2e-40   
dbj|BAF98666.1|  ribosomal protein L18a                                 140   2e-40   
gb|ABR27953.1|  60S ribosomal protein L18a                              142   2e-40   
ref|NP_001187046.1|  60S ribosomal protein L18a                         139   2e-40   
gb|AAI67657.1|  Unknown (protein for IMAGE:7718161)                     147   2e-40   
gb|AFM87509.1|  60S ribosomal protein L18a-like protein                 139   2e-40   
emb|CAQ37750.1|  60S ribosomal protein L18a                             135   2e-40   
ref|XP_003448789.1|  PREDICTED: 60S ribosomal protein L18a-like         139   2e-40   
ref|XP_007540776.1|  PREDICTED: 60S ribosomal protein L18a              139   2e-40   
dbj|BAN20250.1|  hypothetical protein                                   145   2e-40   
ref|XP_005809747.1|  PREDICTED: 60S ribosomal protein L18a-like         139   2e-40   
gb|AAP20183.1|  ribosomal protein L18a                                  140   2e-40   
gb|ACY95363.1|  ribosomal protein L18A                                  143   2e-40   
gb|AFM87533.1|  60S ribosomal protein L18a-like protein                 141   3e-40   
ref|XP_003923253.1|  PREDICTED: 60S ribosomal protein L18a              139   3e-40   
ref|XP_007235111.1|  PREDICTED: 60S ribosomal protein L18a-like         138   3e-40   
dbj|BAH28893.1|  ribosomal protein L18a                                 141   3e-40   
ref|XP_005988720.1|  PREDICTED: 60S ribosomal protein L18a-like i...    146   3e-40   
ref|XP_005409607.1|  PREDICTED: 60S ribosomal protein L18a              147   4e-40   
gb|AFM87186.1|  60S ribosomal protein L18a-like protein                 137   4e-40   
ref|XP_002779521.1|  60S ribosomal protein L18A-2, putative             137   4e-40   
ref|NP_001284617.1|  60S ribosomal protein L18a                         142   4e-40   
gb|AFM87145.1|  ribosomal protein L18a                                  137   4e-40   
gb|AFK43985.1|  unknown                                                 136   4e-40   
dbj|BAM17719.1|  ribosomal protein L18A                                 144   4e-40   
ref|XP_005363729.1|  PREDICTED: 60S ribosomal protein L18a-like         139   4e-40   
ref|XP_006267603.1|  PREDICTED: 60S ribosomal protein L18a-like         145   4e-40   
ref|XP_001652208.1|  AAEL006785-PA                                      145   5e-40   
gb|AAX62413.1|  ribosomal protein L18a                                  143   5e-40   
ref|XP_001750897.1|  hypothetical protein                               130   5e-40   
dbj|BAJ93879.1|  predicted protein                                      137   5e-40   
gb|EHJ65723.1|  ribosomal protein L18A                                  137   6e-40   
emb|CDQ92557.1|  unnamed protein product                                138   6e-40   
ref|XP_008822800.1|  PREDICTED: 60S ribosomal protein L18a isofor...    145   7e-40   
ref|XP_001614192.1|  60S ribosomal protein L18a                         127   7e-40   
ref|XP_008502645.1|  PREDICTED: 60S ribosomal protein L18a              145   7e-40   
ref|XP_001611594.1|  60S ribosomal  protein L18ae                       134   7e-40   
ref|XP_001087364.1|  PREDICTED: 60S ribosomal protein L18a-like i...    139   7e-40   
dbj|BAN65814.1|  60S ribosomal protein L18ae, putative                  134   8e-40   
ref|XP_011349291.1|  PREDICTED: 60S ribosomal protein L18a-like         142   8e-40   
gb|KDO27995.1|  hypothetical protein SPRG_22195                         125   8e-40   
ref|XP_010071114.1|  PREDICTED: 60S ribosomal protein L18a              145   8e-40   
ref|XP_001985733.1|  GH20961                                            140   8e-40   
gb|EJY71843.1|  60S ribosomal protein L18a-1                            136   9e-40   
dbj|BAD26689.1|  Ribosomal protein L18A                                 143   9e-40   
ref|XP_003707868.1|  PREDICTED: 60S ribosomal protein L18a-like         144   9e-40   
ref|XP_011300735.1|  PREDICTED: 60S ribosomal protein L18a              142   1e-39   
ref|XP_008815720.1|  50S ribosomal protein L18Ae                        125   1e-39   
gb|ACN10349.1|  60S ribosomal protein L18a                              137   1e-39   
ref|XP_628224.1|  60S ribosomal protein L18A                            135   1e-39   
ref|XP_004395636.1|  PREDICTED: 60S ribosomal protein L18a-like         137   1e-39   
gb|EZA47602.1|  60S ribosomal protein L18a                              142   1e-39   
gb|KIK92807.1|  hypothetical protein PAXRUDRAFT_13013                   126   1e-39   
gb|ABY28362.1|  ribosomal protein L18a                                  137   1e-39   
ref|XP_008213453.1|  PREDICTED: 60S ribosomal protein L18a-like i...    143   1e-39   
ref|XP_003383990.1|  PREDICTED: 60S ribosomal protein L18a-like         135   1e-39   
gb|EAW72846.1|  hCG2040224                                              137   1e-39   
ref|XP_006899250.1|  PREDICTED: 60S ribosomal protein L18a-like         140   1e-39   
gb|ACI69714.1|  60S ribosomal protein L18a                              137   1e-39   
ref|XP_001607320.1|  PREDICTED: 60S ribosomal protein L18a-like         144   1e-39   
gb|EGI58526.1|  60S ribosomal protein L18a                              143   1e-39   
ref|XP_011065620.1|  PREDICTED: 60S ribosomal protein L18a              143   1e-39   
ref|XP_008942357.1|  PREDICTED: 60S ribosomal protein L18a              144   2e-39   
gb|ACH70788.1|  ribosomal protein L18a                                  136   2e-39   
ref|XP_005419299.1|  PREDICTED: 60S ribosomal protein L18a-like         144   2e-39   
ref|XP_004643232.1|  PREDICTED: 60S ribosomal protein L18a-like         144   2e-39   
gb|ABD98777.1|  putative ribosomal protein L18A                         141   2e-39   
ref|XP_002599714.1|  hypothetical protein BRAFLDRAFT_116402             141   2e-39   
ref|XP_003393070.1|  PREDICTED: 60S ribosomal protein L18a-like         143   2e-39   
ref|XP_001505898.2|  PREDICTED: 60S ribosomal protein L18a              145   2e-39   
ref|XP_393322.1|  PREDICTED: 60S ribosomal protein L18a                 142   2e-39   
ref|XP_004365311.1|  ribosomal protein L18ae                            135   2e-39   
emb|CEG71682.1|  Putative 60S ribosomal protein L20                     124   2e-39   
ref|XP_011265568.1|  PREDICTED: 60S ribosomal protein L18a-like         142   2e-39   
ref|XP_011336934.1|  PREDICTED: 60S ribosomal protein L18a-like         140   2e-39   
ref|XP_011156394.1|  PREDICTED: 60S ribosomal protein L18a              142   2e-39   
gb|KDR15731.1|  60S ribosomal protein L18a                              142   2e-39   
gb|EFZ20272.1|  hypothetical protein SINV_15860                         142   2e-39   
gb|EIF45355.1|  60s ribosomal protein l20                               128   3e-39   
ref|XP_011253777.1|  PREDICTED: 60S ribosomal protein L18a-like         142   3e-39   
gb|KIY70561.1|  60S ribosomal protein L18A                              126   3e-39   
ref|XP_007874905.1|  hypothetical protein PNEG_02868                    129   3e-39   
ref|XP_011142006.1|  PREDICTED: 60S ribosomal protein L18a-like         142   3e-39   
ref|XP_004200777.1|  Piso0_003381                                       130   3e-39   
ref|XP_003697931.1|  PREDICTED: 60S ribosomal protein L18a-like         142   3e-39   
gb|AAN52374.1|  ribosomal protein L18a                                  139   3e-39   
ref|XP_009929895.1|  PREDICTED: 60S ribosomal protein L18a              143   4e-39   
gb|KIH90052.1|  60S ribosomal protein l20                               125   4e-39   
ref|XP_011127067.1|  hypothetical protein AOL_s00193g154                119   4e-39   
ref|XP_001245490.1|  60S ribosomal protein L20                          132   4e-39   
gb|KIJ91891.1|  hypothetical protein K443DRAFT_114419                   125   4e-39   
ref|XP_004991000.1|  ribosomal protein L18a                             135   4e-39   
ref|XP_008213454.1|  PREDICTED: 60S ribosomal protein L18a-like i...    143   4e-39   
ref|XP_011494259.1|  PREDICTED: 60S ribosomal protein L18a              142   4e-39   
ref|XP_972907.1|  PREDICTED: 60S ribosomal protein L18a                 138   4e-39   
emb|CDH57447.1|  60s ribosomal protein l20                              121   5e-39   
gb|KIL64760.1|  hypothetical protein M378DRAFT_77817                    122   6e-39   
ref|XP_009038926.1|  hypothetical protein AURANDRAFT_60205              134   6e-39   
ref|XP_007415007.1|  hypothetical protein MELLADRAFT_72927              123   6e-39   
emb|CDO75758.1|  hypothetical protein BN946_scf184921.g34               122   6e-39   
emb|CDS14547.1|  Putative 60S ribosomal protein L20                     120   6e-39   
gb|KJA26912.1|  hypothetical protein HYPSUDRAFT_132230                  124   6e-39   
ref|XP_007313367.1|  hypothetical protein SERLADRAFT_456475             122   6e-39   
ref|XP_006730525.1|  PREDICTED: 60S ribosomal protein L18a-like         139   6e-39   
emb|CDS03349.1|  Putative 60S ribosomal protein L20                     120   7e-39   
ref|XP_001896063.1|  60S ribosomal protein L18a                         137   7e-39   
gb|ERS97659.1|  60S ribosomal protein L20                               124   7e-39   
ref|XP_001882521.1|  60S ribosomal protein L20                          124   7e-39   
emb|CDP99545.1|  Protein Bm13771, isoform b                             137   8e-39   
gb|EUC60950.1|  60S ribosomal protein L20                               123   8e-39   
gb|EWM27710.1|  60s ribosomal protein l18a                              123   8e-39   
ref|XP_003145959.1|  60S ribosomal protein L18a                         135   8e-39   
gb|KDR72699.1|  hypothetical protein GALMADRAFT_142989                  124   8e-39   
emb|CDI83837.1|  60S ribosomal protein L18a, putative                   138   8e-39   
ref|XP_008552298.1|  PREDICTED: 60S ribosomal protein L18a              139   8e-39   
ref|XP_008508108.1|  PREDICTED: 60S ribosomal protein L18a isofor...    134   8e-39   
gb|EJW80288.1|  ribosomal protein L18ae                                 136   9e-39   
gb|EAR97130.3|  60S ribosomal protein L18a                              144   9e-39   
gb|KIK23334.1|  hypothetical protein PISMIDRAFT_679451                  122   9e-39   



>gb|ADE42972.1| putative 60S ribosomal protein L18a [Gardenia jasminoides]
Length=178

 Score =   263 bits (671),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR+HCIQIIKTAT+PAKLCKRESTKQFHNSKI+FPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRYHCIQIIKTATVPAKLCKRESTKQFHNSKIRFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score =   102 bits (255),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVNYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_004241806.1| PREDICTED: 60S ribosomal protein L18a [Solanum lycopersicum]
Length=178

 Score =   264 bits (674),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score =   101 bits (252),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>emb|CDP06299.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   261 bits (668),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR+HCIQIIKTAT+PAKLCKRESTKQFHNSKI+FPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRYHCIQIIKTATVPAKLCKRESTKQFHNSKIRFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score =   102 bits (255),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVNYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|NP_001275107.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|AFX66998.1| 60S ribosomal protein L18a [Solanum tuberosum]
Length=178

 Score =   263 bits (671),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score =   101 bits (252),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_009799848.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana sylvestris]
Length=178

 Score =   264 bits (674),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            +LRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   YLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPN+F+
Sbjct  166  KTTYKATRPNLFM  178


 Score =   100 bits (248),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV Y+FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWY+  + ++
Sbjct  1    MVNYKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKK  52



>ref|XP_006363066.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum tuberosum]
Length=178

 Score =   263 bits (673),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKK+RPPSRKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKIRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score =   100 bits (248),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV Y+FHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVNYKFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010324737.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum lycopersicum]
Length=178

 Score =   262 bits (669),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score =   101 bits (251),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTY+FHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTYKFHQYQVVGRALPSENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_008229704.1| PREDICTED: uncharacterized protein LOC103329046 [Prunus mume]
Length=776

 Score =   259 bits (663),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  644  FLRKLKKVKKSNGQVLAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  703

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  704  EDMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  763

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPNIFV
Sbjct  764  KTTYKATRPNIFV  776


 Score =   103 bits (256),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  67   SVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            S  ++MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  594  SPTSQMVTFRFHQYQVVGRALPSEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  650



>ref|XP_009609142.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009627827.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009592293.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009757479.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
 ref|XP_009757480.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   263 bits (673),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            +LRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   YLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPN+F+
Sbjct  166  KTTYKATRPNLFM  178


 Score = 99.0 bits (245),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWY+  + ++
Sbjct  1    MVTYKFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKK  52



>ref|NP_001275252.1| uncharacterized protein LOC102577837 [Solanum tuberosum]
 ref|XP_004233112.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 ref|XP_010316931.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 gb|ABA46783.1| unknown [Solanum tuberosum]
Length=178

 Score =   260 bits (664),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score =   102 bits (254),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTY+FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|NP_001275234.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|ABB29928.1| unknown [Solanum tuberosum]
Length=178

 Score =   261 bits (667),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score =   101 bits (251),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTY+FHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTYKFHQYQVVGRALPSENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_011071121.1| PREDICTED: 60S ribosomal protein L18a [Sesamum indicum]
Length=178

 Score =   262 bits (670),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 99.8 bits (247),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTY+FHQYQVVGR LP+ETDEHP+IYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTYKFHQYQVVGRGLPTETDEHPRIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006595492.1| PREDICTED: uncharacterized protein LOC100305604 isoform X1 [Glycine 
max]
Length=753

 Score =   262 bits (669),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  621  FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  680

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVRH CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKK+RPP+RKL
Sbjct  681  EHMYTEMASRHRVRHPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKIRPPTRKL  740

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  741  KTTYKASRPNLFM  753


 Score = 99.8 bits (247),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  76   AKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            A+MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  574  AEMVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  627



>ref|XP_009598886.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana tomentosiformis]
Length=178

 Score =   261 bits (668),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            +LRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   YLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIK ATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKIATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPN+F+
Sbjct  166  KTTYKATRPNLFM  178


 Score =   100 bits (248),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV Y+FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWY+  + ++
Sbjct  1    MVNYKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKK  52



>ref|XP_006387417.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011009656.1| PREDICTED: 60S ribosomal protein L18a [Populus euphratica]
 gb|ABK93213.1| unknown [Populus trichocarpa]
 gb|ABK94632.1| unknown [Populus trichocarpa]
 gb|ERP46331.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   260 bits (665),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 126/133 (95%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score =   100 bits (250),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|ABB29925.1| unknown [Solanum tuberosum]
Length=178

