BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF027B22

Length=446
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011074970.1|  PREDICTED: elongation factor 1-gamma-like          223   4e-68   Sesamum indicum [beniseed]
emb|CBI39244.3|  unnamed protein product                                210   3e-66   Vitis vinifera
gb|AGJ83736.1|  elongation factor 1-gamma-like protein                  211   8e-66   Caragana korshinskii
ref|XP_006647077.1|  PREDICTED: elongation factor 1-gamma 2-like        211   2e-63   Oryza brachyantha
emb|CDP10743.1|  unnamed protein product                                211   2e-63   Coffea canephora [robusta coffee]
gb|EYU28215.1|  hypothetical protein MIMGU_mgv1a007176mg                210   4e-63   Erythranthe guttata [common monkey flower]
ref|XP_009610261.1|  PREDICTED: elongation factor 1-gamma 2-like ...    210   5e-63   Nicotiana tomentosiformis
emb|CBI29689.3|  unnamed protein product                                202   6e-63   Vitis vinifera
ref|XP_002278756.2|  PREDICTED: elongation factor 1-gamma               209   1e-62   Vitis vinifera
ref|XP_006339362.1|  PREDICTED: elongation factor 1-gamma 2-like ...    209   1e-62   Solanum tuberosum [potatoes]
ref|XP_007041182.1|  Elongation factor 1-gamma 3 isoform 2              206   1e-62   
ref|XP_004250641.1|  PREDICTED: elongation factor 1-gamma 2-like ...    209   1e-62   Solanum lycopersicum
ref|NP_001046318.1|  Os02g0220600                                       209   1e-62   
ref|XP_010686883.1|  PREDICTED: elongation factor 1-gamma-like          208   2e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007222556.1|  hypothetical protein PRUPE_ppa006233mg             208   2e-62   
ref|XP_008219063.1|  PREDICTED: elongation factor 1-gamma-like          208   3e-62   Prunus mume [ume]
ref|XP_009774948.1|  PREDICTED: elongation factor 1-gamma 2-like ...    208   3e-62   Nicotiana sylvestris
ref|XP_004240589.1|  PREDICTED: elongation factor 1-gamma 2-like        207   4e-62   Solanum lycopersicum
ref|XP_007041183.1|  Elongation factor 1-gamma 3 isoform 3              205   4e-62   
gb|ACB72462.1|  elongation factor 1 gamma-like protein                  207   4e-62   Nicotiana tabacum [American tobacco]
ref|XP_009759974.1|  PREDICTED: elongation factor 1-gamma 2-like ...    207   6e-62   Nicotiana sylvestris
ref|XP_002451782.1|  hypothetical protein SORBIDRAFT_04g007760          207   6e-62   Sorghum bicolor [broomcorn]
sp|Q6YW46.2|EF1G2_ORYSJ  RecName: Full=Elongation factor 1-gamma ...    207   9e-62   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046317.1|  Os02g0220500                                       207   9e-62   
gb|ACA50518.1|  elongation factor 1-gamma                               207   9e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009417204.1|  PREDICTED: elongation factor 1-gamma 2-like        206   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009610260.1|  PREDICTED: elongation factor 1-gamma 2-like ...    206   2e-61   Nicotiana tomentosiformis
ref|XP_003563720.1|  PREDICTED: elongation factor 1-gamma 3             206   3e-61   Brachypodium distachyon [annual false brome]
gb|KJB47886.1|  hypothetical protein B456_008G046300                    202   4e-61   Gossypium raimondii
ref|XP_004250642.1|  PREDICTED: elongation factor 1-gamma 2-like ...    204   7e-61   Solanum lycopersicum
ref|XP_011099002.1|  PREDICTED: elongation factor 1-gamma 2-like        204   8e-61   Sesamum indicum [beniseed]
ref|XP_007041181.1|  Elongation factor 1-gamma 3 isoform 1              204   9e-61   Theobroma cacao [chocolate]
ref|XP_006385057.1|  elongation factor 1-gamma 1 family protein         204   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_010928857.1|  PREDICTED: elongation factor 1-gamma 2             204   1e-60   Elaeis guineensis
gb|KJB47897.1|  hypothetical protein B456_008G046200                    204   1e-60   Gossypium raimondii
ref|XP_009774942.1|  PREDICTED: elongation factor 1-gamma 2-like ...    204   1e-60   Nicotiana sylvestris
ref|XP_008677347.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    204   1e-60   
gb|ADR70876.1|  eukaryotic translation elongation factor 1B gamma...    204   2e-60   Hevea brasiliensis [jebe]
ref|XP_004294500.1|  PREDICTED: elongation factor 1-gamma-like          203   2e-60   Fragaria vesca subsp. vesca
ref|XP_009418787.1|  PREDICTED: elongation factor 1-gamma 2-like        203   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009759973.1|  PREDICTED: elongation factor 1-gamma 2-like ...    203   3e-60   Nicotiana sylvestris
ref|XP_006339363.1|  PREDICTED: elongation factor 1-gamma 2-like ...    203   3e-60   Solanum tuberosum [potatoes]
gb|KDO42761.1|  hypothetical protein CISIN_1g014592mg                   199   5e-60   Citrus sinensis [apfelsine]
ref|XP_004951452.1|  PREDICTED: elongation factor 1-gamma 2-like        202   8e-60   Setaria italica
ref|XP_006656177.1|  PREDICTED: elongation factor 1-gamma 3-like        201   1e-59   
ref|XP_008643919.1|  PREDICTED: uncharacterized protein LOC100381...    201   1e-59   
ref|NP_001151229.1|  elongation factor 1-gamma 2                        201   1e-59   Zea mays [maize]
emb|CAN75785.1|  hypothetical protein VITISV_021574                     201   2e-59   Vitis vinifera
ref|XP_002264400.1|  PREDICTED: elongation factor 1-gamma-like          201   2e-59   Vitis vinifera
ref|XP_009353791.1|  PREDICTED: elongation factor 1-gamma               201   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_011028370.1|  PREDICTED: elongation factor 1-gamma 2-like        201   2e-59   Populus euphratica
ref|XP_010272550.1|  PREDICTED: elongation factor 1-gamma-like is...    202   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_003571724.1|  PREDICTED: elongation factor 1-gamma 2             201   2e-59   Brachypodium distachyon [annual false brome]
gb|AFW76479.1|  elongation factor gamma1                                197   3e-59   
ref|XP_008339412.1|  PREDICTED: elongation factor 1-gamma               200   3e-59   
ref|XP_006478210.1|  PREDICTED: elongation factor 1-gamma-like          200   4e-59   Citrus sinensis [apfelsine]
ref|XP_008804357.1|  PREDICTED: elongation factor 1-gamma 2-like        201   4e-59   Phoenix dactylifera
ref|XP_010272551.1|  PREDICTED: elongation factor 1-gamma-like is...    200   5e-59   Nelumbo nucifera [Indian lotus]
ref|XP_008339178.1|  PREDICTED: elongation factor 1-gamma-like          197   6e-59   
gb|KJB47883.1|  hypothetical protein B456_008G046300                    199   6e-59   Gossypium raimondii
ref|XP_011047878.1|  PREDICTED: elongation factor 1-gamma               199   6e-59   Populus euphratica
gb|ABA81876.1|  unknown                                                 199   7e-59   Solanum tuberosum [potatoes]
gb|EMT20600.1|  Elongation factor 1-gamma 2                             199   1e-58   
ref|XP_006431568.1|  hypothetical protein CICLE_v10003566mg             199   1e-58   Citrus clementina [clementine]
gb|KDO42759.1|  hypothetical protein CISIN_1g014592mg                   199   1e-58   Citrus sinensis [apfelsine]
ref|XP_010242290.1|  PREDICTED: elongation factor 1-gamma-like          198   2e-58   Nelumbo nucifera [Indian lotus]
sp|Q9FUM1.1|EF1G_PRUAV  RecName: Full=Elongation factor 1-gamma; ...    198   2e-58   Prunus avium [gean]
gb|KHG04277.1|  hypothetical protein F383_29497                         198   2e-58   Gossypium arboreum [tree cotton]
gb|KHG12420.1|  hypothetical protein F383_17048                         198   2e-58   Gossypium arboreum [tree cotton]
ref|XP_006494223.1|  PREDICTED: elongation factor 1-gamma 3-like ...    198   2e-58   Citrus sinensis [apfelsine]
gb|EYU22759.1|  hypothetical protein MIMGU_mgv1a007114mg                197   3e-58   Erythranthe guttata [common monkey flower]
ref|XP_008789739.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    197   4e-58   Phoenix dactylifera
ref|XP_009362385.1|  PREDICTED: elongation factor 1-gamma-like          197   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_004966045.1|  PREDICTED: elongation factor 1-gamma 3-like        197   5e-58   Setaria italica
ref|XP_006441587.1|  hypothetical protein CICLE_v10020303mg             197   6e-58   Citrus clementina [clementine]
gb|EMS60520.1|  Elongation factor 1-gamma 2                             197   6e-58   Triticum urartu
ref|NP_001057916.1|  Os06g0571400                                       196   1e-57   
gb|ACJ84952.1|  unknown                                                 191   1e-57   Medicago truncatula
gb|ACG36145.1|  elongation factor 1-gamma 3                             196   1e-57   Zea mays [maize]
ref|XP_008647353.1|  PREDICTED: uncharacterized protein LOC100192...    196   1e-57   
ref|XP_007222927.1|  hypothetical protein PRUPE_ppa005220mg             197   1e-57   Prunus persica
ref|XP_002325529.1|  hypothetical protein POPTR_0019s10560g             196   1e-57   Populus trichocarpa [western balsam poplar]
gb|ADB11388.1|  gamma class glutathione transferase EF1Bgamma3          196   1e-57   Populus trichocarpa [western balsam poplar]
gb|EAZ37421.1|  hypothetical protein OsJ_21756                          196   1e-57   Oryza sativa Japonica Group [Japonica rice]
gb|AAO72574.1|  elongation factor 1 gamma-like protein                  196   2e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002438602.1|  hypothetical protein SORBIDRAFT_10g022570          196   2e-57   Sorghum bicolor [broomcorn]
ref|XP_010030200.1|  PREDICTED: elongation factor 1-gamma               195   2e-57   Eucalyptus grandis [rose gum]
ref|NP_001148829.1|  elongation factor 1-gamma 3                        195   2e-57   Zea mays [maize]
gb|EEC80835.1|  hypothetical protein OsI_23436                          196   2e-57   Oryza sativa Indica Group [Indian rice]
gb|EEE56572.1|  hypothetical protein OsJ_05923                          196   3e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010683294.1|  PREDICTED: elongation factor 1-gamma 2-like        195   3e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011031541.1|  PREDICTED: elongation factor 1-gamma-like          194   5e-57   Populus euphratica
ref|XP_006389499.1|  elongation factor 1-gamma 1 family protein         194   1e-56   
gb|EEC72757.1|  hypothetical protein OsI_06402                          195   1e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_004966044.1|  PREDICTED: elongation factor 1-gamma 3-like        193   1e-56   Setaria italica
ref|XP_008352808.1|  PREDICTED: elongation factor 1-gamma-like          192   3e-56   
ref|XP_008218696.1|  PREDICTED: elongation factor 1-gamma               192   3e-56   Prunus mume [ume]
gb|AIZ68134.1|  translation elongation factor 1-gamma                   192   4e-56   Ornithogalum longebracteatum [sea-onion]
ref|XP_008365338.1|  PREDICTED: elongation factor 1-gamma-like          189   5e-56   
gb|AGC13156.1|  EF1Bgamma class glutathione S-transferase               185   1e-55   Pinus tabuliformis [southern Chinese pine]
gb|AFW76477.1|  elongation factor gamma1                                187   2e-55   
gb|AAO72563.1|  elongation factor 1 gamma-like protein                  190   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004300001.1|  PREDICTED: elongation factor 1-gamma-like          190   3e-55   Fragaria vesca subsp. vesca
gb|AHZ94964.1|  elongation factor 1                                     189   4e-55   Lilium regale
ref|XP_003540135.1|  PREDICTED: elongation factor 1-gamma-like          189   4e-55   
gb|ACU24584.1|  unknown                                                 189   5e-55   Glycine max [soybeans]
ref|XP_011470423.1|  PREDICTED: elongation factor 1-gamma-like is...    190   6e-55   Fragaria vesca subsp. vesca
gb|KEH32762.1|  translation elongation factor EF1B, gamma chain         189   7e-55   Medicago truncatula
ref|XP_009355338.1|  PREDICTED: elongation factor 1-gamma               188   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_009388887.1|  PREDICTED: elongation factor 1-gamma 2-like        184   2e-54   
gb|KDP42461.1|  hypothetical protein JCGZ_00258                         187   3e-54   Jatropha curcas