 Score =   260 bits (664),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTY A++PN+F+
Sbjct  166  KTTYWATKPNLFM  178


 Score =   101 bits (251),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_009782492.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   262 bits (669),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            +LRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   YLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPN+F+
Sbjct  166  KTTYKATRPNLFM  178


 Score = 99.0 bits (245),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWY+  + ++
Sbjct  1    MVTYKFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKK  52



>ref|XP_011096544.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=178

 Score =   258 bits (660),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+V
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR+HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPN+F+
Sbjct  166  KTTYKATRPNLFM  178


 Score =   102 bits (254),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTY+FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006574359.1| PREDICTED: uncharacterized protein LOC100527007 isoform X1 [Glycine 
max]
Length=784

 Score =   260 bits (665),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  652  FLRKLKKVKKSNGQVLAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  711

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVRH CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  712  EHMYTEMASRHRVRHPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  771

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  772  KTTYKASRPNLFM  784


 Score = 99.8 bits (247),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  76   AKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             KMV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  605  VKMVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  658



>ref|XP_002528496.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF33913.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=178

 Score =   261 bits (668),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVK+SNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKRSNGQVLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFSCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 98.6 bits (244),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLW+TNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTENDDHPKIYRMKLWSTNEVRAKSKFWYFLRKLKK  52



>ref|XP_006477944.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Citrus 
sinensis]
 gb|KDO49363.1| hypothetical protein CISIN_1g028910mg [Citrus sinensis]
Length=202

 Score =   257 bits (657),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  70   FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  129

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQII+TATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  130  EQMYTEMASRHRVRSPCIQIIRTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  189

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  190  KTTYKASRPNLFM  202


 Score =   102 bits (254),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  58   EDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            E   +  KMVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  17   EPALLGGKMVTFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  76



>ref|XP_009406265.1| PREDICTED: 60S ribosomal protein L18a [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   260 bits (665),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR+HCIQIIKTATIP+KLCKRESTKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYNEMASRHRVRYHCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 99.4 bits (246),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVVFRFHQYQVVGRALPSATDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_008465452.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=751

 Score =   256 bits (654),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  619  FLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  678

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLV+KKVRPP+RKL
Sbjct  679  EQMYTEMASRHRVRCPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYKKVRPPTRKL  738

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  739  KTTYKASKPNLFM  751


 Score =   103 bits (256),  Expect(2) = 4e-90, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            KMVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  573  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  625



>ref|XP_007215058.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
 gb|EMJ16257.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
Length=178

 Score =   258 bits (658),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EDMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPNIFV
Sbjct  166  KTTYKATRPNIFV  178


 Score =   101 bits (251),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPSEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|ABK92715.1| unknown [Populus trichocarpa]
Length=178

 Score =   260 bits (665),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 126/133 (95%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 98.6 bits (244),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_004166596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=752

 Score =   256 bits (653),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  620  FLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  679

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL
Sbjct  680  EQMYTEMASRHRVRCPCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKL  739

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  740  KTTYKASKPNLFM  752


 Score =   103 bits (256),  Expect(2) = 6e-90, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            KMVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  574  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  626



>ref|XP_002317384.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 gb|ABK93710.1| unknown [Populus trichocarpa]
 gb|EEE97996.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   259 bits (661),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score =   100 bits (248),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTQSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_011009655.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
 ref|XP_011009657.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
Length=178

 Score =   260 bits (665),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 126/133 (95%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 97.8 bits (242),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M T+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_004134633.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 ref|XP_004162601.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 gb|KGN49388.1| hypothetical protein Csa_6G522810 [Cucumis sativus]
Length=178

 Score =   257 bits (656),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVRH CIQIIKTAT+PAKLCKRESTKQFH+SKIKFPLVFK VRPP+RKL
Sbjct  106  EAMYTEMASRHRVRHPCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKTVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score =   101 bits (251),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPSEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_009389413.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   262 bits (669),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  56   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  115

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVRHHCIQIIKTATIP+KLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL
Sbjct  116  EQMYNEMASRHRVRHHCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKL  175

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  176  KTTYKASRPNLFM  188


 Score = 95.9 bits (237),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  11   MVAFRFHQYQVVGRALPTAADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  62



>ref|XP_004147412.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 ref|XP_004164939.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
Length=178

 Score =   257 bits (657),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTKVKNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRSPCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score =   100 bits (249),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV++RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVSFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010924380.1| PREDICTED: 60S ribosomal protein L18a [Elaeis guineensis]
Length=178

 Score =   259 bits (661),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR+HCIQIIKTATIPAKLCKRE+TKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EHMYNEMASRHRVRYHCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 98.6 bits (244),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPSPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KHG02356.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB34966.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
Length=178

 Score =   257 bits (656),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score =   100 bits (250),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006449674.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 ref|XP_006467485.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X1 [Citrus 
sinensis]
 gb|ESR62914.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 gb|KDO78150.1| hypothetical protein CISIN_1g035537mg [Citrus sinensis]
Length=178

 Score =   256 bits (655),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            +TTYKA+RPN+F+
Sbjct  166  RTTYKATRPNLFM  178


 Score =   100 bits (250),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KHN38335.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   260 bits (664),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVRH CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EHMYTEMASRHRVRHPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 97.4 bits (241),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_008798296.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   260 bits (664),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR HCIQIIKTATIPAKLCKRE+TKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYNEMASRHRVRSHCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 97.4 bits (241),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALPS T+EHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPSPTNEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_011074018.1| PREDICTED: 60S ribosomal protein L18a-2-like [Sesamum indicum]
Length=178

 Score =   263 bits (671),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 94.7 bits (234),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  YRF QYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MAIYRFRQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_008811096.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   258 bits (659),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFK VRPPSRKL
Sbjct  106  EQMYNEMASRHRVRCHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKMVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 99.0 bits (245),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVVFRFHQYQVVGRALPSPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006484924.1| PREDICTED: uncharacterized protein LOC102625748 [Citrus sinensis]
Length=820

 Score =   255 bits (652),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            +LRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  688  YLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  747

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  748  EQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  807

Query  578  KTTYKASRPNIFV  616
            +TTYKASRPN+F+
Sbjct  808  RTTYKASRPNLFM  820


 Score =   101 bits (252),  Expect(2) = 2e-89, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+  + ++
Sbjct  643  MVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKK  694



>ref|XP_011002051.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
Length=178

 Score =   257 bits (656),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTY ASRPN+F+
Sbjct  166  KTTYNASRPNLFM  178


 Score =   100 bits (248),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTQSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KCW89756.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=213

 Score =   258 bits (659),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  81   FLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  140

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  141  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  200

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  201  KTTYKASRPNLFM  213


 Score = 99.0 bits (245),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  73   VAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             + MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  33   TSTMVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  87



>ref|XP_008444078.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   256 bits (654),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTKVKNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRSPCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            +TTYKAS+PN+F+
Sbjct  166  RTTYKASKPNLFM  178


 Score =   100 bits (249),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV++RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVSFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006442292.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
 gb|ESR55532.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
Length=224

 Score =   254 bits (648),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAI+EIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RD TLNGAV
Sbjct  92   FLRKLKKVKKSNGQMLAIDEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAV  151

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQII+TATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  152  EQMYTEMASRHRVRSPCIQIIRTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  211

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  212  KTTYKASRPNLFM  224


 Score =   102 bits (255),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  4    PSLAAQrerergrergSQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWAT  183
            PS+ +   + R       E   +  KMVT+RFHQYQVVGRALP+E DEHPKIYRMKLWAT
Sbjct  21   PSMQSAAYKPRFPSFTCSEPALLGGKMVTFRFHQYQVVGRALPTEKDEHPKIYRMKLWAT  80

Query  184  NEVRAKSKFWYFFEEAEE  237
            NEVRAKSKFWYF  + ++
Sbjct  81   NEVRAKSKFWYFLRKLKK  98



>ref|XP_008439644.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   255 bits (652),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVRH CIQIIKTAT+PAKLCKRESTKQFH+SKIKFPLVFK VRPP+RKL
Sbjct  106  EAMYTEMASRHRVRHPCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKTVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score =   101 bits (251),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPSEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KCW75929.1| hypothetical protein EUGRSUZ_D00304 [Eucalyptus grandis]
Length=255

 Score =   258 bits (658),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  123  FLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  182

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  183  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  242

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  243  KTTYKASRPNLFM  255


 Score = 99.0 bits (245),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  70   VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            + ++MVT+RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  74   LASEMVTFRFHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  129



>ref|XP_010918885.1| PREDICTED: 60S ribosomal protein L18a-like [Elaeis guineensis]
Length=178

 Score =   260 bits (664),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDT LNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTALNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR+HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL
Sbjct  106  EHMYNEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 96.3 bits (238),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALPS TDEHP+IYRMKLW TNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPSPTDEHPRIYRMKLWTTNEVRAKSKFWYFLRKLKK  52



>gb|KDO51884.1| hypothetical protein CISIN_1g030276mg [Citrus sinensis]
Length=180

 Score =   254 bits (650),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            +LRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  48   YLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  107

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  108  EQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  167

Query  578  KTTYKASRPNIFV  616
            +TTYKASRPN+F+
Sbjct  168  RTTYKASRPNLFM  180


 Score =   101 bits (252),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            +MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+  + ++
Sbjct  2    RMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKK  54



>ref|XP_009394206.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   257 bits (656),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR HCIQIIKTATIP+KLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRCHCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 99.4 bits (246),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPSSTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_002300869.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011026230.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
 gb|ABK92614.1| unknown [Populus trichocarpa]
 gb|EEE80142.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   257 bits (657),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 98.6 bits (244),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV++RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVR+KSKFWYF  + ++
Sbjct  1    MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKK  52



>ref|XP_010655647.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Vitis vinifera]
 emb|CAN82658.1| hypothetical protein VITISV_011977 [Vitis vinifera]
Length=178

 Score =   252 bits (644),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRES+KQFHNSKIKFPL F+KVRPP+RKL
Sbjct  106  EQMYAEMASRHRVRSPCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLTFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score =   103 bits (257),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_008789456.1| PREDICTED: 60S ribosomal protein L18a-2 [Phoenix dactylifera]
Length=178

 Score =   262 bits (669),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 94.0 bits (232),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010542333.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Tarenaya hassleriana]
Length=178

 Score =   255 bits (652),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score =   100 bits (248),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KHG16522.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   258 bits (658),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 97.8 bits (242),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRAHPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|EYU33348.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=178

 Score =   256 bits (654),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVR+HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF KVRPP+RKL
Sbjct  106  EHMYTEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFHKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score = 99.4 bits (246),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTYR HQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTYRIHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010053843.1| PREDICTED: 60S ribosomal protein L18a [Eucalyptus grandis]
Length=178

 Score =   257 bits (656),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 98.6 bits (244),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|EYU36633.1| hypothetical protein MIMGU_mgv1a014793mg [Erythranthe guttata]
Length=178

 Score =   253 bits (646),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVR HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV +KVRPP+RKL
Sbjct  106  EHMYTEMASRHRVRSHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVTRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score =   102 bits (253),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTYRFHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTYRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_007025105.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOY27727.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   256 bits (655),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 98.6 bits (244),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+R+HQYQVVGRALP+E+DEHPKIYRM+LWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRYHQYQVVGRALPTESDEHPKIYRMRLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010052071.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Eucalyptus 
grandis]
Length=178

 Score =   257 bits (656),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 97.8 bits (242),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006437137.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
 gb|ESR50377.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
Length=180

 Score =   253 bits (646),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            +LRKLKKVKKSNGQVLAINEIFEK P K+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  48   YLRKLKKVKKSNGQVLAINEIFEKNPAKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  107

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  108  EQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  167

Query  578  KTTYKASRPNIFV  616
            +TTYKASRPN+F+
Sbjct  168  RTTYKASRPNLFM  180


 Score =   101 bits (252),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            +MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+  + ++
Sbjct  2    RMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKK  54



>gb|ACS96446.1| 60S ribosomal protein L18a [Jatropha curcas]
 gb|KDP37961.1| hypothetical protein JCGZ_04604 [Jatropha curcas]
Length=178

 Score =   255 bits (652),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKT TIPAKLCKRES+KQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTGTIPAKLCKRESSKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            +TTYKASRPN+F+
Sbjct  166  RTTYKASRPNLFM  178


 Score = 99.0 bits (245),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTY+FHQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTYKFHQYQVVGRGLPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_002276260.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CAN71860.1| hypothetical protein VITISV_019859 [Vitis vinifera]
 emb|CBI30856.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   252 bits (644),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRES+KQFHNSKIKFPL F+KVRPP+RKL
Sbjct  106  EQMYAEMASRHRVRSPCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLTFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score =   102 bits (253),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KHG16962.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB69799.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=178

 Score =   256 bits (655),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 97.8 bits (242),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRAHPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KHG29727.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   253 bits (646),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKR++TKQFHNSKIKFPL+ KKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDNTKQFHNSKIKFPLMVKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score =   100 bits (250),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010538246.1| PREDICTED: 60S ribosomal protein L18a-like [Tarenaya hassleriana]
Length=178

 Score =   254 bits (648),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RD TLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score =   100 bits (248),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_009399317.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   258 bits (660),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYG+WLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGVWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR HCIQIIKTATIP+KLCKRESTKQFH+SKIKFPLVFKKVRPPSRKL
Sbjct  106  EQMYNEMASRHRVRQHCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIF  613
            KTTYKASRPN+F
Sbjct  166  KTTYKASRPNLF  177


 Score = 95.5 bits (236),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGNFRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_008796386.1| PREDICTED: 60S ribosomal protein L18a-like [Phoenix dactylifera]
Length=178

 Score =   260 bits (664),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLV KKVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVLKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 94.0 bits (232),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KJB10614.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=178

 Score =   256 bits (655),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score = 96.7 bits (239),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRGLPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_002268750.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CBI22128.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   253 bits (647),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+V
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR+ CIQIIKTATIPAKLCKRESTKQ HNSKIKFPLV +KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRYPCIQIIKTATIPAKLCKRESTKQMHNSKIKFPLVVRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 99.8 bits (247),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT++FHQYQVVGRALPSE+DEHP+IYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFKFHQYQVVGRALPSESDEHPRIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|ABK94361.1| unknown [Populus trichocarpa]
Length=178

 Score =   254 bits (649),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKR STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRGSTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 98.6 bits (244),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV++RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVR+KSKFWYF  + ++
Sbjct  1    MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKK  52



>gb|KJB42782.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
Length=178

 Score =   257 bits (656),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 95.5 bits (236),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGR LP+E D+HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRGLPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_007048983.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOX93140.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   256 bits (655),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 95.9 bits (237),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV++R+HQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVSFRYHQYQVVGRGLPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|EYU43268.1| hypothetical protein MIMGU_mgv1a013972mg [Erythranthe guttata]
Length=204

 Score =   249 bits (635),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+G+WLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  72   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGVWLRYQSRTGYHNMYKEYRDTTLNGGV  131

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV++KVRP SRKL
Sbjct  132  EQMYTEMASRHRVRPHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVYRKVRPHSRKL  191

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  192  KTTYKATKPNLFM  204


 Score =   103 bits (256),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  52   SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEA  231
            ++E  S  +KMVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + 
Sbjct  17   TEERESEQSKMVTYKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  76

Query  232  EE  237
            ++
Sbjct  77   KK  78



>ref|NP_001237207.1| uncharacterized protein LOC100527007 [Glycine max]
 gb|ACU16044.1| unknown [Glycine max]
Length=178

 Score =   254 bits (650),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KN GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERNPTKIKNCGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVRH CIQIIKTATIPAKLCKRESTKQFHNSKI+FPLVFKKVRPP+RKL
Sbjct  106  EHMYTEMASRHRVRHPCIQIIKTATIPAKLCKRESTKQFHNSKIEFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 97.4 bits (241),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_004491319.1| PREDICTED: LOW QUALITY PROTEIN: probable aspartic protease At2g35615-like 
[Cicer arietinum]
Length=748

 Score =   251 bits (642),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  616  FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  675

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPPSRKL
Sbjct  676  ETMYNEMASRHRVRFPCIQIIKTATIPASLCKRESTKQFHNSKIKFPLVYKKIRPPSRKL  735

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  736  KTTYKANKPNLFM  748


 Score =   100 bits (249),  Expect(2) = 6e-88, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  52   SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEA  231
            SQ +     KMV  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYF  + 
Sbjct  561  SQSESVFFVKMVNMKFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKL  620

Query  232  EE  237
            ++
Sbjct  621  KK  622



>ref|NP_001237679.1| uncharacterized protein LOC100306365 [Glycine max]
 gb|ACU14501.1| unknown [Glycine max]
 gb|KHN35898.1| 60S ribosomal protein L18a-2 [Glycine soja]
Length=178

 Score =   252 bits (643),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EHMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score = 99.8 bits (247),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KJB57268.1| hypothetical protein B456_009G155900 [Gossypium raimondii]
Length=178

 Score =   251 bits (642),  Expect(2) = 9e-88, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIP KLCKR++TKQFHNSKIKFPL+ KKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPTKLCKRDNTKQFHNSKIKFPLMVKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score =   100 bits (248),  Expect(2) = 9e-88, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTDSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KHG26670.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   255 bits (652),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYAEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 95.5 bits (236),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGR LP+E D+HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRGLPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_003617399.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=749

 Score =   248 bits (633),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  617  FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  676

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPP+R L
Sbjct  677  ETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRSL  736

Query  578  KTTYKASRPNIFV  616
            KTTYKA +PN+F+
Sbjct  737  KTTYKAKKPNLFM  749


 Score =   102 bits (254),  Expect(2) = 1e-87, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  52   SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEA  231
            SQ +   VAKMV  +FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + 
Sbjct  562  SQSESVFVAKMVNAKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  621

Query  232  EE  237
            ++
Sbjct  622  KK  623



>gb|KJB69800.1| hypothetical protein B456_011G042900 [Gossypium raimondii]
Length=178

 Score =   253 bits (646),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKS GQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSIGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 97.4 bits (241),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRAHPAESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|NP_001238728.1| uncharacterized protein LOC100306174 [Glycine max]
 gb|ACU14228.1| unknown [Glycine max]
 gb|KHN33136.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   251 bits (641),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV+KKVRPP+RKL
Sbjct  106  EAMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVYKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA +PN+F+
Sbjct  166  KTTYKAKKPNLFM  178


 Score = 99.4 bits (246),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010540563.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   251 bits (642),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRD TLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDITLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+PAKLCKRES+KQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRFPCIQIIKTATVPAKLCKRESSKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 99.0 bits (245),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVV RALP+ETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVERALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010552158.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   250 bits (638),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK++NYGIWLRYQSRTGYHNMYKE+RDTTLNG+V
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKIRNYGIWLRYQSRTGYHNMYKEYRDTTLNGSV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  C+QIIKTAT+PAKLCKRESTKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCVQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KAS+PN+F+
Sbjct  166  KTTFKASKPNLFM  178


 Score =   100 bits (248),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006410594.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
 gb|ESQ52047.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
Length=178

 Score =   251 bits (641),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAALCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 98.6 bits (244),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT++FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_009407842.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   254 bits (649),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+V
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR HCIQIIKTATIP+KLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRCHCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIF  613
            KTTYKASRPN+F
Sbjct  166  KTTYKASRPNLF  177


 Score = 95.5 bits (236),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGNFRFHQYQVVGRALPTATDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010263115.1| PREDICTED: 60S ribosomal protein L18a-2 [Nelumbo nucifera]
Length=178

 Score =   256 bits (653),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR+ CIQIIKTATIPA LCKRESTKQFHN+KIKFPLVFKKVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRYPCIQIIKTATIPASLCKRESTKQFHNAKIKFPLVFKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 94.0 bits (232),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALPSE D HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGIFRFHQYQVVGRALPSEADPHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>sp|Q9ATF5.1|RL18A_CASSA RecName: Full=60S ribosomal protein L18a [Castanea sativa]
 gb|AAK25759.1|AF334839_1 ribosomal protein L18a [Castanea sativa]
Length=178

 Score =   248 bits (632),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRES+KQFHNSKIKFPLV +K+RPPSRKL
Sbjct  106  EQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLVTRKIRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KT YKASRPN+F+
Sbjct  166  KTHYKASRPNLFM  178


 Score =   101 bits (252),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGR LPSETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRGLPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>emb|CDX97587.1| BnaA05g24920D [Brassica napus]
Length=178

 Score =   257 bits (656),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 92.4 bits (228),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_004486036.1| PREDICTED: 60S ribosomal protein L18a-like [Cicer arietinum]
Length=178

 Score =   253 bits (645),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            + MY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKK+RPPSRKL
Sbjct  106  DLMYNEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKIRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA +PN+F+
Sbjct  166  KTTYKAKKPNLFM  178


 Score = 96.7 bits (239),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV++++HQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVSFKYHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>emb|CDX75778.1| BnaC03g38610D [Brassica napus]
Length=258

 Score =   256 bits (654),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  126  FLRKLKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  185

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  186  EQMYTEMASRHRVRFPCIQIIKTATVPAGLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  245

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  246  KTTYKASKPNLFM  258


 Score = 92.8 bits (229),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  81   MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  132



>ref|NP_001236918.1| uncharacterized protein LOC100500108 [Glycine max]
 gb|ACU14971.1| unknown [Glycine max]
 gb|KHN47310.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   250 bits (638),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+V
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EAMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFQKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA +PN+F+
Sbjct  166  KTTYKAKKPNLFM  178


 Score = 99.4 bits (246),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_007212144.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
 ref|XP_008225467.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Prunus mume]
 gb|EMJ13343.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
Length=178

 Score =   256 bits (655),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+FV
Sbjct  166  KTTYKASRPNLFV  178


 Score = 92.4 bits (228),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M T++FHQYQVVGR LP+ +DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGTFKFHQYQVVGRKLPTASDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|AFK40398.1| unknown [Medicago truncatula]
 gb|KEH33553.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   253 bits (647),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVRH CIQIIKTATIPA LCKRESTKQFHNSKIKFPLVFKK+RPP+RKL
Sbjct  106  EYMYNEMASRHRVRHPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVFKKIRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNMFM  178


 Score = 95.5 bits (236),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M T+++HQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MATFKYHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_008380196.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_008342343.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_009377204.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
 ref|XP_009356606.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
Length=178

 Score =   254 bits (648),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKYPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTE+ASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EAMYTELASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 95.1 bits (235),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGVFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|AFK44558.1| unknown [Lotus japonicus]
Length=178

 Score =   250 bits (638),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            + MYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLV++KVRPPSRKL
Sbjct  106  DAMYTEMASRHRVRSPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA +PN+F+
Sbjct  166  KTTYKAKKPNLFM  178


 Score = 99.0 bits (245),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+++D+HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTDSDQHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KHG27228.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   252 bits (644),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLV KKVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVSKKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score = 95.9 bits (237),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGR LP++ DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRGLPTDADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|AFK33651.1| unknown [Lotus japonicus]
Length=178

 Score =   251 bits (642),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLV+KK+RPP+RKL
Sbjct  106  EHMYNEMASRHRVRSPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYKKIRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 96.3 bits (238),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV ++FHQYQVVGRALP+E+D+HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFKFHQYQVVGRALPTESDDHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_007136179.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
 gb|ESW08173.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
Length=178

 Score =   250 bits (638),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK++NYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKIQNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKK+RPPSRKL
Sbjct  106  EHMYNEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKIRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA +PN+F+
Sbjct  166  KTTYKAKKPNLFM  178


 Score = 97.8 bits (242),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV++RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVSFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|AFK46978.1| unknown [Lotus japonicus]
Length=178

 Score =   251 bits (640),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTAT+ AKLCKRESTKQFHNSKIKFPLV+KK+RPP+RKL
Sbjct  106  EHMYNEMASRHRVRSPCIQIIKTATVEAKLCKRESTKQFHNSKIKFPLVYKKIRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 96.3 bits (238),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV ++FHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFKFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_008371596.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Malus domestica]
 ref|XP_008383489.1| PREDICTED: 60S ribosomal protein L18a-2 [Malus domestica]
 ref|XP_009360875.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Pyrus x bretschneideri]
Length=178

 Score =   255 bits (652),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 91.3 bits (225),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  ++FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGVFKFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_007159262.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
 gb|ESW31256.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
Length=178

 Score =   247 bits (631),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKK+RPPSRKL
Sbjct  106  EHMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKIRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA +PN+F+
Sbjct  166  KTTYKAKKPNLFM  178


 Score = 99.4 bits (246),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_007147889.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
 gb|ESW19883.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
Length=178

 Score =   247 bits (630),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKK+RPPSRKL
Sbjct  106  EHMYNEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKIRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA +PN+F+
Sbjct  166  KTTYKAKKPNLFM  178


 Score = 99.4 bits (246),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006467486.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Citrus 
sinensis]
Length=307

 Score =   254 bits (650),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  175  FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  234

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  235  EQMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  294

Query  578  KTTYKASRPNIFV  616
            +TTYKA+RPN+F+
Sbjct  295  RTTYKATRPNLFM  307


 Score = 91.7 bits (226),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            FHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  135  FHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  181



>emb|CDX79564.1| BnaC03g19000D [Brassica napus]
Length=178

 Score =   253 bits (647),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTNIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 92.4 bits (228),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006841639.1| hypothetical protein AMTR_s00003p00234980 [Amborella trichopoda]
 gb|ERN03314.1| hypothetical protein AMTR_s00003p00234980 [Amborella trichopoda]
Length=178

 Score =   251 bits (641),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR+ CIQIIKTATIPAKLCKRE+TKQFH+SKIKFPLVF+K RPP+RKL
Sbjct  106  EQMYNEMASRHRVRYPCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLVFRKFRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 94.7 bits (234),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+ T+EHPK+YRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTPTEEHPKLYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010542335.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X3 [Tarenaya 
hassleriana]
Length=316

 Score =   253 bits (645),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  184  FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  243

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  244  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  303

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  304  KTTYKASKPNLFM  316


 Score = 92.8 bits (229),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  144  FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  190



>ref|XP_006407062.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48515.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=178

 Score =   255 bits (652),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 90.1 bits (222),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRA SKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAMSKFWYFLRKLKK  52



>ref|XP_004488610.1| PREDICTED: 60S ribosomal protein L18a-like isoform X2 [Cicer 
arietinum]
Length=178

 Score =   249 bits (636),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPP+RKL
Sbjct  106  ETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKATKPNLFM  178


 Score = 95.9 bits (237),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVNMKFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_009146339.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   256 bits (653),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNG+V
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGSV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 89.4 bits (220),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV + FHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFGFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_002276545.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Vitis vinifera]
Length=299

 Score =   250 bits (638),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  167  FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  226

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRES+KQFHNSKIKFPL F+KVRPP+RKL
Sbjct  227  EQMYAEMASRHRVRSPCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLTFRKVRPPTRKL  286

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  287  KTTYKASRPNLFM  299


 Score = 94.7 bits (234),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             T  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  123  CTIAFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  173



>ref|XP_009135390.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   256 bits (654),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 88.2 bits (217),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWA+NEVRAKSKFWYF  + ++
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWASNEVRAKSKFWYFLRKLKK  52



>ref|XP_009132991.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   251 bits (641),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKESRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 92.8 bits (229),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_009360876.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Pyrus x bretschneideri]
Length=321

 Score =   254 bits (650),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  189  FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  248

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  249  EQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  308

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  309  KTTYKASRPNLFM  321


 Score = 89.0 bits (219),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             T  FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  145  CTIAFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  195



>ref|XP_010052072.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Eucalyptus 
grandis]
Length=317

 Score =   254 bits (650),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  185  FLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  244

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  245  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  304

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  305  KTTYKASRPNLFM  317


 Score = 88.6 bits (218),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            FHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  145  FHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  191



>gb|KEH33554.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=176

 Score =   253 bits (647),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  44   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  103

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVRH CIQIIKTATIPA LCKRESTKQFHNSKIKFPLVFKK+RPP+RKL
Sbjct  104  EYMYNEMASRHRVRHPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVFKKIRPPTRKL  163

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  164  KTTYKATKPNMFM  176


 Score = 90.1 bits (222),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            +HQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  4    YHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  50



>ref|XP_008225468.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Prunus mume]
Length=320

 Score =   255 bits (651),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  188  FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  247

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  248  EQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  307

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+FV
Sbjct  308  KTTYKASRPNLFV  320


 Score = 88.2 bits (217),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             T  FHQYQVVGR LP+ +DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  144  CTIAFHQYQVVGRKLPTASDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  194



>gb|KFK36339.1| hypothetical protein AALP_AA4G109800 [Arabis alpina]
Length=178

 Score =   251 bits (642),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 91.7 bits (226),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M T+RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGTFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_011085620.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=175

 Score =   258 bits (658),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  43   FLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  102

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVF+KVRPP+RKL
Sbjct  103  EQMYTEMASRHRVRPHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKL  162

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  163  KTTYKASRPNLFM  175


 Score = 85.5 bits (210),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 3/52 (6%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVTYR   YQVVGR+LP+ET+EHPKIYRMKLWA NEVRAKSKFWYF  + ++
Sbjct  1    MVTYR---YQVVGRSLPTETEEHPKIYRMKLWAPNEVRAKSKFWYFLRKLKK  49



>ref|XP_008371597.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Malus domestica]
Length=315

 Score =   254 bits (649),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  183  FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  242

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  243  EQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  302

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  303  KTTYKASRPNLFM  315


 Score = 89.0 bits (219),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             T  FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  139  CTIAFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  189



>ref|XP_002519698.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF42671.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=303

 Score =   256 bits (655),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  171  FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  230

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  231  EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  290

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  291  KTTYKASRPNLFM  303


 Score = 86.3 bits (212),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            FHQYQVVGR LP+E D+HPKIYRMKLWATNE RAKSKFWYF  + ++
Sbjct  131  FHQYQVVGRGLPTEADDHPKIYRMKLWATNEFRAKSKFWYFLRKLKK  177



>ref|XP_006298665.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
 gb|EOA31563.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
Length=178

 Score =   253 bits (645),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+RKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 90.1 bits (222),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW TNEV AKSKFWYF  + ++
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGTNEVCAKSKFWYFMRKLKK  52