ref|NP_001241223.1|  uncharacterized protein LOC100787125               187   4e-54   Glycine max [soybeans]
gb|ABK25057.1|  unknown                                                 187   5e-54   Picea sitchensis
gb|AHC03515.1|  gamma class glutathione S-transferase                   186   7e-54   Larix kaempferi [karamatsu]
ref|XP_006845799.1|  hypothetical protein AMTR_s00019p00255470          186   9e-54   
ref|XP_004308137.1|  PREDICTED: elongation factor 1-gamma-like is...    186   1e-53   Fragaria vesca subsp. vesca
ref|XP_010907209.1|  PREDICTED: elongation factor 1-gamma 2-like        185   2e-53   Elaeis guineensis
gb|KHN03584.1|  Elongation factor 1-gamma                               185   3e-53   Glycine soja [wild soybean]
ref|XP_006600242.1|  PREDICTED: elongation factor 1-gamma isoform X1    185   3e-53   
ref|XP_008456982.1|  PREDICTED: elongation factor 1-gamma-like          185   3e-53   Cucumis melo [Oriental melon]
ref|XP_010101278.1|  Elongation factor 1-gamma                          184   1e-52   
gb|AGC13144.1|  EF1Bgamma class glutathione S-transferase               183   2e-52   Pinus tabuliformis [southern Chinese pine]
ref|NP_001235707.1|  elongation factor 1-gamma                          182   2e-52   
ref|XP_010553691.1|  PREDICTED: probable elongation factor 1-gamma 2    181   5e-52   Tarenaya hassleriana [spider flower]
ref|XP_010414808.1|  PREDICTED: probable elongation factor 1-gamma 2    176   5e-52   Camelina sativa [gold-of-pleasure]
ref|NP_001242737.1|  uncharacterized protein LOC100810452               181   8e-52   
gb|KHN40193.1|  Elongation factor 1-gamma                               181   8e-52   Glycine soja [wild soybean]
ref|XP_008218698.1|  PREDICTED: elongation factor 1-gamma-like          181   9e-52   Prunus mume [ume]
ref|XP_006392370.1|  hypothetical protein EUTSA_v10023493mg             180   2e-51   Eutrema salsugineum [saltwater cress]
ref|XP_004485430.1|  PREDICTED: elongation factor 1-gamma-like is...    179   3e-51   Cicer arietinum [garbanzo]
dbj|BAH56923.1|  AT1G57720                                              178   4e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59587.1|  putative elongation factor 1B gamma                     178   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176084.1|  elongation factor EF-1 gamma subunit                  178   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544111.1|  PREDICTED: probable elongation factor 1-gamma 2    177   1e-50   Tarenaya hassleriana [spider flower]
gb|EMT01475.1|  Elongation factor 1-gamma 2                             181   2e-50   
ref|XP_002892012.1|  hypothetical protein ARALYDRAFT_474857             177   2e-50   
ref|XP_007153909.1|  hypothetical protein PHAVU_003G075200g             177   2e-50   Phaseolus vulgaris [French bean]
ref|NP_001274793.1|  elongation factor 1-gamma 2-like                   177   2e-50   Solanum tuberosum [potatoes]
ref|XP_010511351.1|  PREDICTED: probable elongation factor 1-gamma 2    177   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010470318.1|  PREDICTED: probable elongation factor 1-gamma 2    175   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008365322.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    175   2e-49   
gb|EPS67955.1|  elongation factor 1 gamma-like protein                  174   3e-49   Genlisea aurea
ref|XP_006302321.1|  hypothetical protein CARUB_v10020374mg             174   4e-49   Capsella rubella
ref|XP_003592902.1|  Elongation factor 1-gamma                          172   1e-48   
ref|XP_003592901.1|  Elongation factor 1-gamma                          172   1e-48   Medicago truncatula
emb|CDY22629.1|  BnaC08g42630D                                          172   2e-48   Brassica napus [oilseed rape]
ref|NP_001184949.1|  elongation factor EF-1 gamma subunit               168   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118302.1|  PREDICTED: probable elongation factor 1-gamma 1    172   2e-48   Brassica rapa
ref|XP_008452241.1|  PREDICTED: elongation factor 1-gamma-like          171   3e-48   Cucumis melo [Oriental melon]
ref|XP_002889762.1|  hypothetical protein ARALYDRAFT_471063             171   5e-48   
gb|AFK34308.1|  unknown                                                 171   5e-48   Medicago truncatula
emb|CDY06365.1|  BnaA09g48380D                                          171   6e-48   
ref|XP_006417552.1|  hypothetical protein EUTSA_v10007759mg             170   9e-48   Eutrema salsugineum [saltwater cress]
ref|XP_001758671.1|  predicted protein                                  169   3e-47   
ref|XP_004172027.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    167   4e-47   
emb|CDY20681.1|  BnaC08g13770D                                          171   6e-47   Brassica napus [oilseed rape]
gb|ACJ85171.1|  unknown                                                 168   6e-47   Medicago truncatula
ref|XP_010490215.1|  PREDICTED: probable elongation factor 1-gamma 1    168   7e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010458260.1|  PREDICTED: probable elongation factor 1-gamma 1    167   8e-47   Camelina sativa [gold-of-pleasure]
gb|KGN56266.1|  hypothetical protein Csa_3G110630                       167   8e-47   
ref|XP_004133719.1|  PREDICTED: elongation factor 1-gamma-like          167   1e-46   
ref|NP_563848.1|  elongation factor EF-1 gamma subunit                  167   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KGN56265.1|  hypothetical protein Csa_3G110620                       166   1e-46   
ref|XP_004134257.1|  PREDICTED: elongation factor 1-gamma-like          166   1e-46   
gb|KEH34076.1|  translation elongation factor EF1B, gamma chain         167   2e-46   Medicago truncatula
ref|XP_009110814.1|  PREDICTED: probable elongation factor 1-gamma 1    166   5e-46   Brassica rapa
ref|XP_004155227.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    165   8e-46   
emb|CDY31074.1|  BnaA08g26240D                                          165   9e-46   Brassica napus [oilseed rape]
ref|XP_007148576.1|  hypothetical protein PHAVU_006G220100g             165   1e-45   Phaseolus vulgaris [French bean]
ref|XP_010475804.1|  PREDICTED: probable elongation factor 1-gamm...    164   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010475805.1|  PREDICTED: probable elongation factor 1-gamm...    164   2e-45   
ref|XP_001771013.1|  predicted protein                                  164   4e-45   
ref|XP_008452240.1|  PREDICTED: elongation factor 1-gamma-like          162   1e-44   Cucumis melo [Oriental melon]
ref|XP_006307657.1|  hypothetical protein CARUB_v10009284mg             160   6e-44   Capsella rubella
emb|CDX93494.1|  BnaA06g05540D                                          155   5e-42   
ref|XP_009148264.1|  PREDICTED: probable elongation factor 1-gamma 1    154   7e-42   Brassica rapa
emb|CDY50887.1|  BnaCnng19790D                                          154   2e-41   Brassica napus [oilseed rape]
gb|KDO42760.1|  hypothetical protein CISIN_1g014592mg                   152   3e-41   Citrus sinensis [apfelsine]
ref|XP_008789740.1|  PREDICTED: elongation factor 1-gamma 1 isofo...    152   3e-41   
ref|XP_002984514.1|  hypothetical protein SELMODRAFT_156635             151   1e-40   Selaginella moellendorffii
gb|KEH32761.1|  translation elongation factor EF1B, gamma chain         149   4e-40   Medicago truncatula
gb|AFW76480.1|  elongation factor gamma1                                148   1e-39   
ref|XP_002973046.1|  hypothetical protein SELMODRAFT_98733              148   2e-39   
gb|AFW87006.1|  hypothetical protein ZEAMMB73_710904                    146   5e-39   
ref|XP_006841161.1|  hypothetical protein AMTR_s00086p00155150          129   5e-35   Amborella trichopoda
ref|XP_008867564.1|  hypothetical protein H310_04829                    135   9e-35   Aphanomyces invadans
ref|XP_009825362.1|  hypothetical protein H257_03107                    132   2e-33   Aphanomyces astaci
ref|XP_008605170.1|  hypothetical protein SDRG_01423                    131   2e-33   Saprolegnia diclina VS20
ref|XP_006828297.1|  hypothetical protein AMTR_s00023p00230860          118   4e-31   
ref|XP_005645852.1|  glutathione S-transferase                          120   4e-29   Coccomyxa subellipsoidea C-169
ref|XP_001774148.1|  predicted protein                                  117   3e-28   
ref|XP_009041108.1|  hypothetical protein AURANDRAFT_39051              117   4e-28   Aureococcus anophagefferens
ref|XP_009040775.1|  hypothetical protein AURANDRAFT_70385              117   4e-28   Aureococcus anophagefferens
emb|CBJ27519.1|  eukaryotic elongation factor-1 B gamma                 114   4e-27   Ectocarpus siliculosus
ref|XP_009519315.1|  hypothetical protein PHYSODRAFT_284839             109   2e-25   Phytophthora sojae
emb|CCA15330.1|  calciumdependent protein 1 putative                    107   9e-25   Albugo laibachii Nc14
gb|ETM49731.1|  hypothetical protein L914_06086                         103   1e-24   Phytophthora parasitica
gb|KDO34814.1|  hypothetical protein SPRG_00875                         107   1e-24   Saprolegnia parasitica CBS 223.65
ref|XP_004353907.1|  glutathione S-transferase domain-containing ...    107   1e-24   Cavenderia fasciculata
gb|ETP47818.1|  hypothetical protein F442_06319                         103   1e-24   Phytophthora parasitica P10297
gb|ETI50110.1|  hypothetical protein F443_06278                         103   1e-24   Phytophthora parasitica P1569
emb|CCI44608.1|  unnamed protein product                                107   2e-24   Albugo candida
gb|ETI50094.1|  hypothetical protein F443_06281                         103   2e-24   Phytophthora parasitica P1569
gb|ETO78833.1|  hypothetical protein F444_06337                         103   2e-24   Phytophthora parasitica P1976
gb|ETK89985.1|  hypothetical protein L915_06155                         103   3e-24   Phytophthora parasitica
ref|XP_002901767.1|  elongation factor 1-gamma, putative                105   4e-24   Phytophthora infestans T30-4
gb|ETM49723.1|  hypothetical protein L914_06088                         103   6e-24   Phytophthora parasitica
ref|XP_008891716.1|  hypothetical protein PPTG_02396                    103   8e-24   Phytophthora parasitica INRA-310
ref|XP_009519320.1|  hypothetical protein PHYSODRAFT_359164             104   1e-23   Phytophthora sojae
ref|XP_004341586.1|  elongation factor 1-gamma family protein           103   2e-23   Acanthamoeba castellanii str. Neff
ref|XP_002901771.1|  elongation factor 1-gamma, putative                103   3e-23   Phytophthora infestans T30-4
gb|ETL96570.1|  hypothetical protein L917_05968                         102   4e-23   Phytophthora parasitica
gb|ETL96579.1|  hypothetical protein L917_05965                         102   5e-23   Phytophthora parasitica
gb|ETP19871.1|  hypothetical protein F441_06281                         102   7e-23   Phytophthora parasitica CJ01A1
gb|ETK89994.1|  hypothetical protein L915_06152                         102   7e-23   Phytophthora parasitica
ref|XP_005707114.1|  elongation factor EF-1 gamma subunit               104   1e-22   Galdieria sulphuraria
ref|XP_008891718.1|  hypothetical protein PPTG_02398                    101   1e-22   Phytophthora parasitica INRA-310
gb|EFA79702.1|  glutathione S-transferase domain-containing protein     101   1e-22   Heterostelium album PN500
gb|EWM21126.1|  elongation factor 1                                     100   6e-22   Nannochloropsis gaditana
emb|CBK21757.2|  unnamed protein product                              99.0    1e-21   Blastocystis hominis
ref|XP_005760139.1|  hypothetical protein EMIHUDRAFT_438506           94.7    5e-21   Emiliania huxleyi CCMP1516
dbj|GAM21220.1|  hypothetical protein SAMD00019534_043950             95.5    3e-20   Acytostelium subglobosum LB1
sp|P12261.3|EF1G_ARTSA  RecName: Full=Elongation factor 1-gamma; ...  94.7    6e-20   Artemia salina
ref|NP_001083003.1|  uncharacterized protein LOC100037382             94.4    7e-20   Danio rerio [leopard danio]
ref|XP_005988901.1|  PREDICTED: elongation factor 1-gamma-like        94.0    1e-19   
ref|XP_003292098.1|  hypothetical protein DICPUDRAFT_156785           93.6    1e-19   Dictyostelium purpureum
ref|XP_007056947.1|  PREDICTED: elongation factor 1-gamma             93.6    1e-19   Chelonia mydas [green seaturtle]
ref|XP_006113632.1|  PREDICTED: elongation factor 1-gamma             93.2    2e-19   Pelodiscus sinensis [Chinese softshell turtle]
gb|ADV40141.1|  elongation factor-1 gamma                             91.7    3e-19   Latrodectus hesperus [black widow]
ref|XP_007439957.1|  PREDICTED: elongation factor 1-gamma-like is...  92.8    3e-19   Python bivittatus
ref|XP_011334294.1|  PREDICTED: elongation factor 1-gamma             92.4    4e-19   
ref|XP_008172336.1|  PREDICTED: elongation factor 1-gamma             91.3    9e-19   Chrysemys picta bellii
gb|EMP38506.1|  Elongation factor 1-gamma                             92.4    9e-19   Chelonia mydas [green seaturtle]
ref|XP_001733005.1|  glutathione S-transferase domain-containing ...  90.9    1e-18   Dictyostelium discoideum AX4
gb|EPB85278.1|  hypothetical protein HMPREF1544_07959                 90.9    1e-18   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_003290965.1|  hypothetical protein DICPUDRAFT_49566            90.9    1e-18   Dictyostelium purpureum
gb|EFZ22579.1|  hypothetical protein SINV_13881                       90.9    1e-18   
ref|XP_011162880.1|  PREDICTED: elongation factor 1-gamma             90.9    1e-18   Solenopsis invicta [imported red fire ant]
gb|AJD25298.1|  elongation factor-1 gamma-like protein                89.7    1e-18   Plectreurys tristis
emb|CEI89465.1|  hypothetical protein RMCBS344292_03820               90.5    1e-18   Rhizopus microsporus
ref|XP_006271018.1|  PREDICTED: elongation factor 1-gamma-like        90.9    2e-18   
emb|CEG74026.1|  hypothetical protein RMATCC62417_09299               90.5    2e-18   Rhizopus microsporus
emb|CEI97373.1|  hypothetical protein RMCBS344292_11508               90.5    2e-18   Rhizopus microsporus
ref|XP_006033236.1|  PREDICTED: elongation factor 1-gamma isoform X1  90.5    2e-18   
gb|ACJ12080.1|  translation elongation factor EF-1 gamma              90.1    2e-18   Bombina orientalis [Oriental fire-bellied toad]
gb|EFN62393.1|  Elongation factor 1-gamma                             92.4    3e-18   Camponotus floridanus
ref|XP_011428586.1|  PREDICTED: elongation factor 1-gamma-like        88.6    3e-18   
ref|XP_011068058.1|  PREDICTED: elongation factor 1-gamma             89.7    3e-18   Acromyrmex echinatior
gb|ABS57446.1|  elongation factor 1 gamma                             87.0    4e-18   Heliconius melpomene [common postman]
gb|ABB02642.1|  unknown                                               86.3    4e-18   Solanum tuberosum [potatoes]
ref|XP_007943079.1|  PREDICTED: elongation factor 1-gamma             89.7    4e-18   Orycteropus afer afer
ref|XP_003487839.1|  PREDICTED: hypothetical protein LOC100743133     91.7    5e-18   
ref|XP_011152520.1|  PREDICTED: elongation factor 1-gamma             89.4    5e-18   Harpegnathos saltator
ref|XP_003399098.1|  PREDICTED: hypothetical protein LOC100647544     91.7    5e-18   
ref|XP_011264946.1|  PREDICTED: elongation factor 1-gamma             89.4    6e-18   Camponotus floridanus
ref|XP_003229963.2|  PREDICTED: elongation factor 1-gamma             89.4    6e-18   Anolis carolinensis [Carolina anole]
ref|XP_008557385.1|  PREDICTED: elongation factor 1-gamma             89.0    7e-18   Microplitis demolitor
dbj|BAE93064.1|  eukaryotic elongation factor 1 gamma                 88.6    7e-18   Lethenteron camtschaticum [Japanese lamprey]
gb|ELK23445.1|  Elongation factor 1-gamma                             89.0    8e-18   Myotis davidii
ref|XP_006566786.1|  PREDICTED: elongation factor 1-gamma-like        88.6    8e-18   
gb|EGV92764.1|  Elongation factor 1-gamma                             85.1    8e-18   Cricetulus griseus [Chinese hamsters]
gb|EKC22737.1|  Elongation factor 1-gamma                             86.7    1e-17   
ref|XP_006891385.1|  PREDICTED: elongation factor 1-gamma-like        85.1    1e-17   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|ETE60028.1|  Elongation factor 1-gamma                             88.2    1e-17   Ophiophagus hannah
ref|XP_002178302.1|  predicted protein                                87.8    2e-17   Phaeodactylum tricornutum CCAP 1055/1
gb|KDR22664.1|  Elongation factor 1-gamma                             87.8    2e-17   Zootermopsis nevadensis
dbj|BAC56425.1|  similar to elongation factor-1-gamma                 84.7    2e-17   Bos taurus [bovine]
ref|XP_002259965.1|  elongation factor 1-gamma                        87.4    2e-17   Plasmodium knowlesi strain H
ref|XP_011505224.1|  PREDICTED: elongation factor 1-gamma             87.0    2e-17   Ceratosolen solmsi marchali
ref|XP_002072116.1|  GK22492                                          85.9    2e-17   
dbj|BAG61726.1|  unnamed protein product                              84.3    3e-17   Homo sapiens [man]
ref|XP_008210112.1|  PREDICTED: elongation factor 1-gamma             87.4    3e-17   Nasonia vitripennis
gb|EHH56151.1|  hypothetical protein EGM_05506                        87.4    3e-17   Macaca fascicularis [crab eating macaque]
dbj|BAC56510.1|  similar to elongation factor 1 gamma                 84.3    3e-17   Bos taurus [bovine]
dbj|BAC56575.1|  similar to elongation factor-1-gamma                 84.7    3e-17   Bos taurus [bovine]
ref|XP_006109995.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  87.4    3e-17   Myotis lucifugus
ref|XP_006772813.1|  PREDICTED: elongation factor 1-gamma             87.0    4e-17   Myotis davidii
ref|XP_005857534.1|  PREDICTED: elongation factor 1-gamma             87.0    4e-17   Myotis brandtii
dbj|BAG62369.1|  unnamed protein product                              84.7    4e-17   Homo sapiens [man]
ref|XP_003700610.1|  PREDICTED: uncharacterized protein LOC100878621  89.0    4e-17   
gb|ABG88952.1|  elongation factor-1 gamma                             86.7    4e-17   
dbj|BAB29238.3|  unnamed protein product                              84.7    4e-17   
gb|EPQ02217.1|  Elongation factor 1-gamma                             87.0    5e-17   
dbj|GAN05559.1|  hypothetical protein MAM1_0095c05030                 85.1    5e-17   
gb|AAY67988.1|  EF1                                                   82.4    5e-17   
gb|EPB91935.1|  hypothetical protein HMPREF1544_01229                 86.3    5e-17   
ref|XP_011312957.1|  PREDICTED: elongation factor 1-gamma             86.3    5e-17   
emb|CDR15964.1|  elongation factor 1-gamma, putative                  86.3    6e-17   
emb|CCQ18584.1|  Translation elongation factor EF-1 gamma             86.3    6e-17   
dbj|BAE88257.1|  unnamed protein product                              84.3    7e-17   
dbj|BAB27948.1|  unnamed protein product                              84.3    7e-17   
ref|XP_010954720.1|  PREDICTED: elongation factor 1-gamma             85.9    8e-17   
ref|XP_001996097.1|  GH14004                                          85.9    9e-17   
ref|NP_001036852.1|  elongation factor 1 gamma                        85.9    9e-17   
ref|XP_001014085.1|  Glutathione S-transferase, N-terminal domain...  85.5    1e-16   
gb|EAW74023.1|  eukaryotic translation elongation factor 1 gamma,...  84.3    1e-16   
ref|XP_006039986.1|  PREDICTED: elongation factor 1-gamma-like        84.0    1e-16   
ref|XP_008158973.1|  PREDICTED: elongation factor 1-gamma             85.5    1e-16   
emb|CDS12960.1|  hypothetical protein LRAMOSA05144                    85.1    1e-16   
gb|KFH74042.1|  hypothetical protein MVEG_01255                       85.1    1e-16   
ref|NP_001079766.1|  elongation factor 1-gamma-A                      85.5    1e-16   
sp|P26642.1|EF1GA_XENLA  RecName: Full=Elongation factor 1-gamma-...  85.5    1e-16   
gb|AAB29957.1|  elongation factor 1 gamma                             85.5    1e-16   
ref|XP_002000755.1|  GI22348                                          85.1    1e-16   
ref|XP_001119776.2|  PREDICTED: elongation factor 1-gamma             84.3    2e-16   
ref|XP_003508788.1|  PREDICTED: elongation factor 1-gamma             85.1    2e-16   
gb|EAW74024.1|  eukaryotic translation elongation factor 1 gamma,...  84.3    2e-16   
ref|XP_003798774.1|  PREDICTED: elongation factor 1-gamma             84.3    2e-16   
ref|XP_006181822.1|  PREDICTED: elongation factor 1-gamma             85.1    2e-16   
ref|XP_006730446.1|  PREDICTED: elongation factor 1-gamma             84.3    2e-16   
gb|EAW74026.1|  eukaryotic translation elongation factor 1 gamma,...  84.7    3e-16   
gb|ERE79389.1|  elongation factor 1-gamma                             84.7    3e-16   
ref|XP_005063341.1|  PREDICTED: uncharacterized protein LOC101830470  85.1    3e-16   
ref|XP_004413812.1|  PREDICTED: elongation factor 1-gamma             84.7    3e-16   
ref|XP_006875070.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_004264257.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_010383201.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_004682779.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
gb|AAL23895.1|  elongation factor-like protein                        84.3    3e-16   
ref|XP_007110004.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_007174472.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|NP_001395.1|  elongation factor 1-gamma                           84.3    3e-16   
ref|XP_006214925.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|NP_001095173.1|  elongation factor 1-gamma                        84.3    3e-16   
ref|XP_004621561.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|NP_080283.3|  elongation factor 1-gamma                           84.3    3e-16   
ref|XP_005331561.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_005351981.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_004383908.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_003920279.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_003419695.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_002925414.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_008705722.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_004065457.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...  84.3    3e-16   
ref|NP_001182509.1|  eukaryotic translation elongation factor 1 g...  84.3    3e-16   
gb|AAP36704.1|  Homo sapiens eukaryotic translation elongation fa...  84.3    3e-16   
ref|XP_007993749.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_005904892.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_003828537.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|NP_001289353.1|  elongation factor 1-gamma                        84.3    3e-16   
ref|XP_002755470.1|  PREDICTED: elongation factor 1-gamma isoform X1  84.3    3e-16   
ref|XP_004656596.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|NP_001075254.1|  elongation factor 1-gamma                        84.3    3e-16   
ref|XP_008571701.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_001505899.2|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
ref|XP_007526399.1|  PREDICTED: elongation factor 1-gamma             84.3    3e-16   
sp|Q29387.2|EF1G_PIG  RecName: Full=Elongation factor 1-gamma; Sh...  84.3    3e-16   
gb|EPY83396.1|  speckle targeted PIP5K1A-regulated poly(A) polyme...  85.9    3e-16   
ref|XP_006911275.1|  PREDICTED: elongation factor 1-gamma             84.3    4e-16   
ref|XP_005699833.1|  PREDICTED: elongation factor 1-gamma             84.3    4e-16   
ref|XP_007462218.1|  PREDICTED: elongation factor 1-gamma             84.3    4e-16   
ref|XP_010852324.1|  PREDICTED: elongation factor 1-gamma             84.3    4e-16   
gb|ABF57407.1|  eukaryotic translation elongation factor 1 gamma      84.3    4e-16   
ref|NP_001035577.1|  elongation factor 1-gamma                        84.3    4e-16   
ref|XP_008060651.1|  PREDICTED: elongation factor 1-gamma isoform X2  84.0    4e-16   
ref|XP_006043256.1|  PREDICTED: elongation factor 1-gamma             84.3    4e-16   
ref|XP_006995262.1|  PREDICTED: elongation factor 1-gamma             84.3    4e-16   
gb|EFB28168.1|  hypothetical protein PANDA_014932                     84.3    4e-16   
gb|EAW74027.1|  eukaryotic translation elongation factor 1 gamma,...  82.0    4e-16   