>ref|XP_006601742.1| PREDICTED: uncharacterized protein LOC100306365 isoform X1 [Glycine 
max]
Length=184

 Score =   252 bits (643),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  52   FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  111

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  112  EHMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKL  171

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  172  KTTYKATKPNLFM  184


 Score = 90.9 bits (224),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            FHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  12   FHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  58



>ref|XP_006387416.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
 gb|ERP46330.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
Length=150

 Score =   261 bits (668),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/133 (95%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  18   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL
Sbjct  78   EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  138  KTTYKASRPNLFM  150



>ref|XP_003597433.1| 60S ribosomal protein L18a [Medicago truncatula]
 ref|XP_003617397.1| 60S ribosomal protein L18a [Medicago truncatula]
 gb|ACJ84852.1| unknown [Medicago truncatula]
 gb|AES67684.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AET00356.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AFK39885.1| unknown [Medicago truncatula]
 gb|AFK41441.1| unknown [Medicago truncatula]
 gb|AFK43765.1| unknown [Medicago truncatula]
 gb|AFK46613.1| unknown [Medicago truncatula]
 gb|KEH28400.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   247 bits (630),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPP+R L
Sbjct  106  ETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRSL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA +PN+F+
Sbjct  166  KTTYKAKKPNLFM  178


 Score = 95.1 bits (235),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV  +FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVNAKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006295085.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
 gb|EOA27983.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
Length=178

 Score =   250 bits (639),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKANKPNLFM  178


 Score = 91.7 bits (226),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M T+RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGTFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010465351.1| PREDICTED: 60S ribosomal protein L18a-3 [Camelina sativa]
Length=178

 Score =   254 bits (648),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+RKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 88.2 bits (217),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF  + ++
Sbjct  1    MGVFRFHQYQVVGRALPTEKDEHPKIYRMKLWGKNEVCAKSKFWYFMRKLKK  52



>ref|XP_009141387.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
 ref|XP_009143771.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   252 bits (644),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 89.4 bits (220),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_004488609.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Cicer 
arietinum]
Length=182

 Score =   249 bits (636),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  50   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  109

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPP+RKL
Sbjct  110  ETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRKL  169

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  170  KTTYKATKPNLFM  182


 Score = 92.4 bits (228),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            +++  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  4    RLLLKQFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  56



>ref|XP_006407063.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48516.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=203

 Score =   256 bits (654),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  71   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  130

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  131  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  190

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  191  KTTYKASKPNLFM  203


 Score = 83.6 bits (205),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            FHQYQVVGRALP+E D  PKIYRMKLWATNEVRA SKFWYF  + ++
Sbjct  31   FHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAMSKFWYFLRKLKK  77



>ref|NP_180995.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 ref|XP_002881337.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 sp|P51418.2|R18A2_ARATH RecName: Full=60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 gb|AAC26708.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAK68743.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM14956.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAM53336.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAN15395.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAP21367.1| At2g34480 [Arabidopsis thaliana]
 gb|EFH57596.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|AEC08980.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
Length=178

 Score =   250 bits (639),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKANKPNLFM  178


 Score = 89.4 bits (220),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_004303886.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=178

 Score =   249 bits (636),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT + NYGIWLRYQSRTGYHNMYKE+R+TTLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTTINNYGIWLRYQSRTGYHNMYKEYRNTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV +K+RPPSRKL
Sbjct  106  EDMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVLRKIRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPNIF+
Sbjct  166  KTTYKASRPNIFM  178


 Score = 90.9 bits (224),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +R+HQYQVVGRALP+E DEHPKI+RMKLW TNEVRAKSKFWYF  + ++
Sbjct  1    MAPFRYHQYQVVGRALPTEKDEHPKIFRMKLWHTNEVRAKSKFWYFLRKLKK  52



>ref|XP_010504908.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010509745.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010516589.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Camelina 
sativa]
 ref|XP_010516590.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Camelina 
sativa]
Length=178

 Score =   250 bits (639),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  166  KTTYKANKPNLFM  178


 Score = 89.4 bits (220),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGLFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KFK44821.1| hypothetical protein AALP_AA1G307200 [Arabis alpina]
Length=178

 Score =   250 bits (639),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 88.2 bits (217),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALPSE +  PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGAFRFHQYQVVGRALPSEKELQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KJB34967.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
 gb|KJB42783.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
 gb|KJB69798.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=150

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  18   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  78   EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  138  KTTYKASKPNLFM  150



>ref|XP_006415527.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
 gb|ESQ33880.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
Length=317

 Score =   252 bits (643),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  185  FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAV  244

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  245  EQMYTEMASRHRVRFPCIQIIKTATVPAALCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  304

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  305  KTTYKASKPNLFM  317


 Score = 85.5 bits (210),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            FHQYQVVGRALP+E + HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  145  FHQYQVVGRALPTEKELHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  191



>ref|XP_002440257.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
 gb|EES18687.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
Length=178

 Score =   240 bits (612),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 97.4 bits (241),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|KJB10615.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=150

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  18   FLRKLKKVKKSNGQVLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  78   EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  138  KTTYKATKPNLFM  150



>gb|KJB69797.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=145

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  13   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  72

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  73   EQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKL  132

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  133  KTTYKASKPNLFM  145



>emb|CDX98480.1| BnaC05g38950D [Brassica napus]
Length=150

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  18   FLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  78   EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  138  KTTYKASKPNLFM  150



>ref|XP_002449311.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
 gb|EES08299.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
Length=178

 Score =   242 bits (618),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 94.4 bits (233),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVR+KSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALPTPADEHPKIYRMKLWATNEVRSKSKFWYFLRKLKK  52



>ref|NP_001237792.1| uncharacterized protein LOC100305604 [Glycine max]
 gb|ACU13370.1| unknown [Glycine max]
Length=150

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  18   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVRH CIQIIKTAT PAKLCKRESTKQFHNSKIKFPLVFKK+RPP+RKL
Sbjct  78   EHMYTEMASRHRVRHPCIQIIKTATTPAKLCKRESTKQFHNSKIKFPLVFKKIRPPTRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYK SRPN+F+
Sbjct  138  KTTYKTSRPNLFM  150



>ref|NP_001056335.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|AAT77404.1| putative 60S ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF18249.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|EAY99039.1| hypothetical protein OsI_20997 [Oryza sativa Indica Group]
 dbj|BAG95664.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64706.1| hypothetical protein OsJ_19561 [Oryza sativa Japonica Group]
Length=178

 Score =   240 bits (612),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNS IKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNSNIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 96.7 bits (239),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV YRFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>emb|CDX82474.1| BnaA03g33470D [Brassica napus]
Length=150

 Score =   256 bits (655),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  18   FLRKLKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  78   EQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  138  KTTYKASKPNLFM  150



>ref|XP_010499515.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
 ref|XP_010478371.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
Length=178

 Score =   249 bits (637),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLR+ KKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 87.0 bits (214),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWYF    ++
Sbjct  1    MGVFRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKK  52



>gb|EMS54441.1| 60S ribosomal protein L18a [Triticum urartu]
Length=178

 Score =   244 bits (622),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRSPCIQIIKTATVNFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPN+F+
Sbjct  166  KTTYKATRPNLFM  178


 Score = 92.4 bits (228),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010501986.1| PREDICTED: 60S ribosomal protein L18a-3-like [Camelina sativa]
Length=178

 Score =   251 bits (640),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+RKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNS+IKFPLVF+KVRPPSR L
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSEIKFPLVFRKVRPPSRML  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 85.5 bits (210),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV A SKFWYF  + ++
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGKNEVCAMSKFWYFMRKLKK  52



>gb|ABK26330.1| unknown [Picea sitchensis]
 gb|ABR16921.1| unknown [Picea sitchensis]
 gb|ABR17139.1| unknown [Picea sitchensis]
Length=178

 Score =   240 bits (613),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            +QMY EMASRHRVR+ CIQIIKTATIP +LCKRE+TKQF +SKIKFPLV++KVRPP+RKL
Sbjct  106  QQMYDEMASRHRVRYPCIQIIKTATIPNELCKRENTKQFQDSKIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 95.9 bits (237),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGR+LP+ TDEHPKI+RMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVNFRFHQYQVVGRSLPTPTDEHPKIFRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|NP_188078.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 sp|Q9LUD4.1|R18A3_ARATH RecName: Full=60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 dbj|BAB02392.1| 60S ribosomal protein L18A-like [Arabidopsis thaliana]
 gb|AAL60048.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AAM19893.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AEE75546.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
Length=178

 Score =   248 bits (633),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+RKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRE TKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 87.8 bits (216),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF  + ++
Sbjct  1    MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKK  52



>ref|XP_004303885.2| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   249 bits (636),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT + NYGIWLRYQSRTGYHNMYKE+R+TTLNGAV
Sbjct  49   FLRKLKKVKKSNGQILAINEIFEKNPTTINNYGIWLRYQSRTGYHNMYKEYRNTTLNGAV  108

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV +K+RPPSRKL
Sbjct  109  EDMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVLRKIRPPSRKL  168

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPNIF+
Sbjct  169  KTTYKASRPNIFM  181


 Score = 86.3 bits (212),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            +HQYQVVGRALP+E DEHPKI+RMKLW TNEVRAKSKFWYF  + ++
Sbjct  9    YHQYQVVGRALPTEKDEHPKIFRMKLWHTNEVRAKSKFWYFLRKLKK  55



>gb|EYU33347.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=150

 Score =   256 bits (653),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  18   FLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MYTEMASRHRVR+HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF KVRPP+RKL
Sbjct  78   EHMYTEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFHKVRPPTRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  138  KTTYKATKPNLFM  150



>gb|ADU56180.1| hypothetical protein [Jatropha curcas]
Length=154

 Score =   256 bits (654),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  22   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  81

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKT TIPAKLCKRES+KQFHNSKIKFPLVFKKVRPP+RKL
Sbjct  82   EQMYTEMASRHRVRFPCIQIIKTGTIPAKLCKRESSKQFHNSKIKFPLVFKKVRPPTRKL  141

Query  578  KTTYKASRPNIFV  616
            +TTYKASRPN+F+
Sbjct  142  RTTYKASRPNLFM  154


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  154  KIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            KIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    KIYRMKLWATNEVRAKSKFWYFLRKLKK  28



>gb|ACG30921.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW81142.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   238 bits (607),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            +TT+KASRPN+F+
Sbjct  166  RTTFKASRPNLFM  178


 Score = 97.4 bits (241),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|NP_001149475.1| LOC100283101 [Zea mays]
 ref|XP_002458279.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 gb|ACF85683.1| unknown [Zea mays]
 gb|ACF85980.1| unknown [Zea mays]
 gb|ACG29474.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35503.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35547.1| 60S ribosomal protein L18a [Zea mays]
 gb|EES03399.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 tpg|DAA58211.1| TPA: hypothetical protein ZEAMMB73_000159 [Zea mays]
Length=178

 Score =   240 bits (612),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 95.1 bits (235),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|NP_001148024.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG29459.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   238 bits (606),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNS IKFPLV++KVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSAIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            +TT+KASRPN+F+
Sbjct  166  RTTFKASRPNLFM  178


 Score = 97.4 bits (241),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_002882886.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59145.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   247 bits (630),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+RKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRE TKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 87.8 bits (216),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF  + ++
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKK  52



>ref|XP_006654794.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   238 bits (607),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHN  IKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 96.7 bits (239),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV YRFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|EMT07340.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   242 bits (617),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRSPCIQIIKTATVNFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYK +RPN+F+
Sbjct  166  KTTYKVTRPNLFM  178


 Score = 92.4 bits (228),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_006306031.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
 gb|EOA38929.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
Length=319

 Score =   249 bits (637),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLR+ KKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  187  FLRRQKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  246

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  247  EQMYTEMASRHRVRFPCIQIIKTATVPANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  306

Query  578  KTTYKASRPNIFV  616
            KTTYKA++PN+F+
Sbjct  307  KTTYKANKPNLFM  319


 Score = 84.7 bits (208),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             HQYQVVGRALP+E DEHPKIYRMKLWATNEV AKSKFWYF    ++
Sbjct  147  LHQYQVVGRALPTEKDEHPKIYRMKLWATNEVLAKSKFWYFLRRQKK  193



>ref|XP_006644488.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   239 bits (610),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHN+ IKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNASIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 95.1 bits (235),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010679799.1| PREDICTED: 60S ribosomal protein L18a-2 [Beta vulgaris subsp. 
vulgaris]
Length=178

 Score =   242 bits (617),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKS GQVLAINEI+EK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKLKKVKKSVGQVLAINEIYEKNPTLIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+P +LCKRE+TKQFH   IKFPLVFKKVRPPSRKL
Sbjct  106  EQMYTEMASRHRVRAPCIQIIKTATVPDELCKRENTKQFHAKDIKFPLVFKKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 92.4 bits (228),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E+D HPKIYRMKLWATN+VRAKSKFWYF  + ++
Sbjct  1    MGQFRFHQYQVVGRALPTESDAHPKIYRMKLWATNDVRAKSKFWYFLRKLKK  52



>gb|AAM65890.1| putative 60S ribosomal protein L18A [Arabidopsis thaliana]
Length=178

 Score =   246 bits (628),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+RKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTE+ASRHRVR  CIQIIKTAT+PAKLCKRE TKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  106  EQMYTEIASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRPPSRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 87.8 bits (216),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF  + ++
Sbjct  1    MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKK  52



>ref|XP_004969468.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   238 bits (608),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV +K+RPP+RKL
Sbjct  106  EQMYNEMASRHRVRAPCIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLVSRKIRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 95.5 bits (236),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_003567891.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   242 bits (617),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+   LCKR++TKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRSPCIQIIKTATVHFSLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPN+F+
Sbjct  166  KTTYKATRPNLFM  178


 Score = 92.0 bits (227),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|ACN28455.1| unknown [Zea mays]
 gb|AFW79177.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   236 bits (602),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNS IKFPLV++KVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSAIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            +TT+K+SRPN+F+
Sbjct  166  RTTFKSSRPNLFM  178


 Score = 97.4 bits (241),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010460775.1| PREDICTED: 60S ribosomal protein L18a-1-like [Camelina sativa]
Length=178

 Score =   247 bits (630),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLR+ KKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+ A LCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVQANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN+F+
Sbjct  166  KTTYKASRPNLFM  178


 Score = 87.0 bits (214),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWYF    ++
Sbjct  1    MGVFRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKK  52



>dbj|BAJ85943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=178

 Score =   242 bits (617),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKK+NGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FLRKLKKVKKANGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRSPCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPN+F+
Sbjct  166  KTTYKATRPNLFM  178


 Score = 91.7 bits (226),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|ACF78859.1| unknown [Zea mays]
Length=178

 Score =   238 bits (608),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLR LKKVKKSNGQVLAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRNLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 95.1 bits (235),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF    ++
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRNLKK  52



>ref|NP_001043805.2| Os01g0666900 [Oryza sativa Japonica Group]
 gb|EEC71234.1| hypothetical protein OsI_03189 [Oryza sativa Indica Group]
 dbj|BAF05719.2| Os01g0666900 [Oryza sativa Japonica Group]
Length=178

 Score =   238 bits (608),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHN  IKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 95.1 bits (235),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>gb|EMT24993.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   241 bits (616),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKK+NGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FLRKLKKVKKANGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRAPCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKA+RPN+F+
Sbjct  166  KTTYKATRPNLFM  178