ref|XP_008530379.1|  PREDICTED: elongation factor 1-gamma             84.3    4e-16   
gb|EUD71702.1|  elongation factor 1-gamma                             84.0    4e-16   
gb|ELR49692.1|  Elongation factor 1-gamma                             84.0    4e-16   
ref|XP_002610271.1|  hypothetical protein BRAFLDRAFT_115434           84.0    4e-16   
gb|EHJ69132.1|  elongation factor 1 gamma                             84.0    4e-16   
gb|AAH07949.2|  EEF1G protein                                         84.0    4e-16   
dbj|GAN03435.1|  elongation factor 1-gamma family protein             83.2    4e-16   
ref|XP_008815696.1|  elongation factor 1-gamma                        84.0    5e-16   
ref|XP_008060650.1|  PREDICTED: elongation factor 1-gamma isoform X1  84.0    5e-16   
dbj|BAG61974.1|  unnamed protein product                              84.3    5e-16   
ref|NP_001004223.1|  elongation factor 1-gamma                        84.0    5e-16   
ref|XP_745420.1|  elongation factor 1-gamma                           83.6    5e-16   
ref|XP_008622446.1|  elongation factor 1-gamma                        83.6    5e-16   
dbj|BAM17758.1|  elongation factor 1 gamma                            83.6    6e-16   
gb|ABG88954.1|  elongation factor-1 gamma                             83.6    6e-16   
ref|XP_005966833.1|  PREDICTED: elongation factor 1-gamma             83.6    6e-16   
ref|XP_004437533.1|  PREDICTED: elongation factor 1-gamma             84.0    6e-16   
ref|XP_004223626.1|  elongation factor 1-gamma                        83.2    7e-16   
ref|XP_005534461.1|  PREDICTED: elongation factor 1-gamma-like        82.4    7e-16   
ref|XP_001456169.1|  hypothetical protein                             83.2    8e-16   
emb|CDH55788.1|  elongation factor 1-gamma                            82.8    8e-16   
gb|AAL78751.1|  translation elongation factor-1 gamma                 83.2    9e-16   
ref|XP_002432920.1|  elongation factor 1-gamma, putative              83.2    9e-16   
ref|XP_008835762.1|  PREDICTED: elongation factor 1-gamma isoform X1  83.2    9e-16   
ref|XP_006156649.1|  PREDICTED: elongation factor 1-gamma             83.6    1e-15   
dbj|BAN20579.1|  elongation factor 1 gamma                            83.2    1e-15   
gb|ELW52035.1|  Elongation factor 1-gamma                             84.7    1e-15   
ref|XP_853577.1|  PREDICTED: elongation factor 1-gamma isoform 1      82.8    1e-15   
ref|XP_005660855.1|  PREDICTED: elongation factor 1-gamma             83.2    1e-15   
ref|XP_005414851.1|  PREDICTED: elongation factor 1-gamma             82.8    1e-15   
gb|AAH13918.1|  Eukaryotic translation elongation factor 1 gamma      82.8    1e-15   
ref|XP_009244529.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...  82.4    1e-15   
ref|XP_010631294.1|  PREDICTED: elongation factor 1-gamma isoform X1  82.8    1e-15   
ref|XP_009009109.1|  hypothetical protein HELRODRAFT_105304           82.4    2e-15   
gb|ACD62419.1|  elongation factor 1-gamma                             80.5    2e-15   
ref|XP_001366000.1|  PREDICTED: elongation factor 1-gamma             82.8    2e-15   
ref|XP_001614168.1|  elongation factor 1-gamma                        82.4    2e-15   
gb|ABG88953.1|  elongation factor-1 gamma                             82.4    2e-15   
ref|XP_004449309.1|  PREDICTED: elongation factor 1-gamma             82.8    2e-15   
ref|XP_004535631.1|  PREDICTED: elongation factor 1-gamma-like        82.4    2e-15   
ref|XP_010631295.1|  PREDICTED: elongation factor 1-gamma isoform X2  82.4    2e-15   
gb|AAS49527.1|  eukaryotic translation elongation factor 1 gamma      81.3    2e-15   
emb|CDS50901.1|  elongation factor 1-gamma, putative                  81.6    2e-15   
ref|XP_001954706.1|  GF18406                                          82.0    2e-15   
ref|XP_004770359.1|  PREDICTED: elongation factor 1-gamma isoform X1  82.8    3e-15   
gb|AAU89473.1|  putative translation elongation factor 1 gamma        80.1    3e-15   
ref|XP_004646771.1|  PREDICTED: elongation factor 1-gamma             81.6    3e-15   
ref|XP_004644383.1|  PREDICTED: elongation factor 1-gamma-like        81.6    3e-15   
ref|XP_007865989.1|  eEF1-gamma domain-containing protein             81.6    3e-15   
ref|XP_004883303.1|  PREDICTED: elongation factor 1-gamma             81.6    3e-15   
gb|AAH80966.1|  MGC76278 protein                                      81.6    3e-15   
ref|XP_005497725.1|  PREDICTED: elongation factor 1-gamma-like        81.6    3e-15   
ref|XP_003467975.1|  PREDICTED: elongation factor 1-gamma             81.6    4e-15   
gb|AAS93749.1|  RE15368p                                              80.1    4e-15   
gb|KDQ56005.1|  hypothetical protein JAAARDRAFT_180216                81.3    4e-15   
ref|NP_001133235.1|  elongation factor 1 gamma                        79.7    4e-15   
gb|EFX73418.1|  hypothetical protein DAPPUDRAFT_200523                81.3    4e-15   
emb|CDH55787.1|  elongation factor 1-gamma                            81.6    4e-15   
emb|CDY04368.1|  BnaC04g18250D                                        79.3    6e-15   
ref|XP_004770360.1|  PREDICTED: elongation factor 1-gamma isoform X2  81.6    6e-15   
gb|EHB02083.1|  Elongation factor 1-gamma                             81.3    6e-15   
gb|EPY26159.1|  elongation factor 1-gamma                             79.3    6e-15   
ref|XP_011210287.1|  PREDICTED: elongation factor 1-gamma             80.5    7e-15   
ref|XP_004596833.1|  PREDICTED: elongation factor 1-gamma             80.5    7e-15   
gb|ETB62718.1|  hypothetical protein YYC_00410                        80.5    7e-15   
ref|XP_010730447.1|  PREDICTED: elongation factor 1-gamma             80.5    7e-15   
ref|XP_001357735.1|  GA11269                                          80.5    8e-15   
ref|XP_001981372.1|  GG11656                                          80.5    8e-15   
ref|XP_003663778.1|  glutathione S-transferase-like protein           78.6    8e-15   
ref|XP_002098608.1|  Ef1gamma                                         80.5    8e-15   
dbj|BAM19052.1|  elongation factor 1 gamma                            80.5    8e-15   
ref|XP_002105322.1|  GD21427                                          80.5    8e-15   
gb|KFO33384.1|  Elongation factor 1-gamma                             80.5    9e-15   
ref|XP_002037178.1|  GM12777                                          80.5    9e-15   
emb|CDO76003.1|  hypothetical protein BN946_scf184780.g10             80.1    9e-15   
ref|XP_001350110.2|  elongation factor 1-gamma, putative              80.1    1e-14   
gb|ETW47418.1|  hypothetical protein PFMALIP_04497                    80.1    1e-14   
gb|ETW34692.1|  hypothetical protein PFTANZ_04597                     80.1    1e-14   
ref|XP_010339291.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...  80.1    1e-14   
ref|XP_004027144.1|  hypothetical protein IMG5_188690                 80.1    1e-14   
ref|XP_010588872.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...  80.1    1e-14   
ref|NP_652000.1|  Ef1gamma, isoform A                                 79.7    1e-14   
gb|AAN71367.1|  RE32823p                                              80.1    1e-14   
ref|XP_003274134.1|  PREDICTED: elongation factor 1-gamma isoform 1   79.7    2e-14   
gb|ENN80225.1|  hypothetical protein YQE_03344                        79.7    2e-14   
gb|AEE62776.1|  unknown                                               79.7    2e-14   
ref|XP_005178105.1|  PREDICTED: elongation factor 1-gamma             79.3    2e-14   
ref|XP_010900657.1|  PREDICTED: elongation factor 1-gamma             79.7    2e-14   
gb|ACO09775.1|  Elongation factor 1-gamma                             79.3    2e-14   
ref|XP_011179201.1|  PREDICTED: elongation factor 1-gamma             79.3    2e-14   
ref|XP_003274135.1|  PREDICTED: elongation factor 1-gamma isoform 2   79.7    2e-14   
gb|ABF18271.1|  elongation factor 1-gamma                             79.3    2e-14   
ref|XP_001661570.1|  AAEL011288-PA                                    79.3    2e-14   
gb|EPY38039.1|  elongation factor 1-gamma                             77.4    2e-14   
ref|XP_009055805.1|  hypothetical protein LOTGIDRAFT_189800           79.3    2e-14   
ref|XP_010704334.1|  elongation factor-1 gamma                        79.0    2e-14   
ref|XP_005536940.1|  eukaryotic translation elongation factor 1 g...  79.0    2e-14   
ref|XP_001809758.1|  PREDICTED: elongation factor 1-gamma             79.0    3e-14   
ref|XP_682573.1|  hypothetical protein AN9304.2                       77.0    3e-14   
gb|ABG88957.1|  elongation factor-1 gamma                             78.6    3e-14   
gb|ACN10123.1|  Elongation factor 1-gamma                             79.0    3e-14   
gb|ACM08681.1|  Elongation factor 1-gamma                             79.0    3e-14   
gb|ETW55524.1|  hypothetical protein PFUGPA_02286                     79.0    3e-14   
gb|EUR65945.1|  hypothetical protein PFBG_04685                       79.0    3e-14   
gb|EPY28959.1|  elongation factor 1-gamma                             78.6    3e-14   
ref|XP_001562716.1|  elongation factor-1 gamma                        78.6    3e-14   
ref|XP_002754632.1|  PREDICTED: elongation factor 1-gamma-like        78.6    4e-14   
emb|CDO66172.1|  elongation factor 1-gamma, putative                  78.6    4e-14   
ref|XP_004024223.1|  hypothetical protein IMG5_197540                 78.6    4e-14   
ref|XP_006781412.1|  PREDICTED: elongation factor 1-gamma-like is...  78.2    5e-14   
gb|AAF26671.1|  translation elongation factor 1 gamma                 78.2    5e-14   
ref|XP_001228872.1|  hypothetical protein CHGG_02356                  76.3    5e-14   
ref|XP_005913461.1|  PREDICTED: elongation factor 1-gamma-like        78.2    5e-14   
ref|XP_005723183.1|  PREDICTED: elongation factor 1-gamma-like        78.2    5e-14   
ref|XP_008040874.1|  glutathione S-transferase C-terminal-like pr...  76.3    5e-14   
ref|XP_006964046.1|  predicted protein                                79.0    5e-14   
ref|XP_006781411.1|  PREDICTED: elongation factor 1-gamma-like is...  78.2    6e-14   
emb|CDH60277.1|  elongation factor 1 gamma domain-containingprotein   77.8    6e-14   
ref|XP_004545571.1|  PREDICTED: elongation factor 1-gamma-like        78.2    6e-14   
gb|AJN91131.1|  elongation factor 1-gamma                             77.8    6e-14   
ref|XP_727914.1|  elongation factor 1-gamma 1                         77.8    6e-14   
emb|CEP19706.1|  hypothetical protein                                 77.8    7e-14   
ref|XP_004019908.1|  PREDICTED: elongation factor 1-gamma             78.2    7e-14   
gb|ELT98041.1|  hypothetical protein CAPTEDRAFT_173297                77.8    7e-14   
emb|CDS05969.1|  hypothetical protein LRAMOSA08497                    77.4    8e-14   
gb|AGH70142.1|  eukaryotic translation elongation factor 1 gamma      75.1    1e-13   
emb|CCW64576.1|  unnamed protein product                              77.0    1e-13   
ref|XP_006680023.1|  hypothetical protein BATDEDRAFT_37118            77.0    1e-13   
ref|NP_001135112.1|  Elongation factor 1-gamma                        77.4    1e-13   
gb|ACH85278.1|  eukaryotic translation elongation factor 1 gamma      77.0    1e-13   
ref|XP_007587267.1|  putative translation elongation factor eef-1...  75.1    1e-13   
gb|ACM09182.1|  Elongation factor 1-gamma                             77.0    1e-13   
gb|ABG88919.1|  elongation factor-1 gamma                             75.9    1e-13   
gb|AAM93480.1|  eukaryotic translation elongation factor 1 gamma      76.3    1e-13   
ref|XP_002058602.1|  GJ14227                                          77.0    1e-13   
ref|XP_003444636.1|  PREDICTED: elongation factor 1-gamma-like        77.0    1e-13   
gb|EGW02095.1|  Elongation factor 1-gamma                             75.9    1e-13   
gb|ETS03179.1|  hypothetical protein M419DRAFT_75555                  77.4    2e-13   
gb|ENN82421.1|  hypothetical protein YQE_01203                        76.6    2e-13   
ref|XP_008064282.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...  76.6    2e-13   
emb|CAF94682.1|  unnamed protein product                              73.9    2e-13   



>ref|XP_011074970.1| PREDICTED: elongation factor 1-gamma-like [Sesamum indicum]
Length=420

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNAF ALI AEY GVKVELT +F+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHASSTNKNAFKALIAAEYSGVKVELTKDFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++KPDNPL+GSSLI+YGHIEQW DF+ATEID N A+WLYPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKPDNPLYGSSLIDYGHIEQWMDFSATEIDINIARWLYPRLGYG  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  LYLPPA  126



>emb|CBI39244.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   210 bits (535),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ N NKNAF ALI AEY GVKVEL  NF+MGVSNK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNAFKALIAAEYSGVKVELVKNFEMGVSNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+GS+LIEY HIEQW DF + EIDAN  +W  PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSTLIEYAHIEQWIDFGSLEIDANILRWFIPRIGFA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>gb|AGJ83736.1| elongation factor 1-gamma-like protein, partial [Caragana korshinskii]
Length=221

 Score =   211 bits (538),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M+LVLH+ N NKNAF ALI AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MSLVLHAGNTNKNAFKALIAAEYSGVQVELVQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+GSSLIEY HIEQW DFA+ EIDAN  +W  PR GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIEYAHIEQWIDFASMEIDANIMRWYIPRAGFA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|XP_006647077.1| PREDICTED: elongation factor 1-gamma 2-like [Oryza brachyantha]
Length=418

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNAF ALI AEY GVKVEL  NFQMGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLGF 
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWIDFSATEVDANIGKWLYPRLGFA  120

Query  428  IYLP  439
             Y+P
Sbjct  121  PYVP  124



>emb|CDP10743.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+ + NKNAF ALI AEY  VKVELT +FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATSNNKNAFKALIAAEYSDVKVELTKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K+K +NPLFGSSLIEY  IEQW DFA TEID N  +WLYPRLGF+
Sbjct  61   DGPLFESNAIARYVTKLKANNPLFGSSLIEYARIEQWIDFATTEIDVNLGRWLYPRLGFM  120

Query  428  IYLPPA  445
            ++LPPA
Sbjct  121  VHLPPA  126



>gb|EYU28215.1| hypothetical protein MIMGU_mgv1a007176mg [Erythranthe guttata]
Length=416

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNA  ALI AEY G+K+EL   F+MGVSNKTP FLKMNPIGKVPVLETP
Sbjct  1    MALVLHASSTNKNAIKALITAEYSGIKIELAKGFEMGVSNKTPAFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL+GSSLI+YGHIEQW DF+A EIDAN  +WLYPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLYGSSLIDYGHIEQWIDFSANEIDANIGRWLYPRLGYG  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  LYLPPA  126



>ref|XP_009610261.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=417

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS N NKNA  ALI AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K KPDNPLFGSSLIEY  IEQW DF+ATEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKSKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIARWLYPRLGYG  120

Query  428  IYL  436
             Y+
Sbjct  121  AYI  123



>emb|CBI29689.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   202 bits (513),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNA+  LI AEY G+KVEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAYKTLIAAEYSGIKVELVQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+GSS IEYGHIEQW DFA+ EIDAN   W  PR+G  
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIEQWIDFASLEIDANIGHWFRPRIGRA  120

Query  428  IYLPP  442
            +YLPP
Sbjct  121  VYLPP  125



>ref|XP_002278756.2| PREDICTED: elongation factor 1-gamma [Vitis vinifera]
Length=424

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ N NKNAF ALI AEY GVKVEL  NF+MGVSNK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNAFKALIAAEYSGVKVELVKNFEMGVSNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+GS+LIEY HIEQW DF + EIDAN  +W  PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSTLIEYAHIEQWIDFGSLEIDANILRWFIPRIGFA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|XP_006339362.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
tuberosum]
Length=416

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  65   AMALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLET  244
            AMAL+LHS N NKNA  ALI AE+ GVKVEL  +FQMGVSN +PEFLKMNPIGKVPVLET
Sbjct  2    AMALILHSTNNNKNASKALIAAEFTGVKVELAKDFQMGVSNNSPEFLKMNPIGKVPVLET  61

Query  245  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            PDGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLG+
Sbjct  62   PDGPVFESNAIARYVTKLKPNNPLFGSSLIEYAQIEQWNDFSATEVDANIGRWLYPRLGY  121

Query  425  VIYLP  439
             +Y+P
Sbjct  122  RVYIP  126



>ref|XP_007041182.1| Elongation factor 1-gamma 3 isoform 2 [Theobroma cacao]
 gb|EOX97013.1| Elongation factor 1-gamma 3 isoform 2 [Theobroma cacao]
Length=309

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNA  ALI A+YC V+V+L  NF+MGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKNNKNAVKALIAAQYCDVEVKLAENFEMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYV ++K DNPLFGS+LI+YGHIEQWTDFAA EID N +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRIKADNPLFGSTLIDYGHIEQWTDFAAMEIDVNISKWLYPRLGYG  120

Query  428  IYLPPA  445
            ++LP A
Sbjct  121  VHLPLA  126



>ref|XP_004250641.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
lycopersicum]
Length=414

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LHS N NKNA  ALI AEY GVKVE+  +FQMGVSN TPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHSTNNNKNASKALIAAEYTGVKVEVPKDFQMGVSNNTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   DGPVFESNAIARYVTKLKPNNPLFGSSLIEYSQIEQWNDFSATEVDANIGRWLYPRLGFR  120

Query  428  IYLP  439
            +Y+P
Sbjct  121  VYIP  124



>ref|NP_001046318.1| Os02g0220600 [Oryza sativa Japonica Group]
 sp|Q9ZRI7.1|EF1G1_ORYSJ RecName: Full=Elongation factor 1-gamma 1; Short=EF-1-gamma 1; 
AltName: Full=eEF-1B gamma 1 [Oryza sativa Japonica Group]
 dbj|BAA34206.1| elongation factor 1B gamma [Oryza sativa]
 dbj|BAD17615.1| Elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08232.1| Os02g0220600 [Oryza sativa Japonica Group]
Length=418

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNAF ALI AEY GVKVEL  NFQMGVSNKTPE+LKMNPIGKVP+LETP
Sbjct  1    MALVLHTFDGNKNAFKALIAAEYSGVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DANT KWL+PRLGF 
Sbjct  61   DGPVFESNAIARYVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWLFPRLGFA  120

Query  428  IYL  436
             Y+
Sbjct  121  PYV  123



>ref|XP_010686883.1| PREDICTED: elongation factor 1-gamma-like [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ N NKNAF ALI AEY GVKVEL  +F+MGVSN+TPEFLK+NPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNAFKALIAAEYSGVKVELAKDFEMGVSNQTPEFLKINPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYV ++K DNPL+GSSLI+YGHIEQW DFA+ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIQYGHIEQWIDFASLEIDVNILRWFVPRIGFA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|XP_007222556.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
 gb|EMJ23755.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
Length=421

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ N NKN F ALI AEY GVKVEL  NF+MGVSNK+P+FL+MNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNGFKALIAAEYSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPLFGS+LIEY H+EQW DFA  EIDAN  +WL PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLFGSTLIEYAHVEQWIDFATLEIDANILRWLIPRIGFA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|XP_008219063.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=421

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ N NKN F ALI AEY GVKVEL  NF+MGVSNK+P+FL+MNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNGFKALIAAEYSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPLFGSSLIEY H+EQW DFA  EID+N  +WL PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLFGSSLIEYAHVEQWIDFATLEIDSNILRWLIPRIGFA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|XP_009774948.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS + NKNA  ALI AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSGSNNKNALKALIAAEYTGVKVELAKNFEMGVSNKTPEFVKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K+KPDNPLFGSSLIEY  IEQW DF+ATEIDAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIGQWLYPRLGYR  120

Query  428  IYL  436
            +++
Sbjct  121  VFI  123



>ref|XP_004240589.1| PREDICTED: elongation factor 1-gamma 2-like [Solanum lycopersicum]
Length=413

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LHS + NKNA  ALI AEY GVKV+L  +FQMGVSNKTPEFL+MNPIGKVPVL+TP
Sbjct  1    MALILHSTDNNKNASKALIAAEYTGVKVDLAKDFQMGVSNKTPEFLEMNPIGKVPVLQTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K KP+NPLFGSSLIEY  IEQW DF+ATEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKTKPNNPLFGSSLIEYAQIEQWNDFSATEIDANIARWLYPRLGYA  120

Query  428  IYLPPA  445
            +Y+  A
Sbjct  121  VYISQA  126



>ref|XP_007041183.1| Elongation factor 1-gamma 3 isoform 3 [Theobroma cacao]
 gb|EOX97014.1| Elongation factor 1-gamma 3 isoform 3 [Theobroma cacao]
Length=320

 Score =   205 bits (521),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNA  ALI A+YC V+V+L  NF+MGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKNNKNAVKALIAAQYCDVEVKLAENFEMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYV ++K DNPLFGS+LI+YGHIEQWTDFAA EID N +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRIKADNPLFGSTLIDYGHIEQWTDFAAMEIDVNISKWLYPRLGYG  120

Query  428  IYLPPA  445
            ++LP A
Sbjct  121  VHLPLA  126



>gb|ACB72462.1| elongation factor 1 gamma-like protein [Nicotiana tabacum]
Length=417

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS + NKNA  ALI AEY G+KVEL  NF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSGSNNKNAIKALIAAEYTGIKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K+KPDNPLFGSSLIEY  IEQW DF+ATEIDAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIGQWLYPRLGYR  120

Query  428  IYL  436
            +++
Sbjct  121  VFI  123



>ref|XP_009759974.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS N NKNA  ALI AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K+KPDNPLFGSSLI+Y  IEQW DF+ TEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIQYAQIEQWNDFSTTEIDANIARWLYPRLGYG  120

Query  428  IYL  436
             Y+
Sbjct  121  PYI  123



>ref|XP_002451782.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
 gb|EES04758.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
Length=418

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNAF  LI AEY GVKVEL  +FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSANKNAFKTLIAAEYSGVKVELAKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFA TE+DANT KWLYPR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWMDFATTEVDANTGKWLYPRMGFY  120

Query  428  IY  433
             Y
Sbjct  121  PY  122



>sp|Q6YW46.2|EF1G2_ORYSJ RecName: Full=Elongation factor 1-gamma 2; Short=EF-1-gamma 2; 
AltName: Full=eEF-1B gamma 2 [Oryza sativa Japonica Group]
Length=418

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNAF ALI AEY GVKVEL  NFQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG  
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIA  120

Query  428  IYL  436
             Y+
Sbjct  121  PYV  123



>ref|NP_001046317.1| Os02g0220500 [Oryza sativa Japonica Group]
 dbj|BAD17614.1| putative elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08231.1| Os02g0220500 [Oryza sativa Japonica Group]
 gb|EEC72756.1| hypothetical protein OsI_06401 [Oryza sativa Indica Group]
 gb|EEE56571.1| hypothetical protein OsJ_05922 [Oryza sativa Japonica Group]
Length=414

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNAF ALI AEY GVKVEL  NFQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG  
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIA  120

Query  428  IYL  436
             Y+
Sbjct  121  PYV  123



>gb|ACA50518.1| elongation factor 1-gamma [Oryza sativa Japonica Group]
Length=414

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNAF ALI AEY GVKVEL  NFQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG  
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIA  120

Query  428  IYL  436
             Y+
Sbjct  121  PYV  123



>ref|XP_009417204.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=419

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNAF ALI AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAFKALIAAEYSGVQVELAENFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+GSSLIEY HIEQW DFA+ E+DAN A+WLYPRLG++
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIEYAHIEQWIDFASMEVDANIARWLYPRLGYM  120

Query  428  IY  433
             Y
Sbjct  121  PY  122



>ref|XP_009610260.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=417

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M  VLHS N NKNA  ALI AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MLQVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K KPDNPLFGSSLIEY  IEQW DF+ATEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKSKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIARWLYPRLGYG  120

Query  428  IYL  436
             Y+
Sbjct  121  AYI  123



>ref|XP_003563720.1| PREDICTED: elongation factor 1-gamma 3 [Brachypodium distachyon]
Length=413

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS + NKNAF ALI AE+CGVKVEL  NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEFCGVKVELAKNFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG +FESNAIARYVA+ K D+PLFG SLI+Y H+EQW DF+ATEID N A+WLYPRLG++
Sbjct  61   DGAVFESNAIARYVARSKGDSPLFGGSLIDYAHVEQWMDFSATEIDGNIARWLYPRLGYM  120

Query  428  IYLP  439
             Y+P
Sbjct  121  PYVP  124



>gb|KJB47886.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=314

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNAF ALI AEY GV+V++  NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYVA+ K +NP+ GSSLI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSSLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  428  IYL  436
            +YL
Sbjct  121  VYL  123



>ref|XP_004250642.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
lycopersicum]
Length=414

 Score =   204 bits (520),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M  +LHS N NKNA  ALI AEY GVKVE+  +FQMGVSN TPEFLKMNPIGKVPVLETP
Sbjct  1    MLQILHSTNNNKNASKALIAAEYTGVKVEVPKDFQMGVSNNTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   DGPVFESNAIARYVTKLKPNNPLFGSSLIEYSQIEQWNDFSATEVDANIGRWLYPRLGFR  120