 Score = 91.7 bits (226),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>emb|CDX84313.1| BnaC04g10750D [Brassica napus]
Length=150

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  18   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  78   EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  138  KTTYKASKPNLFM  150



>emb|CDX84643.1| BnaA03g15870D [Brassica napus]
Length=150

 Score =   254 bits (648),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  18   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  78   EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  138  KTTYKASKPNLFM  150



>ref|NP_001044264.1| Os01g0752300 [Oryza sativa Japonica Group]
 ref|XP_006644713.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
 sp|Q943F3.1|RL18A_ORYSJ RecName: Full=60S ribosomal protein L18a [Oryza sativa Japonica 
Group]
 pdb|3J61|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAB67920.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAB89536.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF06178.1| Os01g0752300 [Oryza sativa Japonica Group]
 gb|EAY75840.1| hypothetical protein OsI_03756 [Oryza sativa Indica Group]
 gb|EAZ13560.1| hypothetical protein OsJ_03475 [Oryza sativa Japonica Group]
Length=178

 Score =   239 bits (610),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFH S IKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHKSDIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 93.2 bits (230),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGR LP+ TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|NP_001152227.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG46491.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW83498.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   237 bits (605),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV +KVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVHRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            +TT+KASRPN+F+
Sbjct  166  RTTFKASRPNLFM  178


 Score = 95.1 bits (235),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_004979031.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   237 bits (605),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHN+KIKFPLV +K+RPP+RKL
Sbjct  106  EQMYNEMASRHRVRAPCIQIIKTATVHFKLCKRDNTKQFHNAKIKFPLVSRKIRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  166  KTTFKASRPNLFM  178


 Score = 95.1 bits (235),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>emb|CDY43672.1| BnaA04g20190D [Brassica napus]
 emb|CDY17253.1| BnaA05g09350D [Brassica napus]
Length=150

 Score =   253 bits (645),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  18   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  78   EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  138  KTTYKASKPNLFM  150



>ref|XP_003569521.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   239 bits (610),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+   LCKR++TKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRSPCIQIIKTATVHFSLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KA+RPN+F+
Sbjct  166  KTTFKATRPNLFM  178


 Score = 92.4 bits (228),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010940708.1| PREDICTED: 60S ribosomal protein L18a-2-like [Elaeis guineensis]
Length=178

 Score =   239 bits (610),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  251  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  430
            NGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRH
Sbjct  57   NGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRH  116

Query  431  RVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  610
            RVR+HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKK+RPP+RKLKTTYKASRPN+
Sbjct  117  RVRYHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKIRPPTRKLKTTYKASRPNL  176

Query  611  FV  616
            F+
Sbjct  177  FM  178


 Score = 92.0 bits (227),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  219
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYF
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYF  46



>ref|XP_009109630.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=194

 Score =   244 bits (622),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRK  K+KKSNGQ+LAINEIFEK PT + N+GIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  62   FLRKQVKIKKSNGQMLAINEIFEKNPTTINNFGIWLRYQSRTGYHNMYKEFRDTTLNGAV  121

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  122  EQMYTEMASRHRVRFPCIQIIKTATVPAALCKRESTKQFHNSKIKFPLVYRKVRPPTRKL  181

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  182  KTTYKASKPNLFM  194


 Score = 87.8 bits (216),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  70   VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
            +  KM  +RFHQYQVVGRALP+E +  PKIYRMKLWATNEVRA SKFWYF  +
Sbjct  13   LTTKMGVFRFHQYQVVGRALPTENEVQPKIYRMKLWATNEVRAMSKFWYFLRK  65



>ref|XP_010936051.1| PREDICTED: 60S ribosomal protein L18a-2 [Elaeis guineensis]
Length=178

 Score =   238 bits (608),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  251  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  430
            NGQVLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRH
Sbjct  57   NGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRH  116

Query  431  RVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  610
            RVR+HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKASRPN+
Sbjct  117  RVRYHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNL  176

Query  611  FV  616
            F+
Sbjct  177  FM  178


 Score = 92.0 bits (227),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  219
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYF
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYF  46



>ref|XP_006828776.1| hypothetical protein AMTR_s00001p00102800 [Amborella trichopoda]
 gb|ERM96192.1| hypothetical protein AMTR_s00001p00102800 [Amborella trichopoda]
Length=138

 Score =   252 bits (643),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  6    FLRKLKKVKKSNGQVLAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  65

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRE+TKQFH+S+IKFPLVF+KVRPP+RKL
Sbjct  66   EQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRENTKQFHDSRIKFPLVFRKVRPPTRKL  125

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  126  KTTFKASRPNLFM  138



>emb|CDY35269.1| BnaC03g59540D [Brassica napus]
Length=178

 Score =   245 bits (625),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRK  K+KKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  46   FLRKQVKIKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPAALCKRESTKQFHNSKIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  166  KTTYKASKPNLFM  178


 Score = 84.3 bits (207),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
            M  +RFHQYQVVGRALP+E +  PKIYRMKLWATNEVRA SKFWYF  +
Sbjct  1    MGVFRFHQYQVVGRALPTEKEVQPKIYRMKLWATNEVRAMSKFWYFLRK  49



>ref|NP_849729.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
 sp|Q8L7K0.1|R18A1_ARATH RecName: Full=60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AAM91614.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AAN15378.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AEE31159.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
Length=178

 Score =   243 bits (621),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            +LR+ KKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   YLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KA++PN+F+
Sbjct  166  KTTFKANKPNLFM  178


 Score = 84.7 bits (208),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M   R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+    ++
Sbjct  1    MSVIRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKK  52



>ref|XP_004961208.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=339

 Score =   238 bits (608),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  207  FLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  266

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKL
Sbjct  267  EQMYNEMASRHRVRAPCIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLVYRKVRPPTRKL  326

Query  578  KTTYKASRPNIFV  616
            KTT+KASRPN+F+
Sbjct  327  KTTFKASRPNLFM  339


 Score = 89.0 bits (219),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             T  FHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  163  CTIAFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  213



>ref|XP_010666370.1| PREDICTED: 60S ribosomal protein L18a-like [Beta vulgaris subsp. 
vulgaris]
Length=177

 Score =   236 bits (603),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKS GQVLAINEI+EK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV
Sbjct  45   FLRKLKKVKKSVGQVLAINEIYEKNPTIIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  104

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+P +LCKRE+TKQFH+  IKFP+VF+KVRPP+RKL
Sbjct  105  EQMYCEMASRHRVRAPCIQIIKTATVPDELCKRENTKQFHSKDIKFPMVFRKVRPPTRKL  164

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  165  KTTYKASKPNLFM  177


 Score = 90.1 bits (222),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            +RFHQYQVVGRALP+E+ EHPKIYRMKLWATN+VRAKSKFWYF  + ++
Sbjct  3    FRFHQYQVVGRALPTESVEHPKIYRMKLWATNDVRAKSKFWYFLRKLKK  51



>gb|ACG47612.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   229 bits (583),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  46   FLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGXV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
             QMY EM SRHRVR  CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KV PP+RKL
Sbjct  106  XQMYNEMXSRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVXPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            +TT+KASRPN+F+
Sbjct  166  RTTFKASRPNLFM  178


 Score = 97.4 bits (241),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>dbj|BAH20340.1| AT3G14600 [Arabidopsis thaliana]
Length=150

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+RKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V
Sbjct  18   FMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGV  77

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRE TKQFHNSKIKFPLVF+KVRPPSRKL
Sbjct  78   EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRPPSRKL  137

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  138  KTTYKASKPNLFM  150



>ref|NP_001152434.1| LOC100286074 [Zea mays]
 gb|ACG47606.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   233 bits (593),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKS GQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+R TTLNGAV
Sbjct  46   FLRKLKKVKKSXGQMLAINEIFERXPTTIKNYGIWLRYQSRTGYHNMYKEYRXTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            +TT+KASRPN+F+
Sbjct  166  RTTFKASRPNLFM  178


 Score = 93.6 bits (231),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRAL + TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAHRFHQYQVVGRALXTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_010549484.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Tarenaya 
hassleriana]
Length=312

 Score =   252 bits (643),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RD TLNGAV
Sbjct  180  FLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAV  239

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  240  EQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  299

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  300  KTTYKASKPNLFM  312


 Score = 73.6 bits (179),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  106  YQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            Y     ALP+ETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  143  YHCFVPALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  186



>ref|XP_002893593.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69852.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
Length=314

 Score =   244 bits (624),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLR+ KKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  182  FLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  241

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  242  EQMYTEMASRHRVRFPCIQIIKTATVPANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  301

Query  578  KTTYKASRPNIFV  616
            KTT+KAS+PN+F+
Sbjct  302  KTTFKASKPNLFM  314


 Score = 80.9 bits (198),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             HQYQVVGRALP E DE PKIYRMKLWATNEV AKSKFWYF    ++
Sbjct  142  LHQYQVVGRALPMEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKK  188



>ref|XP_006387717.1| hypothetical protein POPTR_0647s00210g [Populus trichocarpa]
 gb|ERP46631.1| hypothetical protein POPTR_0647s00210g [Populus trichocarpa]
Length=152

 Score =   248 bits (632),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +2

Query  230  LKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY  409
            LKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY
Sbjct  24   LKKVKKSNGQILAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMY  83

Query  410  TEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTY  589
            TEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTY
Sbjct  84   TEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTY  143

Query  590  KASRPNIFV  616
            KASRPN+F+
Sbjct  144  KASRPNLFM  152



>dbj|BAB90499.1| ribosomal protein L18a-like [Oryza sativa Japonica Group]
Length=195

 Score =   238 bits (607),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  203  PSSGIFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTT  382
            P    FLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTT
Sbjct  58   PVCRYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTT  117

Query  383  LNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRP  562
            LNGAVEQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHN  IKFPLV++KVRP
Sbjct  118  LNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRP  177

Query  563  PSRKLKTTYKASRPNIFV  616
            P+RKLKTT+KASRPN+F+
Sbjct  178  PTRKLKTTFKASRPNLFM  195


 Score = 85.9 bits (211),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKF  210
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKF
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKF  43



>ref|XP_003569823.1| PREDICTED: 60S ribosomal protein L18a [Brachypodium distachyon]
Length=178

 Score =   232 bits (592),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LA NEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAFNEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+   +CKR++TKQFH S IKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRSPCIQIIKTATVHFSICKRDNTKQFHKSDIKFPLVYQKVRPPTRKL  165

Query  578  KTTYKASRPNIFV  616
            KTT+KA+RPN+F+
Sbjct  166  KTTFKATRPNLFM  178


 Score = 90.9 bits (224),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGR LP+ T+E PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRGLPTPTEEKPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|NP_001077626.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AEE31161.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
Length=312

 Score =   242 bits (617),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            +LR+ KKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  180  YLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAV  239

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKL
Sbjct  240  EQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKL  299

Query  578  KTTYKASRPNIFV  616
            KTT+KA++PN+F+
Sbjct  300  KTTFKANKPNLFM  312


 Score = 80.5 bits (197),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+    ++
Sbjct  140  LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKK  186



>ref|XP_003617398.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=147

 Score =   245 bits (626),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  15   FLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  74

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E MY EMASRHRVR  CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPP+R L
Sbjct  75   ETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRSL  134

Query  578  KTTYKASRPNIFV  616
            KTTYKA +PN+F+
Sbjct  135  KTTYKAKKPNLFM  147



>ref|XP_001762693.1| predicted protein [Physcomitrella patens]
 ref|XP_001768277.1| predicted protein [Physcomitrella patens]
 gb|EDQ66891.1| predicted protein [Physcomitrella patens]
 gb|EDQ72492.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   233 bits (593),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKL+KVKK++GQ+LAINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAV
Sbjct  45   FLRKLQKVKKAHGQLLAINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAV  104

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIP  LCKR +TKQFHNSKIKFPL  +K+RPPSR L
Sbjct  105  EQMYDEMASRHRVRFPCIQIIKTATIPVSLCKRVNTKQFHNSKIKFPLTTRKIRPPSRSL  164

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN FV
Sbjct  165  KTTYKASRPNTFV  177


 Score = 87.4 bits (215),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MSFRFHQYQVVGRALPTATNETPKAYRMKLWATNEVRAKSKFWYFLRKLQK  51



>ref|XP_001765218.1| predicted protein [Physcomitrella patens]
 ref|XP_001774990.1| predicted protein [Physcomitrella patens]
 gb|EDQ60256.1| predicted protein [Physcomitrella patens]
 gb|EDQ69946.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   231 bits (590),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKL+KVKK++GQ+LAINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAV
Sbjct  45   FLRKLQKVKKAHGQLLAINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAV  104

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIP  LCKR +TKQFHNSKIKFPL  +K+RPP+R L
Sbjct  105  EQMYDEMASRHRVRFPCIQIIKTATIPVSLCKRVNTKQFHNSKIKFPLTTRKIRPPTRSL  164

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN FV
Sbjct  165  KTTYKASRPNTFV  177


 Score = 87.4 bits (215),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MSFRFHQYQVVGRALPTATNETPKAYRMKLWATNEVRAKSKFWYFLRKLQK  51



>gb|EEE55145.1| hypothetical protein OsJ_02939 [Oryza sativa Japonica Group]
Length=198

 Score =   223 bits (569),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 124/153 (81%), Gaps = 20/153 (13%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINE--------------------IFEKCPTKVKNYGIWLRYQS  337
            FLRKLKKVKKSNGQ+LAIN                     IFE+ PT +KNYGIWLRYQS
Sbjct  46   FLRKLKKVKKSNGQMLAINGGGPSAFANEFFIFLHHGFVGIFERNPTTIKNYGIWLRYQS  105

Query  338  RTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH  517
            RTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFH
Sbjct  106  RTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFH  165

Query  518  NSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  616
            N  IKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  166  NGSIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  198


 Score = 95.1 bits (235),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_004144680.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=757

 Score =   219 bits (558),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  278  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  457
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  645  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRCPCIQI  704

Query  458  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  616
            IKTAT+PAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  705  IKTATVPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  757


 Score = 99.4 bits (246),  Expect(2) = 7e-78, Method: Composition-based stats.
 Identities = 43/45 (96%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFW  213
            KMVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFW
Sbjct  574  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFW  618



>ref|XP_009419339.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=173

 Score =   228 bits (582),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 5/132 (4%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAIN IFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQVLAINVIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQII+TATIP+KLC     KQFH+SKIKFP+VFKKVRPP+RKL
Sbjct  106  EQMYNEMASRHRVRCLCIQIIRTATIPSKLC-----KQFHDSKIKFPVVFKKVRPPTRKL  160

Query  578  KTTYKASRPNIF  613
            KTT+KASRP++F
Sbjct  161  KTTFKASRPSLF  172


 Score = 89.4 bits (220),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGRALP+   EHPKIYRMKLWATNE RAKSKFWYF  + ++
Sbjct  1    MTIFRFHQYQVVGRALPTAAVEHPKIYRMKLWATNEARAKSKFWYFLRKLKK  52



>ref|XP_001752605.1| predicted protein [Physcomitrella patens]
 gb|EDQ82476.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   230 bits (586),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKL+KVKK++GQ+LAINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAV
Sbjct  45   FLRKLQKVKKAHGQLLAINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAV  104