Query  428  IYLP  439
            +Y+P
Sbjct  121  VYIP  124



>ref|XP_011099002.1| PREDICTED: elongation factor 1-gamma 2-like [Sesamum indicum]
Length=391

 Score =   204 bits (518),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS + NKNA+ AL+ AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGK+PVLETP
Sbjct  1    MALVLHS-SPNKNAYKALVAAEYSGVKVELVKNFEMGVSNKTPEFIKMNPIGKIPVLETP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++ PD  L+GSSLIEYG IEQW DF+ATEID +   WLYPRLG+ 
Sbjct  60   DGPIFESNAIARYVARLNPDGTLYGSSLIEYGQIEQWLDFSATEIDVSLGNWLYPRLGYR  119

Query  428  IYLPPA  445
            +YLPPA
Sbjct  120  VYLPPA  125



>ref|XP_007041181.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
 gb|EOX97012.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
Length=422

 Score =   204 bits (519),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNA  ALI A+YC V+V+L  NF+MGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKNNKNAVKALIAAQYCDVEVKLAENFEMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYV ++K DNPLFGS+LI+YGHIEQWTDFAA EID N +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRIKADNPLFGSTLIDYGHIEQWTDFAAMEIDVNISKWLYPRLGYG  120

Query  428  IYLPPA  445
            ++LP A
Sbjct  121  VHLPLA  126



>ref|XP_006385057.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ABK94655.1| unknown [Populus trichocarpa]
 gb|ADB11387.1| gamma class glutathione transferase EF1Bgamma2 [Populus trichocarpa]
 gb|ERP62854.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=422

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVL++   NKNA+ ALI AEY GV V+L  NF+MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLYAGKTNKNAYKALIAAEYSGVDVKLAENFEMGVTNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFAATEIDA  ++WLYPR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWMDFAATEIDAGISRWLYPRMGFQ  120

Query  428  IYLPPA  445
             YLPPA
Sbjct  121  PYLPPA  126



>ref|XP_010928857.1| PREDICTED: elongation factor 1-gamma 2 [Elaeis guineensis]
Length=419

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+ N NKNAF ALI AEY GVKVEL  NF++GVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALILHAGNANKNAFKALIAAEYSGVKVELVKNFEIGVSNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYV ++K DNPL+GSSLIEY  IEQW DFA+ EIDAN A+WLYPRLGF+
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIEYARIEQWIDFASMEIDANIARWLYPRLGFL  120



>gb|KJB47897.1| hypothetical protein B456_008G046200 [Gossypium raimondii]
Length=421

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNAF ALI AEY GV+V++  NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYVA+ K +NP+ GS+LI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSTLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  428  IYLPPA  445
            +YLPP+
Sbjct  121  VYLPPS  126



>ref|XP_009774942.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M  VLHS + NKNA  ALI AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MLQVLHSGSNNKNALKALIAAEYTGVKVELAKNFEMGVSNKTPEFVKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K+KPDNPLFGSSLIEY  IEQW DF+ATEIDAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIGQWLYPRLGYR  120

Query  428  IYL  436
            +++
Sbjct  121  VFI  123



>ref|XP_008677347.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008677348.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008679834.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 ref|XP_008679835.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 gb|AFW66035.1| elongation factor 1-gamma 2 [Zea mays]
 gb|AFW66036.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M LVLH+ + NKNAF  LI AEY GVKVEL  +FQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MVLVLHANSGNKNAFKTLIAAEYSGVKVELVKDFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            DGP+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFAATEIDAN  KWLYPR+GF
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWIDFAATEIDANIGKWLYPRMGF  119



>gb|ADR70876.1| eukaryotic translation elongation factor 1B gamma-subunit [Hevea 
brasiliensis]
Length=424

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNAF +LI AEY GVKVEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKSLIAAEYSGVKVELVENFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+ SSLI+Y HIEQW DFA+ EIDAN   WL PR+GF 
Sbjct  61   DGPLFESNAIARYVTRLKADNPLYDSSLIDYAHIEQWIDFASLEIDANLMAWLRPRMGFA  120

Query  428  IYLPPA  445
             YLPPA
Sbjct  121  PYLPPA  126



>ref|XP_004294500.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=419

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKN + ALI AEYCGVKVEL  +FQMGVSNKTPEFLK+NPIGKVPVLETP
Sbjct  1    MALVLHAASNNKNGYKALIAAEYCGVKVELVKDFQMGVSNKTPEFLKLNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K D PLFGSSLIE+  ++QW DFA  EIDAN  +W  PR+GF 
Sbjct  61   DGPVFESNAIARYVARLKADTPLFGSSLIEHALVDQWIDFATLEIDANILRWFIPRIGFA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|XP_009418787.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=421

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ N NKN F ALI AEY G++VEL  NF MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNGFKALIAAEYSGIQVELVKNFVMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+G SLIEY HIEQW D+A+ EIDAN A+WLYPRLG++
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGCSLIEYAHIEQWIDYASMEIDANLARWLYPRLGYM  120

Query  428  IYLPPA  445
             YL  A
Sbjct  121  PYLAVA  126



>ref|XP_009759973.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M  VLHS N NKNA  ALI AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MLQVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K+KPDNPLFGSSLI+Y  IEQW DF+ TEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIQYAQIEQWNDFSTTEIDANIARWLYPRLGYG  120

Query  428  IYL  436
             Y+
Sbjct  121  PYI  123



>ref|XP_006339363.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
tuberosum]
Length=414

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M  +LHS N NKNA  ALI AE+ GVKVEL  +FQMGVSN +PEFLKMNPIGKVPVLETP
Sbjct  1    MLQILHSTNNNKNASKALIAAEFTGVKVELAKDFQMGVSNNSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPNNPLFGSSLIEYAQIEQWNDFSATEVDANIGRWLYPRLGYR  120

Query  428  IYLP  439
            +Y+P
Sbjct  121  VYIP  124



>gb|KDO42761.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=312

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M LVLH+ N NKNAF ALI AEY GV VEL  NF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  428  IYLPPA  445
            +YLP A
Sbjct  121  VYLPQA  126



>ref|XP_004951452.1| PREDICTED: elongation factor 1-gamma 2-like [Setaria italica]
Length=417

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNAF ALI AEY G+KVEL  +FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGIKVELVKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG +FESNAIARYVA++K DNPL+G SLI+Y HIEQW DFAATE+DAN  KWL+PR+GF 
Sbjct  61   DGAVFESNAIARYVARLKADNPLYGFSLIDYAHIEQWMDFAATEVDANIGKWLFPRMGFY  120

Query  428  IY  433
             Y
Sbjct  121  PY  122



>ref|XP_006656177.1| PREDICTED: elongation factor 1-gamma 3-like [Oryza brachyantha]
Length=416

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS + NKNAF ALI AEY GVKVELT NF+MGVSNKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEYNGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG +FESNAIARYVA++K +N L GSSLIEY HIEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   DGAVFESNAIARYVARLKDNNTLCGSSLIEYAHIEQWMDFSATEVDANIGRWLYPRLGFA  120

Query  428  IYLP  439
             ++P
Sbjct  121  PHVP  124



>ref|XP_008643919.1| PREDICTED: uncharacterized protein LOC100381466 isoform X1 [Zea 
mays]
 gb|AFW71313.1| hypothetical protein ZEAMMB73_547198 [Zea mays]
Length=414

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNAF  LI A+Y G+KVEL  +FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSSNKNAFKTLIAADYSGIKVELVKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K +NPL+GSSLI+Y HIEQW DFAATE+DA+  KWLYPR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKANNPLYGSSLIDYAHIEQWMDFAATEVDASIGKWLYPRMGFY  120

Query  428  IY  433
             Y
Sbjct  121  PY  122



>ref|NP_001151229.1| elongation factor 1-gamma 2 [Zea mays]
 gb|ACG42059.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M LVLH+ + NKNAF  LI AEY GVKVEL  +FQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MVLVLHANSGNKNAFKTLIAAEYSGVKVELVKDFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            D P+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFAATEIDAN  KWLYPR+GF
Sbjct  61   DDPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWIDFAATEIDANIGKWLYPRMGF  119



>emb|CAN75785.1| hypothetical protein VITISV_021574 [Vitis vinifera]
Length=423

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNA+  LI AEY G+KVEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAYKTLIAAEYSGIKVELXQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+GSS IEYGHIEQW DFA+ EIDAN   W  PR+G  
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIEQWIDFASLEIDANIGHWFRPRMGRA  120

Query  428  IYLPP  442
            +YLPP
Sbjct  121  VYLPP  125



>ref|XP_002264400.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
 ref|XP_010657965.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
Length=423

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNA+  LI AEY G+KVEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAYKTLIAAEYSGIKVELVQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+GSS IEYGHIEQW DFA+ EIDAN   W  PR+G  
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIEQWIDFASLEIDANIGHWFRPRIGRA  120

Query  428  IYLPP  442
            +YLPP
Sbjct  121  VYLPP  125



>ref|XP_009353791.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
 ref|XP_009353792.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKN + ALI AEY GVKVEL  NF+MGVSNKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALIAAEYTGVKVELAPNFEMGVSNKTPEYLKLNPIGKVPLLVTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL+GSSLI+Y HIEQW DF   EIDAN +KW YPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLYGSSLIDYAHIEQWIDFGTMEIDANISKWYYPRLGYG  120

Query  428  IYLPPA  445
            ++LPPA
Sbjct  121  VHLPPA  126



>ref|XP_011028370.1| PREDICTED: elongation factor 1-gamma 2-like [Populus euphratica]
Length=422

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVL++   NKN + ALI AEY GV V+L  NF+MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLYAGKTNKNGYKALIAAEYSGVDVKLAENFEMGVTNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYV ++K +NPL+GSSLI+Y HIEQW DFAATEIDA  A+WLYPRLGF 
Sbjct  61   DGPIFESNAIARYVTRLKAENPLYGSSLIDYAHIEQWMDFAATEIDAGIARWLYPRLGFQ  120

Query  428  IYLPP  442
             YLPP
Sbjct  121  PYLPP  125



>ref|XP_010272550.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Nelumbo 
nucifera]
Length=487

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  62   EAMALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLE  241
            +AM LVLH+ N NKNAF ALI AEY GV V+L  NF+MGVSNKTP+FLKMNPIGKVPVLE
Sbjct  63   QAMTLVLHAGNTNKNAFKALIAAEYNGVTVKLVPNFEMGVSNKTPQFLKMNPIGKVPVLE  122

Query  242  TPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
            TPDGPIFESNAIARYVA++K D PL+GSSLIE+  IEQW DFA+ EIDAN  KW  PR G
Sbjct  123  TPDGPIFESNAIARYVARLKGDTPLYGSSLIEFARIEQWIDFASLEIDANILKWFIPRAG  182

Query  422  FVIYLPPA  445
            F +YLPPA
Sbjct  183  FAVYLPPA  190



>ref|XP_003571724.1| PREDICTED: elongation factor 1-gamma 2 [Brachypodium distachyon]
Length=417

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVL++   NKNAF ALI AEY GVK+EL  +FQMGVSNK+ EFLKMNPIGKVPVLETP
Sbjct  1    MALVLYAGGGNKNAFKALIAAEYSGVKIELVKDFQMGVSNKSAEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYVA+VK DNPL+GSSL+EY HIEQW DF+ATE+D N  KWLYPRLGF 
Sbjct  61   EGPVFESNAIARYVARVKADNPLYGSSLMEYAHIEQWIDFSATEVDVNIGKWLYPRLGFY  120

Query  428  IYL  436
             Y+
Sbjct  121  HYV  123



>gb|AFW76479.1| elongation factor gamma1 [Zea mays]
Length=309

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNAF ALI AEY G+KVELT +F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPRLGYL  120

Query  428  IYL  436
             Y+
Sbjct  121  PYV  123



>ref|XP_008339412.1| PREDICTED: elongation factor 1-gamma [Malus domestica]
Length=420

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKN + ALI AEY GVKVEL  NF MGVSNKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALITAEYTGVKVELAPNFXMGVSNKTPEYLKLNPIGKVPLLVTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL+G SLI+Y HIEQW DF + EIDAN +KW YPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLYGCSLIDYAHIEQWIDFGSMEIDANISKWYYPRLGYG  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|XP_006478210.1| PREDICTED: elongation factor 1-gamma-like [Citrus sinensis]
Length=422

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MA+VLH+ N NKNAF ALI AEY GV VEL  NF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MAMVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  428  IYLPPA  445
            +YLP A
Sbjct  121  VYLPQA  126



>ref|XP_008804357.1| PREDICTED: elongation factor 1-gamma 2-like [Phoenix dactylifera]
Length=461

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +2

Query  65   AMALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLET  244
            +MAL+LH+ N NKN F ALI AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLET
Sbjct  42   SMALILHAGNTNKNGFKALIAAEYSGVQVELAKNFEMGVSNKTPEFLKMNPIGKVPVLET  101

Query  245  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            PDGPIFESNAIARYV ++K DNPLFGSSLI+Y  IEQW DFA+ EID N ++WLYPRLG+
Sbjct  102  PDGPIFESNAIARYVTRLKADNPLFGSSLIDYARIEQWIDFASMEIDVNLSRWLYPRLGY  161



>ref|XP_010272551.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Nelumbo 
nucifera]
Length=423

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M LVLH+ N NKNAF ALI AEY GV V+L  NF+MGVSNKTP+FLKMNPIGKVPVLETP
Sbjct  1    MTLVLHAGNTNKNAFKALIAAEYNGVTVKLVPNFEMGVSNKTPQFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K D PL+GSSLIE+  IEQW DFA+ EIDAN  KW  PR GF 
Sbjct  61   DGPIFESNAIARYVARLKGDTPLYGSSLIEFARIEQWIDFASLEIDANILKWFIPRAGFA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|XP_008339178.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=313

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKN F ALI AE+ GVKVEL  NF+MGVSNK+P+FL+MNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNGFKALIAAEFSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP FESNAIARYV ++K DNPL+GSSLIEY  +EQW DFA  EIDAN  +WL P +GF 
Sbjct  61   DGPXFESNAIARYVTRLKADNPLYGSSLIEYARVEQWIDFATLEIDANILRWLIPXIGFS  120

Query  428  IYLPP  442
            +YLPP
Sbjct  121  VYLPP  125



>gb|KJB47883.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47887.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47888.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=421

 Score =   199 bits (507),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNAF ALI AEY GV+V++  NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYVA+ K +NP+ GSSLI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSSLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  428  IYL  436
            +YL
Sbjct  121  VYL  123



>ref|XP_011047878.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
 ref|XP_011047880.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
Length=421

 Score =   199 bits (507),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+L++   NKNA+  LI AEY GV V+L  NF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILYAGKTNKNAYKTLIAAEYSGVDVKLAENFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYV ++K DNPL+GSSLIEY  IEQW DFAATEIDA  +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRLKADNPLYGSSLIEYARIEQWIDFAATEIDAGISKWLYPRLGYQ  120

Query  428  IYLPPA  445
             YLPPA
Sbjct  121  PYLPPA  126



>gb|ABA81876.1| unknown [Solanum tuberosum]
Length=413

 Score =   199 bits (506),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LHS N NKN   ALI AEY GVKV+L  +FQMGVSNKTPEFL+MNPIGKVPVL+T 
Sbjct  1    MALILHSTNNNKNTSKALIAAEYTGVKVDLAKDFQMGVSNKTPEFLEMNPIGKVPVLQTT  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
              P+ ESNAIARYV K KPDNPLFGSSLIEY  IEQW DF+ATE+DAN A+WLYPRLG+ 
Sbjct  61   YEPVLESNAIARYVTKTKPDNPLFGSSLIEYAQIEQWNDFSATEVDANIARWLYPRLGYG  120

Query  428  IYLPPA  445
            +Y+P A
Sbjct  121  VYIPQA  126



>gb|EMT20600.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=413

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS + NKNAF ALI AEYCGVKVELT NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEYCGVKVELTKNFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG +FESNAIARYVA+ K DN L+G SLIEY  +EQW DF ATE+D N A+WLYPRLG++
Sbjct  61   DGAVFESNAIARYVARSKGDNLLWGGSLIEYARVEQWMDFGATEVDPNIARWLYPRLGYM  120

Query  428  IY  433
             Y
Sbjct  121  PY  122



>ref|XP_006431568.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
 gb|ESR44808.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
Length=418

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH   ENKN F  LI AEY GV+V+L  NF+MGV+NK+PEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHVGQENKNGFKGLIAAEYAGVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K DN L+GSSLI+Y H+EQW DF+A EIDAN ++W+YPRLG++
Sbjct  61   DGPVFESNAIARYVARLKADNQLYGSSLIDYAHVEQWMDFSAMEIDANISRWVYPRLGYM  120

Query  428  IYLPPA  445
             Y+P A
Sbjct  121  QYIPLA  126



>gb|KDO42759.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=422

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M LVLH+ N NKNAF ALI AEY GV VEL  NF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  428  IYLPPA  445
            +YLP A
Sbjct  121  VYLPQA  126



>ref|XP_010242290.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
 ref|XP_010242291.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
Length=424

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M+LVLH+ N NKNAF ALI AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MSLVLHASNVNKNAFKALIAAEYSGVKVELVPNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K D  L+GSSLIEY  +EQW DFA+ E+D N ++WLYPRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDAILYGSSLIEYARVEQWIDFASLEVDTNISRWLYPRLGFG  120

Query  428  I-YLPPA  445
              YLPPA
Sbjct  121  QPYLPPA  127



>sp|Q9FUM1.1|EF1G_PRUAV RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: 
Full=eEF-1B gamma [Prunus avium]
 gb|AAG17901.1|AF297712_1 translation elongation factor 1-gamma [Prunus avium]
Length=422

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNAF  LIVAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP+LETP
Sbjct  1    MALVLHAGKTNKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  PR G+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRPRFGYA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>gb|KHG04277.1| hypothetical protein F383_29497 [Gossypium arboreum]
Length=421

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNAF ALI AEY GV+V++  NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYVA++K +NP+ GS+LI+YGHIEQW DFAA EIDAN AKW YPRLG+ 
Sbjct  61   EGPVFESNAIARYVARLKVNNPICGSTLIDYGHIEQWIDFAAMEIDANIAKWFYPRLGYG  120

Query  428  IYL  436
            +YL
Sbjct  121  VYL  123



>gb|KHG12420.1| hypothetical protein F383_17048 [Gossypium arboreum]
Length=421

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+   NKNAF ALI AEY GV+V++  NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALILHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYVA+ K +NP+ GS+LI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSTLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  428  IYL  436
            +YL
Sbjct  121  VYL  123



>ref|XP_006494223.1| PREDICTED: elongation factor 1-gamma 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494224.1| PREDICTED: elongation factor 1-gamma 3-like isoform X2 [Citrus 
sinensis]
 gb|ACP43319.1| translation elongation factor [Citrus maxima]
Length=418

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH   ENKN F  LI AEY GV+V+L  NF+MGV+NK+PEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHVGQENKNGFKGLIAAEYAGVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K DN L GSSLI+Y H+EQW DF+A EIDAN ++WLYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYM  120

Query  428  IYLPPA  445
             Y+P A
Sbjct  121  QYIPLA  126



>gb|EYU22759.1| hypothetical protein MIMGU_mgv1a007114mg [Erythranthe guttata]
Length=419

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS + NKNAF  LI AEYCGVK+E+   FQMGVSNKTPEF+KMNP+GK+PVLETP
Sbjct  1    MALVLHS-SPNKNAFKVLIAAEYCGVKIEMVKEFQMGVSNKTPEFIKMNPLGKIPVLETP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G IFESNAIARYV +   D+ L+GSSLI+YG IEQW DF+ATEIDA+ A WLYPRLG+ 
Sbjct  60   EGAIFESNAIARYVVRSSADSSLYGSSLIDYGQIEQWMDFSATEIDASIAGWLYPRLGYR  119

Query  428  IYLPPA  445
            +YLPPA
Sbjct  120  LYLPPA  125



>ref|XP_008789739.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Phoenix dactylifera]
Length=419

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+ N NKN F ALI A Y GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHAGNTNKNGFKALIAAAYSGVQVELVKNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYV ++K +NPL+GSSLIEY  IEQW DFA+ EIDAN A+WL PRLGFV
Sbjct  61   DGPIFESNAIARYVTRLKAENPLYGSSLIEYARIEQWIDFASMEIDANIARWLLPRLGFV  120



>ref|XP_009362385.1| PREDICTED: elongation factor 1-gamma-like [Pyrus x bretschneideri]
Length=422

 Score =   197 bits (502),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKN F ALI AE+ G KVEL  NF+MGVSNK+P+FL MNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNGFKALIAAEFSGAKVELVKNFEMGVSNKSPKFLDMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+GSSLIEY  +EQW DFA  EIDAN  +WL PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIEYARVEQWIDFATLEIDANILRWLIPRIGFS  120

Query  428  IYLPP  442
            +YLPP
Sbjct  121  VYLPP  125



>ref|XP_004966045.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNAF ALI AEY GVKVELT NF+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGPGNKNAFKALIAAEYSGVKVELTKNFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG IFESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D+  A +LYPRLG++
Sbjct  61   DGAIFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDSGVAWYLYPRLGYI  120

Query  428  IY  433
             Y
Sbjct  121  PY  122



>ref|XP_006441587.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
 gb|ESR54827.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
Length=422

 Score =   197 bits (501),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M LVLH+ N NKNAF  LI AEY GV VEL  NF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MPLVLHAGNTNKNAFKTLITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  428  IYLPPA  445
            +YLP A
Sbjct  121  VYLPQA  126



>gb|EMS60520.1| Elongation factor 1-gamma 2 [Triticum urartu]
Length=413

 Score =   197 bits (500),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS + NKNAF ALI AEYCGVKVELT NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEYCGVKVELTKNFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG +FESNAIARYVA+ K D+ L+G SLIEY  +EQW DF ATE+D N A+WLYPRLG++
Sbjct  61   DGAVFESNAIARYVARSKGDSLLWGGSLIEYARVEQWMDFGATEVDPNIARWLYPRLGYM  120

Query  428  IY  433
             Y
Sbjct  121  PY  122



>ref|NP_001057916.1| Os06g0571400 [Oryza sativa Japonica Group]
 sp|Q5Z627.1|EF1G3_ORYSJ RecName: Full=Elongation factor 1-gamma 3; Short=EF-1-gamma 3; 
AltName: Full=eEF-1B gamma 3 [Oryza sativa Japonica Group]
 dbj|BAD61828.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAD61932.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAF19830.1| Os06g0571400 [Oryza sativa Japonica Group]
 dbj|BAG90811.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96325.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH  + NKNAF ALI AEY GVKVELT NF+MGVSNKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   EGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFG  120

Query  428  IYLP  439
             Y+P
Sbjct  121  PYVP  124



>gb|ACJ84952.1| unknown [Medicago truncatula]
Length=227

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LHS   NKNA+ A I AEY  V+++LT NF+MGVSNKTP+FL MNP+GKVPVLETP
Sbjct  1    MALILHSGEINKNAYKARIAAEYASVQLQLTPNFEMGVSNKTPQFLDMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA+   +N L+GSSLI+Y  IEQW DF++ E+D+N  KWLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVARQNNNNTLYGSSLIQYAQIEQWIDFSSLEVDSNINKWLYPRLGYG  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>gb|ACG36145.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNAF ALI AEY G+KVELT +F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPRLGYL  120

Query  428  IYL  436
             Y+
Sbjct  121  PYV  123



>ref|XP_008647353.1| PREDICTED: uncharacterized protein LOC100192872 isoform X1 [Zea 
mays]
 gb|AFW76478.1| elongation factor gamma1 [Zea mays]
Length=417

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNAF ALI AEY G+KVELT +F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPRLGYL  120

Query  428  IYL  436
             Y+
Sbjct  121  PYV  123



>ref|XP_007222927.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
 gb|EMJ24126.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
Length=472

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +2

Query  53   F*SEAMALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVP  232
            F ++AMALVLH+   NKNAF  LIVAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP
Sbjct  46   FSAKAMALVLHAGKTNKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVP  105

Query  233  VLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  412
            +L TPDGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  P
Sbjct  106  LLVTPDGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRP  165

Query  413  RLGFVIYLPPA  445
            R G  +YLPPA
Sbjct  166  RFGSAVYLPPA  176



>ref|XP_002325529.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|EEE99910.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|ADB11386.1| gamma class glutathione transferase EF1Bgamma1 [Populus trichocarpa]
Length=426

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNA   LI AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNALKTLIAAEYSGVQVELVKNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYV ++K DNPL+GSSLIEY  IEQW DFA  EIDAN  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIEYARIEQWIDFATLEIDANILRWFIPRIGFA  120

Query  428  IYL  436
            +YL
Sbjct  121  VYL  123



>gb|ADB11388.1| gamma class glutathione transferase EF1Bgamma3 [Populus trichocarpa]
Length=421

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+   NKNA+  LI AEY GV V+L  NF+M V+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHAGKTNKNAYKTLIAAEYSGVDVKLAENFEMRVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYV ++K DN L+GSSLIEY  IEQW DFAATEIDA  +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRLKADNHLYGSSLIEYARIEQWIDFAATEIDAGISKWLYPRLGYQ  120

Query  428  IYLPPA  445
             YLPPA
Sbjct  121  PYLPPA  126



>gb|EAZ37421.1| hypothetical protein OsJ_21756 [Oryza sativa Japonica Group]
Length=440

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  65   AMALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLET  244
             MALVLH  + NKNAF ALI AEY GVKVELT NF+MGVSNKTPEFLKMNP+GK+PVLET
Sbjct  24   GMALVLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLET  83