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKT TIP  LCKR +TKQFHNSKIKFPL  +K+RPP+R L
Sbjct  105  EQMYDEMASRHRVRFPCIQIIKTGTIPVSLCKRVNTKQFHNSKIKFPLTTRKIRPPTRSL  164

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN FV
Sbjct  165  KTTYKASRPNTFV  177


 Score = 87.4 bits (215),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MSFRFHQYQVVGRALPTATNEAPKAYRMKLWATNEVRAKSKFWYFLRKLQK  51



>ref|XP_001760636.1| predicted protein [Physcomitrella patens]
 gb|EDQ74375.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   232 bits (591),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKL+KVKK++GQ+LAINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAV
Sbjct  45   FLRKLQKVKKAHGQLLAINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAV  104

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIP  LCKR +TKQFHNSKIKFPL  +K+RPPSR L
Sbjct  105  EQMYDEMASRHRVRSPCIQIIKTATIPVALCKRVNTKQFHNSKIKFPLTSRKIRPPSRSL  164

Query  578  KTTYKASRPNIFV  616
            KTTYKASRPN FV
Sbjct  165  KTTYKASRPNTFV  177


 Score = 82.4 bits (202),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            + +RFHQYQVVGRALP+  +E PK YRMKLWAT+EVRAKSKFWYF  + ++
Sbjct  1    MIFRFHQYQVVGRALPTPGNETPKAYRMKLWATDEVRAKSKFWYFLRKLQK  51



>gb|AAG52055.1|AC022455_9 60S ribosomal protein L18A, putative; 23187-20334 [Arabidopsis 
thaliana]
Length=321

 Score =   233 bits (595),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 127/145 (88%), Gaps = 12/145 (8%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINE------------IFEKCPTKVKNYGIWLRYQSRTGYHNMY  361
            +LR+ KKVKKSNGQ+LAINE            IFEK PT +KN+GIWLRYQSRTGYHNMY
Sbjct  177  YLRRQKKVKKSNGQMLAINEVLAVGSEFDLFSIFEKNPTTIKNFGIWLRYQSRTGYHNMY  236

Query  362  KEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPL  541
            KE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPL
Sbjct  237  KEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPL  296

Query  542  VFKKVRPPSRKLKTTYKASRPNIFV  616
            VF+KVRPP+RKLKTT+KA++PN+F+
Sbjct  297  VFRKVRPPTRKLKTTFKANKPNLFM  321


 Score = 80.5 bits (197),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+    ++
Sbjct  137  LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKK  183



>pdb|3IZS|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 
80s Ribosome
Length=167

 Score =   221 bits (562),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFH S IKFPLV++KVRPP+RKL
Sbjct  106  EQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHKSDIKFPLVYRKVRPPTRKL  165

Query  578  KT  583
            KT
Sbjct  166  KT  167


 Score = 93.2 bits (230),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M  +RFHQYQVVGR LP+ TDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_011460183.1| PREDICTED: 60S ribosomal protein L18a [Fragaria vesca subsp. 
vesca]
Length=178

 Score =   226 bits (577),  Expect(2) = 9e-75, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  248  SNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  427
            SNGQ+LAINEIFEK PT V+NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV+QMY EMASR
Sbjct  56   SNGQMLAINEIFEKKPTVVENYGIWLRYQSRTGYHNMYKEYRDTTLNGAVDQMYNEMASR  115

Query  428  HRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN  607
            HRVR  CIQIIK ATIPAKLCKRE TKQFHNSKIKFPL+ +KVRPP+RKLKTTYKASRPN
Sbjct  116  HRVRFPCIQIIKIATIPAKLCKRECTKQFHNSKIKFPLITRKVRPPTRKLKTTYKASRPN  175

Query  608  IFV  616
            +FV
Sbjct  176  LFV  178


 Score = 81.6 bits (200),  Expect(2) = 9e-75, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  219
            MV  ++HQYQVVGRALP + ++ PKIYRMKLW TNEVRAKSKFWYF
Sbjct  1    MVALKYHQYQVVGRALPKDAEDTPKIYRMKLWHTNEVRAKSKFWYF  46



>ref|XP_002961150.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
 ref|XP_002966859.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ31458.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ38689.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
Length=177

 Score =   224 bits (570),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKS+GQ+LAINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAV
Sbjct  45   FLRKLKKVKKSHGQILAINEIFEKNPTTIKNYGIWVRYQSRTGYHNMYKEYRDITLNGAV  104

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTA++P   CKRE+TKQFH+S+IKFPL+ +K+R PSRKL
Sbjct  105  EQMYDEMASRHRVRFPCIQIIKTASVPDSACKRENTKQFHSSEIKFPLMNRKIRAPSRKL  164

Query  578  KTTYKASRPNIFV  616
            KTT+KA RPN F 
Sbjct  165  KTTFKAKRPNTFA  177


 Score = 81.6 bits (200),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            + +RFHQYQVVGRA P+  +EHPK+YRMKLWA +EVRAKSKFWYF  + ++
Sbjct  1    MKFRFHQYQVVGRATPTPDNEHPKMYRMKLWAGDEVRAKSKFWYFLRKLKK  51



>ref|XP_007146225.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
 gb|ESW18219.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
Length=159

 Score =   196 bits (498),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 109/133 (82%), Gaps = 19/133 (14%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRK+KKVKKSNGQ+LAINE                   SRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKVKKVKKSNGQMLAINE-------------------SRTGYHNMYKEYRDTTLNGAV  86

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EMASRHRVR  CIQIIKTATIPAKLCKRE TKQF +SKIKFPLVFKK+RPP+RKL
Sbjct  87   EQMYNEMASRHRVRCPCIQIIKTATIPAKLCKRECTKQFLDSKIKFPLVFKKIRPPTRKL  146

Query  578  KTTYKASRPNIFV  616
            KTTYKAS+PN+F+
Sbjct  147  KTTYKASKPNLFM  159


 Score =   100 bits (250),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKVKK  52



>ref|XP_006384076.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 gb|ERP61873.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=121

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  278  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  457
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  9    IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  68

Query  458  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  616
            IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  69   IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  121



>gb|KDO49364.1| hypothetical protein CISIN_1g028910mg [Citrus sinensis]
Length=124

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +2

Query  275  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  454
            EIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQ
Sbjct  11   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRSPCIQ  70

Query  455  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  616
            II+TATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  71   IIRTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  124



>ref|XP_005652280.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
 gb|EIE27736.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
Length=179

 Score =   210 bits (534),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKL+KVKK+NGQ+LA NEIFEK PT VKN+G+W+RYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  46   FLRKLRKVKKANGQILAANEIFEKKPTTVKNFGVWVRYQSRTGYHNMYKEYRDTTLNGAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQ+Y EMASRHRVR  C+QIIKTAT+PA L KR + KQFH+SKIKFPL  +  RP SR  
Sbjct  106  EQLYQEMASRHRVRAPCMQIIKTATVPAALTKRVNIKQFHDSKIKFPLTRRMARPSSRTF  165

Query  578  KTTYKASRPNI  610
            KTT+KA RPN+
Sbjct  166  KTTFKAVRPNV  176


 Score = 76.3 bits (186),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
            M  Y++HQYQVVGR LP+E +  P IYRMKLWAT+ VRAKSKFWYF  +
Sbjct  1    MGGYKYHQYQVVGRHLPTEKEPEPTIYRMKLWATDPVRAKSKFWYFLRK  49



>ref|XP_005848088.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
 gb|EFN55986.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
Length=181

 Score =   206 bits (525),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKL+KVKK+NGQ+LA NEIFE+ PT VKNYGIW+RYQSRTG+HN YKE+RDTTLNGAV
Sbjct  48   FLRKLRKVKKANGQILACNEIFERNPTTVKNYGIWVRYQSRTGFHNAYKEYRDTTLNGAV  107

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EM SRHRVR  CIQIIKTATI A  CKR +T+Q H+SKI FPL  K +RP SRK 
Sbjct  108  EQMYQEMGSRHRVRSPCIQIIKTATITAAQCKRAATQQLHDSKISFPLTRKVLRPSSRKY  167

Query  578  KTTYKASRPNI  610
            +TT+KA RPN+
Sbjct  168  RTTFKAVRPNV  178


 Score = 77.0 bits (188),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
            Y++HQYQVVGR LPSE D  P IYRMKLWA + VRAKSKFWYF  +
Sbjct  6    YKYHQYQVVGRHLPSEKDAEPTIYRMKLWAQDPVRAKSKFWYFLRK  51



>gb|AFW81143.1| hypothetical protein ZEAMMB73_376835 [Zea mays]
Length=119

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  439
            +LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR
Sbjct  1    MLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVR  60

Query  440  HHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  616
              CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKL+TT+KASRPN+F+
Sbjct  61   SPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLRTTFKASRPNLFM  119



>ref|XP_009144150.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=117

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  278  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  457
            IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  5    IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  64

Query  458  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  616
            IKTAT+PAKLCKRESTK FHNSKIKFP VF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  65   IKTATVPAKLCKRESTKLFHNSKIKFPSVFRKVRPPTRKLKTTYKASKPNLFM  117



>gb|AAT08714.1| ribosomal protein L18A [Hyacinthus orientalis]
Length=178

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 118/137 (86%), Gaps = 8/137 (6%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHN----MYKEFRDTTL  385
            FLRKLKKVKKSNGQVLAINEIFEK PTK+    I LR+ +     N    MYKE+RDTTL
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTKI----IELRHMAEVPEQNRLSYMYKEYRDTTL  101

Query  386  NGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP  565
            NG VEQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP
Sbjct  102  NGGVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPP  161

Query  566  SRKLKTTYKASRPNIFV  616
            +RKLKTT+KASRPN+F+
Sbjct  162  TRKLKTTFKASRPNLFM  178


 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEES*EKQWPG  261
            M  +RFHQYQVVGRALP+ +DEHPKI+RMKLWATNEVRAKSKFWYF  + ++  +     
Sbjct  1    MGGFRFHQYQVVGRALPTPSDEHPKIFRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  PRYQ*DI*EVPYQG*ELRDMVEVPEQNRVS  351
                    + P +  ELR M EVPEQNR+S
Sbjct  61   LAINEIFEKNPTKIIELRHMAEVPEQNRLS  90



>gb|KCW89757.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=178

 Score =   173 bits (439),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  81   FLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  140

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPA  481
            EQMYTEMASRHRVR  CIQIIKTAT+PA
Sbjct  141  EQMYTEMASRHRVRFPCIQIIKTATVPA  168


 Score = 99.0 bits (245),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  73   VAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             + MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  33   TSTMVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  87



>gb|KIZ01204.1| 60S ribosomal protein L18a-2 [Monoraphidium neglectum]
Length=182

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKL++VKK+NGQVLA+NEIFE+  T VKN+G+W+RYQSRTGYHNMYKE+RDTTLNGA+
Sbjct  49   FLRKLRRVKKANGQVLAVNEIFERKTTTVKNFGVWVRYQSRTGYHNMYKEYRDTTLNGAI  108

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
             QMY EMASRHRVR+ CIQ+IKTAT+PA  CKR +T QFH+SKIKFPL    +RP S+  
Sbjct  109  GQMYGEMASRHRVRYPCIQVIKTATVPASACKRANTLQFHDSKIKFPLTHNALRPSSKVF  168

Query  578  KTTYKASRPNI  610
            KT YKA RPN+
Sbjct  169  KTLYKAKRPNV  179


 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
            +++HQYQVVGR  P+  + +P +YRMK+WA + V AKSKFWYF  +
Sbjct  7    FKYHQYQVVGRHNPTTAEPNPTVYRMKVWAPDAVCAKSKFWYFLRK  52



>gb|ACN30573.1| unknown [Zea mays]
Length=117

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +2

Query  275  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  454
            +IFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQ
Sbjct  4    QIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRSPCIQ  63

Query  455  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  616
            IIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  64   IIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  117



>ref|XP_011401286.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
 gb|KFM28272.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
Length=182

 Score =   187 bits (476),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL KL+KVKK+NGQ++A+NEIFE+ PT +KN+GIW+RY SRTG HNM+KE+RD TLNGAV
Sbjct  49   FLAKLRKVKKANGQIVAVNEIFERRPTTIKNFGIWVRYTSRTGVHNMFKEYRDVTLNGAV  108

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY EM SRHRVR   +QIIKTATI A   KR + KQFH+SKI FPL  +  RP   + 
Sbjct  109  EQMYQEMGSRHRVRSSALQIIKTATIKAADTKRANIKQFHDSKISFPLTRRMARPSDPRF  168

Query  578  KTTYKASRPNIFV  616
            KTT+KA+RPN+ +
Sbjct  169  KTTFKANRPNVAI  181


 Score = 73.9 bits (180),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFF  222
            Y++HQYQVVGR LP+E D  P I+RMKLWA + VRAKSKFWYF 
Sbjct  7    YKYHQYQVVGRHLPTEKDAEPPIFRMKLWAQDTVRAKSKFWYFL  50



>ref|XP_001689743.1| ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09481.1| ribosomal protein L18a [Chlamydomonas reinhardtii]
Length=182

 Score =   189 bits (479),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKL++VKK+NGQ++A NEIFE+ PT  KNYGIW+RYQSRTG HNMYKE+RD TLNG+V
Sbjct  49   FLRKLRRVKKANGQIIACNEIFERKPTLAKNYGIWVRYQSRTGVHNMYKEYRDVTLNGSV  108

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
             QMY EMASRHRVR   IQIIKTAT+    CKR +TKQFHN KI FP+  K  RP S   
Sbjct  109  SQMYQEMASRHRVRPSSIQIIKTATVDYHSCKRANTKQFHNEKISFPVTQKLARPSSATF  168

Query  578  KTTYKASRPNI  610
            +T +KA+RPN+
Sbjct  169  RTLFKANRPNV  179


 Score = 72.4 bits (176),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  88   TYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
             ++FHQYQVVGR LP+  D +P +YRMK+WA ++V+AKSKFWYF  +
Sbjct  6    NFKFHQYQVVGRHLPTAADANPTVYRMKVWAEDDVKAKSKFWYFLRK  52



>gb|KHN49096.1| 60S ribosomal protein L18a-2, partial [Glycine soja]
Length=116

 Score =   197 bits (500),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  269  INEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHC  448
            I + FEK PTK+KNYGIWLRYQSRTGY +MYKE+RDTTLNGA+  MY EMASRHRVR  C
Sbjct  1    IFQTFEKNPTKIKNYGIWLRYQSRTGYDSMYKEYRDTTLNGAIRVMYNEMASRHRVRSPC  60

Query  449  IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  616
            IQIIK  TIPAKLCKRESTKQFHNSKI FPLV+KKVRPP+RKLK TYKA +PN+F+
Sbjct  61   IQIIKIVTIPAKLCKRESTKQFHNSKINFPLVYKKVRPPTRKLKATYKAKKPNLFM  116



>ref|XP_002948508.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
 gb|EFJ50383.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
Length=182

 Score =   187 bits (476),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKL++VKK+NGQ++A NEIFE+ PT  KNYG+W+RYQSRTG HNMYKE+RD TLNG+V
Sbjct  49   FLRKLRRVKKANGQIIACNEIFERKPTLAKNYGVWVRYQSRTGVHNMYKEYRDVTLNGSV  108

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
             QMY EMASRHRVR   IQIIKTAT+    CKR +TKQFHN  IKFP+  K  RP + + 
Sbjct  109  AQMYQEMASRHRVRPSSIQIIKTATVDYHSCKRANTKQFHNENIKFPVTHKLSRPSNPEF  168

Query  578  KTTYKASRPNI  610
            +T +KASRPN+
Sbjct  169  RTLFKASRPNV  179


 Score = 70.9 bits (172),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  88   TYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
             ++FHQYQVVGR LP+  D  P +YRMK+WA ++V+AKSKFWYF  +
Sbjct  6    NFKFHQYQVVGRHLPTAADATPTVYRMKVWAEDDVKAKSKFWYFLRK  52



>gb|KDD75676.1| ribosomal protein L18ae/LX [Helicosporidium sp. ATCC 50920]
Length=182

 Score =   188 bits (478),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+RKL+KVKK+NGQV+A+NEI EK PT VKNYGIW+RY SRTG HNMYKEFRDTTLNGAV
Sbjct  49   FMRKLRKVKKANGQVVAVNEIVEKRPTVVKNYGIWVRYTSRTGVHNMYKEFRDTTLNGAV  108

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
             QMY+EMA RHRVRH  +QIIKTA IPA+L KR   KQF ++KI+FP+  + VRP SR  
Sbjct  109  SQMYSEMAGRHRVRHSALQIIKTAEIPAELVKRPGVKQFLSAKIRFPITRRLVRPSSRVH  168

Query  578  KTTYKASRPN  607
            K+ ++  RPN
Sbjct  169  KSLFQDRRPN  178


 Score = 68.6 bits (166),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
            +++ QYQVVGR LP+E D  P ++RMKLWA + VRAKSKFWYF  +
Sbjct  7    FKYKQYQVVGRHLPTEKDAEPALFRMKLWAEDSVRAKSKFWYFMRK  52



>emb|CDY71447.1| BnaAnng37490D, partial [Brassica napus]
Length=98

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +2

Query  260  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  439
            +LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR
Sbjct  1    MLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVR  60

Query  440  HHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKK  553
              CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+K
Sbjct  61   FPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRK  98



>ref|XP_007508296.1| unknown [Bathycoccus prasinos]
 emb|CCO20400.1| unknown [Bathycoccus prasinos]
Length=211

 Score =   170 bits (431),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL +L+KVKK+NGQ++A NEIFEK  T VKNYG+W+RYQSR G+HN YKE+R+TT+N AV
Sbjct  78   FLSRLRKVKKANGQIIACNEIFEKDDTTVKNYGVWIRYQSRVGFHNAYKEYRETTMNAAV  137

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            + +YTEMASRHRVR H +QIIK A +  +  +RE+T+QF    + FP+V K +R  S+  
Sbjct  138  DALYTEMASRHRVRSHALQIIKIAEVANEDVRRENTRQFLADDVSFPVVRKTLRHDSKSQ  197

Query  578  KTTYKASRPNIFV  616
            KTT+K  RPN  +
Sbjct  198  KTTFKYQRPNFAI  210


 Score = 65.9 bits (159),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFF  222
            +HQYQ+VGR +P+E +  P++YRMKLWA +  RA+SKFWYF 
Sbjct  38   YHQYQIVGRRVPTEQEPTPQVYRMKLWALDATRARSKFWYFL  79



>ref|XP_001418811.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97104.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=179

 Score =   166 bits (420),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+ +LKKVKK+NGQ++A NEIFE   T VKN+GIW+RYQSRTGYHN YKE+R+TT+N AV
Sbjct  46   FMSRLKKVKKANGQIIACNEIFEADTTTVKNFGIWIRYQSRTGYHNSYKEYRETTMNAAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            + +Y EMASRHRVR  C+QIIK A +  K  +RE+T+QF    + FP+V K  R PS+  
Sbjct  106  DALYEEMASRHRVRASCLQIIKIAEVADKDVRRENTRQFIQDDLSFPVVTKVTRHPSKAS  165

Query  578  KTTYKASRPN  607
            KT  K  RPN
Sbjct  166  KTIIKYKRPN  175


 Score = 67.8 bits (164),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFF  222
            M   R+HQYQVVGR +P++    P+++RMKLWA ++V+A+SKFWYF 
Sbjct  1    MAKIRYHQYQVVGRHVPTDAHPEPEVFRMKLWALDDVKARSKFWYFM  47



>ref|XP_008880083.1| hypothetical protein H310_14105 [Aphanomyces invadans]
 gb|ETV91246.1| hypothetical protein H310_14105 [Aphanomyces invadans]
Length=177

 Score =   164 bits (416),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL ++KK+KK+ G++L+INE+ EK    VKNYG+W+RY SR+G HNMYKE+RD TLNGA+
Sbjct  44   FLHQMKKMKKTTGEILSINELREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLNGAI  103

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQ+Y E+A RHR R   IQI++TA + AK CK+ +T Q+H+SKIKFPL  +  RP  +K 
Sbjct  104  EQLYAELAGRHRARPRSIQIMRTAILAAKDCKKPNTLQYHDSKIKFPLSHRVPRPSLKKF  163

Query  578  KTTYKASRPNIF  613
            +T YKA+RP+ F
Sbjct  164  RTVYKANRPSTF  175


 Score = 64.7 bits (156),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             H YQVVGR  P+ETD +P  +RMKL+A NEV AKS+FWYF  + ++
Sbjct  4    IHHYQVVGRKAPTETDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKK  50



>gb|ADV03035.1| ribosomal protein L18A [Karlodinium veneficum]
Length=187

 Score =   162 bits (411),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F++K+ K K+S G++L +NE+F++ PTKVKNYGIWLRY+SRT  HNMYKEFRD T+NGAV
Sbjct  55   FMKKINKAKRSGGELLGVNELFDRAPTKVKNYGIWLRYESRTNTHNMYKEFRDVTINGAV  114

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
             Q+Y+EMA RHR +   IQII T  + A  CKR+   + H S +KFP V +K+   ++KL
Sbjct  115  SQLYSEMAGRHRAQPGSIQIIDTKVLKASECKRDHVTEMHKSDLKFP-VIRKMPMSAKKL  173

Query  578  KTTYKASRPNIFV  616
            KTT+ A RP  FV
Sbjct  174  KTTFTAKRPMTFV  186


 Score = 66.6 bits (161),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEES  240
            R HQYQ+VGRA P+  +  PKIYRM+L+A N V AKS+FWYF ++  ++
Sbjct  14   RMHQYQIVGRAAPTPKNPTPKIYRMRLFAKNAVLAKSRFWYFMKKINKA  62



>emb|CEF98555.1| Ribosomal protein L18ae [Ostreococcus tauri]
Length=179

 Score =   159 bits (403),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+ +LKKVKK+NGQ++A NEIFE+  T VKN+GIW+RYQSRTG+HN YKE+R+TT+N AV
Sbjct  46   FMSRLKKVKKANGQIIACNEIFEEDTTTVKNFGIWIRYQSRTGFHNSYKEYRETTMNKAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            + +Y EMASRHRVR   +QIIK A +  +  +RE+T+QF    + FP+V K +R PS+  
Sbjct  106  DALYEEMASRHRVRSSQLQIIKIAEVSDENVRRENTRQFLAEDLSFPVVNKVMRHPSKAT  165

Query  578  KTTYKASRPN  607
            KT +K  RPN
Sbjct  166  KTIFKYKRPN  175


 Score = 68.2 bits (165),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFF  222
            M  YR+ Q+QVVGR LP+E    P+++RMKLWA ++V+A+SKFWYF 
Sbjct  1    MAPYRYRQFQVVGRHLPTEATPEPEVFRMKLWALDDVKARSKFWYFM  47



>gb|KHN11975.1| 60S ribosomal protein L18a-2 [Glycine soja]
Length=87

 Score =   169 bits (429),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  356  MYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKF  535
            MYKE+RDTTLNGAVE MYTEMASRHRVRH CIQIIKTATIPAKLCKRESTKQFHNSKIKF
Sbjct  1    MYKEYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTATIPAKLCKRESTKQFHNSKIKF  60

Query  536  PLVFKKVRPPSRKLKTTYKASRPNIFV  616
            PLVFKK+RPP+RKLKTTYKASRPN+F+
Sbjct  61   PLVFKKIRPPTRKLKTTYKASRPNLFM  87



>ref|XP_009831602.1| hypothetical protein H257_07690 [Aphanomyces astaci]
 gb|ETV78883.1| hypothetical protein H257_07690 [Aphanomyces astaci]
Length=177

 Score =   159 bits (403),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL ++KK+KK+ G++L++NE+ EK    VKNYG+W+RY SR+G HNMYKE+RD TLN A+
Sbjct  44   FLHQMKKMKKTTGEILSVNELREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLNSAI  103

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQ+Y E+A RHR R   IQI++TA + AK CK+ +T Q+HNS IKFPL  +  RP  +K 
Sbjct  104  EQLYAELAGRHRARPRSIQIMRTAILAAKDCKKPNTLQYHNSAIKFPLSHRVPRPSLKKF  163

Query  578  KTTYKASRPNIF  613
            +T +KA+RP+ F
Sbjct  164  RTIFKANRPSTF  175


 Score = 65.1 bits (157),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             H YQVVGR  P+ETD +P  +RMKL+A NEV AKS+FWYF  + ++
Sbjct  4    IHHYQVVGRKAPTETDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKK  50



>emb|CBI30857.3| unnamed protein product [Vitis vinifera]
Length=124

 Score =   120 bits (301),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGA+
Sbjct  46   FLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAL  105


 Score =   103 bits (256),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            MVT+RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    MVTFRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  52



>ref|XP_008604133.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
 gb|EQC42710.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
Length=177

 Score =   157 bits (398),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL ++KK+KK+ G++L +NE+ EK    VKNYG+W+RY SR+G HNMYKE+RD TL GAV
Sbjct  44   FLHQMKKMKKTTGEILCLNELREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLCGAV  103

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY E+A RHR R   IQI++TA + AK CK+ +T Q+H+S IKFPL  +  RP ++  
Sbjct  104  EQMYAELAGRHRARPRSIQIMRTAILAAKDCKKPNTLQYHDSAIKFPLSHRVPRPANKNQ  163

Query  578  KTTYKASRPNIF  613
            +T +KASRP  F
Sbjct  164  RTVFKASRPTTF  175


 Score = 65.5 bits (158),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             HQYQVVGR  P+E+D +P  +RMKL+A NEV AKS+FWYF  + ++
Sbjct  4    IHQYQVVGRKAPTESDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKK  50



>ref|XP_003062312.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53131.1| predicted protein [Micromonas pusilla CCMP1545]
Length=185

 Score =   151 bits (381),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL +LKKVKK+NGQ++A NEIFE+  T +KN+GIW+RYQSRTG+HN YKE+R+ ++N AV
Sbjct  50   FLSRLKKVKKANGQIIACNEIFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYREISMNKAV  109

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK--IKFPLVFKKVRPPSR  571
            + +Y EMASRHRVR  C+QIIK   +     KR++T QF   K  + FP+V K +R  S+
Sbjct  110  DALYEEMASRHRVRAPCLQIIKICQVADADVKRDNTIQFLGVKEPVSFPVVNKVLRHDSK  169

Query  572  KLKTTYKASRPNI  610
              KTT+K  RPN 
Sbjct  170  SQKTTFKYKRPNF  182


 Score = 70.5 bits (171),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  70   VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            +V  +  +R+HQY +VGR +P++ D +P++YRMKLW+ ++ RAKSKFWYF    ++
Sbjct  1    MVKGLKPHRYHQYHIVGRHVPTDADPNPQVYRMKLWSLDDTRAKSKFWYFLSRLKK  56



>gb|KGN65560.1| hypothetical protein Csa_1G448420 [Cucumis sativus]
Length=87

 Score =   166 bits (421),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  356  MYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKF  535
            MYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFH+SKIKF
Sbjct  1    MYKEYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIKTATVPAKLCKRESTKQFHDSKIKF  60

Query  536  PLVFKKVRPPSRKLKTTYKASRPNIFV  616
            PLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  61   PLVFKKVRPPTRKLKTTYKASKPNLFM  87



>gb|KHF99199.1| 60S ribosomal L18a [Gossypium arboreum]
Length=143

 Score =   168 bits (425),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  251  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  430
            N QV+AINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMY EMASR+
Sbjct  45   NSQVIAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGVVEQMYIEMASRY  104

Query  431  RVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKF  535
            RV+  CIQI KT TIPAKLCKR+STKQ HNSKI +
Sbjct  105  RVQFPCIQIFKTTTIPAKLCKRDSTKQLHNSKIHW  139



>gb|ABQ42114.1| 60S ribosomal protein L18a [Sonneratia caseolaris]
Length=107

 Score =   159 bits (401),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  26   FLRKLKKVKKSNGQVLAINEIFEKNPTKIDNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  85

Query  398  EQMYTEMASRHRVRHHCIQIIK  463
            EQMY EMASRHRVR  CIQIIK
Sbjct  86   EQMYNEMASRHRVRFPCIQIIK  107


 Score = 62.0 bits (149),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  142  DEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  32



>gb|ABQ42113.1| 60S ribosomal protein L18a [Sonneratia alba]
 gb|ABQ42115.1| 60S ribosomal protein L18a [Sonneratia ovata]
 gb|ABQ42116.1| 60S ribosomal protein L18a [Sonneratia apetala]
Length=107

 Score =   157 bits (398),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT++ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  26   FLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  85

Query  398  EQMYTEMASRHRVRHHCIQIIK  463
            EQMY EMASRHRVR  CIQIIK
Sbjct  86   EQMYNEMASRHRVRFPCIQIIK  107


 Score = 62.0 bits (149),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  142  DEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            DEHPKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  32



>gb|EMS66554.1| 60S ribosomal protein L18a [Triticum urartu]
Length=146

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 5/121 (4%)
 Frame = +2

Query  257  QVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH-R  433
            ++ A NEIFEK PT ++N+GIWLRYQSRTGYHNMY E+ DTTLNGAVEQMYTEMASRH  
Sbjct  30   KLWATNEIFEKNPTTIENFGIWLRYQSRTGYHNMYNEYSDTTLNGAVEQMYTEMASRHCA  89

Query  434  VRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  613
                  Q + T  I    CKR++TKQFH S I+F LV++KVRPPSRKL+TT+KASRPN+F
Sbjct  90   ASRSSRQPLSTPNI----CKRDNTKQFHKSDIRFLLVYQKVRPPSRKLQTTFKASRPNLF  145

Query  614  V  616
            V
Sbjct  146  V  146


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKS  204
            MV +RFHQYQVVGR LP+ T++HP+IYRMKLWATNE+  K+
Sbjct  1    MVAFRFHQYQVVGRGLPTPTEDHPRIYRMKLWATNEIFEKN  41



>ref|XP_002501229.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62487.1| predicted protein [Micromonas sp. RCC299]
Length=188

 Score =   155 bits (391),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL +LKKVKK+NGQ+LA NEIFE+  T +KN+GIW+RYQSRTG+HN YKE+R+ ++N AV
Sbjct  53   FLSRLKKVKKANGQILACNEIFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYREVSMNKAV  112

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK--IKFPLVFKKVRPPSR  571
            + +Y EMASRHRVR  C+QIIK A +     KR++T QF   K  + FP+V K +R  S+
Sbjct  113  DALYEEMASRHRVRAPCLQIIKIAQVADADVKRDNTIQFLGVKEPVSFPVVNKVLRHDSK  172

Query  572  KLKTTYKASRPNI  610
              KTT+K  RPN 
Sbjct  173  SQKTTFKYKRPNF  185


 Score = 60.8 bits (146),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            + Q+ +VGR +P++    P++YRMKLW+T++ RAKSKFWYF    ++
Sbjct  13   YRQFHIVGRHVPTDAMPDPQVYRMKLWSTDDTRAKSKFWYFLSRLKK  59



>ref|XP_005702735.1| 60S ribosomal protein L18Ae [Galdieria sulphuraria]
 gb|EME26215.1| 60S ribosomal protein L18Ae [Galdieria sulphuraria]
Length=178

 Score =   155 bits (393),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLK+VKKS+G++L I+EIFEK  T+VKNYGIW+RY+SR+   NMY+E+RD T+NGAV
Sbjct  45   FLRKLKRVKKSSGEILNISEIFEKKSTQVKNYGIWIRYKSRSDTINMYREYRDVTVNGAV  104

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY +M+ RHR R   I ++K   + AK C+R    QFH+SKIKF L   + R P +K 
Sbjct  105  EQMYKDMSGRHRARWSSIWVLKAMPVAAKDCRRSKVTQFHDSKIKFALPHMRPRAPLKKY  164

Query  578  KTTYKASRPNIFV  616
             T +KA RP   V
Sbjct  165  NTPFKAKRPTTIV  177


 Score = 57.8 bits (138),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
             HQY VVGR +P++ +  P IYR+K++A N V AKS+FWYF  +
Sbjct  5    LHQYSVVGRKIPTQEEPEPPIYRLKIFAPNVVNAKSRFWYFLRK  48



>gb|ADV03042.1| ribosomal protein L18A [Amphidinium carterae]
Length=187

 Score =   148 bits (373),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F++K+ K KKS G++LA+NEI ++ P  VKNYGIWLRY+SRT  HNMYKE+RD  +N AV
Sbjct  55   FMKKMCKAKKSGGELLAVNEIKDRRPLVVKNYGIWLRYESRTNTHNMYKEYRDVDINNAV  114

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
             +MY EM+ RHR     IQII TA +P   C+R+   + H   ++FP+V +K+  P +K 
Sbjct  115  GKMYQEMSGRHRANPGSIQIINTAVLPDDKCRRDHVTEMHQKMLRFPVV-RKLPLPLKKY  173

Query  578  KTTYKASRPNIFV  616
            ++T+KASRPN FV
Sbjct  174  RSTFKASRPNTFV  186


 Score = 63.5 bits (153),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 5/58 (9%)
 Frame = +1

Query  55   QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
            +ED S+  KM     HQ+Q+VGRA P+     PKIYRM+L+A N V AKS+FWYF ++
Sbjct  6    KEDPSLKPKM-----HQFQIVGRAAPTTKRPTPKIYRMRLFAKNTVMAKSRFWYFMKK  58



>gb|ACS68696.1| 60S RPL18aB [Sonneratia alba]
 gb|ACS68767.1| 60S RPL18aB, partial [Sonneratia alba]
Length=101

 Score =   153 bits (386),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FLRKLKKVKKSNGQVLAINEIFEK PT++ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV
Sbjct  23   FLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV  82

Query  398  EQMYTEMASRHRVRHHCIQ  454
            EQMY EMASRHRVR  CIQ
Sbjct  83   EQMYNEMASRHRVRFPCIQ  101


 Score = 54.7 bits (130),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  151  PKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            PKIYRMKLWATNEVRAKSKFWYF  + ++
Sbjct  1    PKIYRMKLWATNEVRAKSKFWYFLRKLKK  29



>gb|ELK19170.1| 60S ribosomal protein L18a [Pteropus alecto]
Length=212

 Score =   146 bits (369),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+ +LKK+KKS+G+++   ++FEK P +VKN+GIWLRY SR+G HNMY+E+RD T  GAV
Sbjct  83   FVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAV  142

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
             Q Y +M +RHR R H IQI+K   I A  C+R + KQFH+SKIKFPL  + +R   R+ 
Sbjct  143  TQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLR---RQH  199

Query  578  KTTYKASRPNIF  613
            K  +   RPN F
Sbjct  200  KPRFTTKRPNTF  211


 Score = 59.7 bits (143),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  52   SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEA  231
            S  D  +   ++ ++  +Y+VVGR LP+     P +YRM+++A N V AKS+FWYF  + 
Sbjct  28   SAVDAGLTPPLILFQLREYKVVGRCLPTPKCRTPPLYRMRIFAPNHVVAKSRFWYFVSQL  87

Query  232  EE  237
            ++
Sbjct  88   KK  89



>ref|XP_637982.2| S60 ribosomal protein L18a [Dictyostelium discoideum AX4]
 sp|Q54MK8.2|RL18A_DICDI RecName: Full=60S ribosomal protein L18a [Dictyostelium discoideum]
 gb|EAL64475.2| S60 ribosomal protein L18a [Dictyostelium discoideum AX4]
Length=171

 Score =   144 bits (362),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 91/132 (69%), Gaps = 5/132 (4%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL K+ K+KKS G++L + EIFE  P KVKN+G+++RY SR+G HN+YKE+RD T  GAV
Sbjct  43   FLSKIVKMKKSTGEILNVTEIFEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAV  102

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
             QMY EMASRH  R   I II    I A L +R +TKQFH+SKIKFPL  +       K 
Sbjct  103  SQMYDEMASRHSARESSIHIIDIKEIAASLTRRANTKQFHDSKIKFPLTHRIA-----KS  157

Query  578  KTTYKASRPNIF  613
            K+T+ A+RPN F
Sbjct  158  KSTFVANRPNTF  169


 Score = 62.4 bits (150),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
             H++QVVGR +P+E D +PKIYRM+L+A   + AKS+FWYF  +
Sbjct  3    IHEFQVVGRHVPTERDANPKIYRMRLFAQTSIHAKSRFWYFLSK  46



>emb|CCI45297.1| unnamed protein product [Albugo candida]
Length=1065

 Score =   144 bits (363),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL ++KK+KK+ G++L +NE+ EK    VKNYG+W+RY SR+G HNMYKE+RD TL GA+
Sbjct  405  FLHQVKKMKKTTGEILDVNELREKNNRIVKNYGVWIRYNSRSGTHNMYKEYRDITLCGAI  464

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            EQMY+E+A RHR R   IQI++TA + AK  K+ + KQFH+SKIKFPL  +  RP  +K 
Sbjct  465  EQMYSELAGRHRARPRSIQIMRTAILAAKDTKKPNIKQFHDSKIKFPLTHRIPRPHMKKF  524

Query  578  KTTY  589
              ++
Sbjct  525  HPSW  528


 Score = 62.0 bits (149),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  88   TYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            T    QYQV GR  P+E + +P IYRMKL+A NEV AKS+FWYF  + ++
Sbjct  362  TMPIRQYQVSGRKAPTEKEPNPPIYRMKLFAPNEVLAKSRFWYFLHQVKK  411



>ref|XP_004354799.1| hypothetical protein DFA_09450 [Dictyostelium fasciculatum]
 gb|EGG16415.1| hypothetical protein DFA_09450 [Dictyostelium fasciculatum]
Length=2079

 Score =   139 bits (349),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  218   FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
             FL K++K+KK+ GQ++ I +IFEK PT +KNYG+++RY SR+G HN+YKE+RDT+  GA+
Sbjct  1959  FLSKIQKMKKTTGQIINITQIFEKKPTTIKNYGVFIRYNSRSGTHNIYKEYRDTSRCGAI  2018

Query  398   EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPL  541
              QMY EMASRH  R   I II+   I A  CKR +TKQFH++ IKFPL
Sbjct  2019  AQMYDEMASRHSAREKSIHIIEIKQIAAAQCKRANTKQFHDAAIKFPL  2066


 Score = 67.0 bits (162),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  85    VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
             VT   ++YQVVGR +P+E D  PK+YRM+L+A  EV AKS+FWYF  + ++
Sbjct  1915  VTMAINEYQVVGRHVPTERDPQPKLYRMRLFAKTEVHAKSRFWYFLSKIQK  1965



>gb|KFH68950.1| 60S ribosomal protein L20 [Mortierella verticillata NRRL 6337]
Length=176

 Score =   139 bits (349),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+RKLKKVKK NG+++ INEI EK P ++KN+GIW+RY SR+G HNMYKE+R+ T N AV
Sbjct  44   FMRKLKKVKKVNGEIVGINEIHEKKPLQIKNFGIWIRYDSRSGTHNMYKEYRELTRNAAV  103

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E  Y++MASRHR R   IQII+ A +     +R   KQ     IKFPL  + +R   +  
Sbjct  104  EACYSDMASRHRARSRSIQIIRVAEVANADVRRPYIKQILVPGIKFPLPHRVIRAADKSH  163

Query  578  KTTYKASRPNIF  613
            +  +  SRP+ F
Sbjct  164  RALFMGSRPSTF  175


 Score = 66.6 bits (161),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            R H+YQ+VGR LP+E D  PK++RM+L+A NEV AKS+FWYF  + ++
Sbjct  3    RLHEYQLVGRHLPTEKDATPKLFRMRLFAPNEVIAKSRFWYFMRKLKK  50



>emb|CCA22335.1| 60S ribosomal protein L18a putative [Albugo laibachii Nc14]
Length=871

 Score =   143 bits (361),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 96/134 (72%), Gaps = 5/134 (4%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL ++KK+KK+ G++L +NE+ EK    VKNYG+W+RY SR+G HNMYKE+RD TL GAV
Sbjct  43   FLHQVKKMKKTTGEILDVNELREKNTRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLCGAV  102

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRP-----  562
            +QMY+E+A RHR R   IQI++TA + AK  K+ + KQFH+SKIKFPL  +  RP     
Sbjct  103  QQMYSELAGRHRARPRSIQIMRTAMLAAKDTKKPNIKQFHDSKIKFPLTHRIPRPHMKKF  162

Query  563  PSRKLKTTYKASRP  604
            PS+ +   +K  +P
Sbjct  163  PSKCILRLWKPLKP  176


 Score = 61.2 bits (147),  Expect(2) = 8e-44, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  103  QYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            QYQV GR  P+E + +P IYRMKL+A NEV AKS+FWYF  + ++
Sbjct  5    QYQVSGRKAPTEKEPNPPIYRMKLFAPNEVLAKSRFWYFLHQVKK  49



>gb|ELK32292.1| 60S ribosomal protein L18a [Myotis davidii]
Length=193

 Score =   146 bits (368),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+ +LKK+KKS+G+++   ++FEK P +VKN+GIWLRY SR+G HNMY+E+RD T  GAV
Sbjct  64   FVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAV  123

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
             Q Y +M +RHR R H IQI+K   I A  C+R + KQFH+SKIKFPL  + +R   R+ 
Sbjct  124  TQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLR---RQH  180

Query  578  KTTYKASRPNIF  613
            K  +   RPN F
Sbjct  181  KPRFTTKRPNTF  192


 Score = 58.2 bits (139),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  58   EDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            E+G ++   +  +  +Y+VVGR LP+     P +YRM+++A N V AKS+FWYF  + ++
Sbjct  11   EEGCLMGLSLRLQLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKK  70



>emb|CBN79653.1| ribosomal protein L18 [Ectocarpus siliculosus]
Length=238

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
             + +++K+KK+ G++L I E+ EK    +KNYGIWLRY SR+G HNMY+E+RD TL GAV
Sbjct  105  LMHQMRKMKKTTGEILDIVELTEKNARIIKNYGIWLRYDSRSGTHNMYREYRDLTLTGAV  164

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            +QMY+EMA RHR R   IQII+T  + AK  KR   +QFHN+ IKFPL  +  R P +K 
Sbjct  165  DQMYSEMAGRHRCRPRSIQIIRTGIVAAKDTKRPDVQQFHNANIKFPLTHRLPRAPKKKF  224

Query  578  KTTYKASRPNIFV  616
            +TT+KASRP  F+
Sbjct  225  RTTFKASRPTTFL  237


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 19/96 (20%)
 Frame = +1

Query  55   QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAE  234
            Q  G  + KMV  R  QYQVVGR   +E + +P +YRMK++A NEV   S+FWY   +  
Sbjct  53   QPHGIRLFKMVAMR--QYQVVGRKAVTEKEPNPPVYRMKVFAPNEVTGASQFWYLMHQMR  110

Query  235  ES*EKQWPGPRYQ*DI*EVPYQG*ELRDMVEVPEQN  342
            +   K+  G               E+ D+VE+ E+N
Sbjct  111  KM--KKTTG---------------EILDIVELTEKN  129



>gb|KFH68928.1| large subunit ribosomal protein L18Ae [Mortierella verticillata 
NRRL 6337]
Length=244

 Score =   139 bits (351),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            F+RKLKKVKK NG+++ INEI EK P ++KN+GIW+RY SR+G HNMYKE+R+ T N AV
Sbjct  112  FMRKLKKVKKVNGEIVGINEIHEKKPLQIKNFGIWIRYDSRSGTHNMYKEYRELTRNAAV  171

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
            E  Y++MASRHR R   IQII+ A +     +R   KQ     IKFPL  + +R   +  
Sbjct  172  EACYSDMASRHRARSRSIQIIRVAEVANADVRRPYIKQILVPGIKFPLPHRVIRAADKSH  231

Query  578  KTTYKASRPNIF  613
            +  +  SRP+ F
Sbjct  232  RALFMGSRPSTF  243


 Score = 63.9 bits (154),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEE  228
             H+YQ+VGR LP+E D  PK++RM+L+A NEV AKS+FWYF  +
Sbjct  72   LHEYQLVGRHLPTEKDATPKLFRMRLFAPNEVIAKSRFWYFMRK  115



>gb|EPZ32213.1| 60S ribosomal protein L20-B [Rozella allomycis CSF55]
Length=178

 Score =   144 bits (364),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  218  FLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  397
            FL+KLKKVKK+NG+++A+NEIFEK P +VKNYGIWLRY SRTG HNMYKE+R+ +   AV
Sbjct  46   FLQKLKKVKKANGEIVAVNEIFEKRPNQVKNYGIWLRYDSRTGTHNMYKEYREMSRVDAV  105

Query  398  EQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKL  577
               Y +MASRHR R   IQIIK   I     +R   KQ     +KFPL  +  R PSR+ 
Sbjct  106  HSCYQDMASRHRARFRSIQIIKVEEIANSDVRRPYIKQLLEPGLKFPLPHRVYRAPSRRY  165

Query  578  KTTYKASRPNIF  613
            K  + A RP+ F
Sbjct  166  KKLFVAHRPSTF  177


 Score = 59.3 bits (142),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFFEEAEE  237
            M   ++H+YQ++GR LP+  +  P++Y+M+++A NEV  KS+FWYF ++ ++
Sbjct  1    MTESKYHEYQIIGRKLPTAAEPVPRLYKMRVFAKNEVVGKSRFWYFLQKLKK  52



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060