Query  245  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            P+G +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF
Sbjct  84   PEGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGF  143

Query  425  VIYLP  439
              Y+P
Sbjct  144  GPYVP  148



>gb|AAO72574.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=409

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            NKNAF ALI AEY GVKVEL  NFQMGVSNKTPEFLKMNPIGK+PVLETPDGP+FESNAI
Sbjct  2    NKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETPDGPVFESNAI  61

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  436
            ARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG   Y+
Sbjct  62   ARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIAPYV  114



>ref|XP_002438602.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
 gb|EER89969.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
Length=417

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNAF ALI AEY GVKVELT +F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGVKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG +FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLGF+
Sbjct  61   DGAVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWVDFAATEVDPGVAWYLYPRLGFI  120

Query  428  IY  433
             Y
Sbjct  121  PY  122



>ref|XP_010030200.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 ref|XP_010030201.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 gb|KCW57149.1| hypothetical protein EUGRSUZ_I02782 [Eucalyptus grandis]
Length=419

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALV+H+   NKN + ALI AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGK+PVLETP
Sbjct  1    MALVVHA-TSNKNVYKALIAAEYTGVKVELAPNFEMGVSNKTPEFIKMNPIGKIPVLETP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DF++ E+DAN   WL PR+G  
Sbjct  60   DGPVFESNAIARYVCRLKADNPLYGSSLIDYAHIEQWIDFSSLEVDANILNWLRPRMGRA  119

Query  428  IYLPPA  445
            +YLPPA
Sbjct  120  VYLPPA  125



>ref|NP_001148829.1| elongation factor 1-gamma 3 [Zea mays]
 gb|ACG33050.1| elongation factor 1-gamma 3 [Zea mays]
 gb|AFW87009.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNAF ALI AEY GVKVELT +F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGVKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D     +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVGWYLYPRLGYI  120

Query  428  IY  433
             Y
Sbjct  121  PY  122



>gb|EEC80835.1| hypothetical protein OsI_23436 [Oryza sativa Indica Group]
Length=458

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH  + NKNAF ALI AEY GVKVELT NF+MGVSNKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   EGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFG  120

Query  428  IYLP  439
             Y+P
Sbjct  121  PYVP  124



>gb|EEE56572.1| hypothetical protein OsJ_05923 [Oryza sativa Japonica Group]
Length=479

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 106/130 (82%), Gaps = 9/130 (7%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  253
            +VLH+ + NKNAF ALI AEY GVKVEL  NFQMGVSNKTPE+LKMNPIGKVP+LETPDG
Sbjct  55   IVLHTFDGNKNAFKALIAAEYSGVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETPDG  114

Query  254  PIFESNAIARY---------VAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWL  406
            P+FESNAIARY         V + K DNPL+GSSLIEY HIEQW DF+ATE+DANT KWL
Sbjct  115  PVFESNAIARYVLSSSHFPEVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWL  174

Query  407  YPRLGFVIYL  436
            +PRLGF  Y+
Sbjct  175  FPRLGFAPYV  184



>ref|XP_010683294.1| PREDICTED: elongation factor 1-gamma 2-like [Beta vulgaris subsp. 
vulgaris]
Length=418

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNA+ ALI AEY GVKV++  +FQMGV+NK+PEFLKMNPIGKVPVL TP
Sbjct  1    MALVLHSGLPNKNAYKALIAAEYSGVKVDVVKDFQMGVTNKSPEFLKMNPIGKVPVLATP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYV ++K DNPLFGSS  EY  IEQW DFA+ EIDA+ A+WLYPRLG+ 
Sbjct  61   EGPLFESNAIARYVTRLKADNPLFGSSTYEYALIEQWIDFASLEIDAHIARWLYPRLGYF  120

Query  428  IYLPPA  445
            ++LPPA
Sbjct  121  VHLPPA  126



>ref|XP_011031541.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031542.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031543.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
Length=426

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNA   LI AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNALKTLIAAEYSGVQVELVKNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYV ++K DNPL+GSSL+EY  IEQW DFA  EIDAN  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLMEYARIEQWIDFATLEIDANILRWFIPRIGFS  120

Query  428  IYL  436
            +YL
Sbjct  121  VYL  123



>ref|XP_006389499.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ERP48413.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=421

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+L++   NKNA+  LI AEY GV V+L  NF+M V+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILYAGKTNKNAYKTLIAAEYSGVDVKLAENFEMRVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYV ++K DN L+GSSLIEY  IEQW DFAATEIDA  +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRLKADNHLYGSSLIEYARIEQWIDFAATEIDAGISKWLYPRLGYQ  120

Query  428  IYLPPA  445
             YLPPA
Sbjct  121  PYLPPA  126



>gb|EEC72757.1| hypothetical protein OsI_06402 [Oryza sativa Indica Group]
Length=479

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 105/130 (81%), Gaps = 9/130 (7%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  253
            +VLH+ + NKNAF ALI AEY GVKVEL  NFQMGVSNKTPE+LKMNPIGKVP+LETPDG
Sbjct  55   IVLHTFDGNKNAFKALIAAEYSGVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETPDG  114

Query  254  PIFESNAIARY---------VAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWL  406
            P+FESN IARY         V + K DNPL+GSSLIEY HIEQW DF+ATE+DANT KWL
Sbjct  115  PVFESNVIARYVLSSSHFPEVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWL  174

Query  407  YPRLGFVIYL  436
            +PRLGF  Y+
Sbjct  175  FPRLGFAPYV  184



>ref|XP_004966044.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNA+ ALI AEY GVKVEL  NF+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSFPGNKNAYKALIAAEYSGVKVELNKNFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG +FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A++L+PRLGF+
Sbjct  61   DGAVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWIDFAATEVDPGIARYLFPRLGFM  120

Query  428  IYLPPA  445
             Y+  A
Sbjct  121  PYVQTA  126



>ref|XP_008352808.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=424

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  253
            LVLH+ + NKN F ALI AE+ GVKVEL  NF+MGVSNK+P+FL+MNPIGKVPVLETPDG
Sbjct  5    LVLHAGSTNKNGFKALIAAEFSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETPDG  64

Query  254  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
            PIFESNAIARYV ++K DNPL+GSSLIEY  +EQW DFA  EIDAN  +WL P +GF +Y
Sbjct  65   PIFESNAIARYVTRLKADNPLYGSSLIEYARVEQWIDFATLEIDANILRWLIPLIGFSVY  124

Query  434  LPP  442
            LPP
Sbjct  125  LPP  127



>ref|XP_008218696.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
 ref|XP_008218697.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
Length=422

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNAF  LIVAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLVTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESN IARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  PR G  
Sbjct  61   DGPIFESNTIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRPRFGHA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>gb|AIZ68134.1| translation elongation factor 1-gamma [Ornithogalum saundersiae]
Length=414

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS ++NKNA+ +LI AEY GV+VEL  +FQMGVSNKTPEF+KMNP+GK+PVL+TP
Sbjct  1    MALVLHSTSDNKNAWKSLIAAEYSGVQVELVKDFQMGVSNKTPEFIKMNPLGKIPVLQTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K DNPL GSSLIEY +IEQW DFA TEID++ + WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLHGSSLIEYANIEQWMDFAVTEIDSSISAWLYPRLGYR  120

Query  428  IYLPPA  445
             ++  A
Sbjct  121  PFIQQA  126



>ref|XP_008365338.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=331

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKN + ALIVAEY GVKVEL  NF+MGV+NKTPEFLK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALIVAEYSGVKVELAPNFEMGVTNKTPEFLKLNPIGKVPLLVTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL GSSLI+Y  IEQW DF + EIDAN   W  PR+G  
Sbjct  61   DGPIFESNAIARYVARLKXDNPLCGSSLIDYARIEQWIDFGSMEIDANVLNWWVPRMGRR  120

Query  428  IYLPPA  445
             YLPPA
Sbjct  121  AYLPPA  126



>gb|AGC13156.1| EF1Bgamma class glutathione S-transferase, partial [Pinus tabuliformis]
Length=225

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL LH+ + NKNAF ALI AEY GVKV L  NF+MG   K+PEFLKMNPIGKVPVLETP
Sbjct  1    MALTLHAGSTNKNAFKALISAEYVGVKVSLAPNFEMG-GTKSPEFLKMNPIGKVPVLETP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G +FESNAIARYVA++K  N LFGSS+I+Y H+EQW DF+  EID N  +W YPRLGF 
Sbjct  60   EGAVFESNAIARYVARLKGVNSLFGSSVIDYAHVEQWIDFSTLEIDINITRWFYPRLGFG  119

Query  428  IYLPPA  445
            +YLPPA
Sbjct  120  VYLPPA  125



>gb|AFW76477.1| elongation factor gamma1 [Zea mays]
Length=291

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNAF ALI AEY G+KVELT +F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL  418
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYP++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPKV  117



>gb|AAO72563.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=413

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            VLH  + NKNAF ALI AEY GVKVELT NF+MGVSNKTPEFLKMNP+GK+PVLETP+G 
Sbjct  1    VLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETPEGA  60

Query  257  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  436
            +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF  Y+
Sbjct  61   VFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFGPYV  120

Query  437  P  439
            P
Sbjct  121  P  121



>ref|XP_004300001.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=420

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNA+  LI AEY GVKV L  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNAYKTLIAAEYTGVKVALAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYV +++ DNPL+GSS I+Y HIEQW DF + EIDAN   WL PR+G  
Sbjct  61   DGPIFESNAIARYVTRLQADNPLYGSSSIDYAHIEQWIDFGSLEIDANLGNWLRPRMGRG  120

Query  428  IYL  436
            +YL
Sbjct  121  VYL  123



>gb|AHZ94964.1| elongation factor 1, partial [Lilium regale]
Length=405

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            NKNAF ALI AEY GVK+EL  NF+MGVSNKTP+FLKMNP+GK+PVLETPDG +FESNAI
Sbjct  1    NKNAFKALIAAEYSGVKIELVKNFEMGVSNKTPDFLKMNPLGKIPVLETPDGAVFESNAI  60

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPA  445
            ARYV + KPDNPL GSSLIEY  IEQW DFA+ EID N  +WLYPRLG+VIY+  A
Sbjct  61   ARYVTRTKPDNPLHGSSLIEYAQIEQWIDFASFEIDINLGRWLYPRLGYVIYIAQA  116



>ref|XP_003540135.1| PREDICTED: elongation factor 1-gamma-like [Glycine max]
 gb|KHN11054.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59626.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=418

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+   NKNAF  LI AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKTNKNAFKTLIAAEYSGVQVELAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K DN LF SS I+  HI+QW DF++ EIDAN  K L PRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDNALFSSSAIDNAHIDQWIDFSSLEIDANLMKLLLPRLGFA  120

Query  428  IYLPP  442
             YLPP
Sbjct  121  PYLPP  125



>gb|ACU24584.1| unknown [Glycine max]
Length=418

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+   NKNAF  LI AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKTNKNAFKTLIAAEYSGVQVELAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K DN LF SS I+  HI+QW DF++ EIDAN  K L PRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDNALFSSSAIDNAHIDQWIDFSSLEIDANLMKLLLPRLGFA  120

Query  428  IYLPP  442
             YLPP
Sbjct  121  PYLPP  125



>ref|XP_011470423.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +2

Query  50   SF*SEAMALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKV  229
            SF  +AMALVLH+ + NKNA+  LI A Y GV+V L  NF+MGVSNKTPEFLKMNPIGKV
Sbjct  54   SFFPQAMALVLHAGSTNKNAYKTLIAAGYTGVQVALAPNFEMGVSNKTPEFLKMNPIGKV  113

Query  230  PVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLY  409
            PVLETPDGPIFESNAIARYV +++ DNPL+GSS I+Y HIEQW DF + EIDAN   WL 
Sbjct  114  PVLETPDGPIFESNAIARYVTRLQADNPLYGSSSIDYAHIEQWIDFGSLEIDANLGNWLR  173

Query  410  PRLGFVIYL  436
            PR+G  +YL
Sbjct  174  PRMGRGVYL  182



>gb|KEH32762.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   189 bits (479),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LHS   NKNA+ A I AEY  V+++LT NF+MGVSNKTP+FL MNP+GKVPVLETP
Sbjct  1    MALILHSGEINKNAYKARIAAEYASVQLQLTPNFEMGVSNKTPQFLDMNPLGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA+   +N L+GSSLI+Y  IEQW DF++ E+D+N  KWLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVARQNNNNTLYGSSLIQYAQIEQWIDFSSLEVDSNINKWLYPRLGYG  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|XP_009355338.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKN + ALIVAEY GVKVEL  NF+MGV+NKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALIVAEYSGVKVELAPNFEMGVTNKTPEYLKLNPIGKVPLLVTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W   R+G  
Sbjct  61   DGPIFESNAIARYVARLKADNPLCGSSLIDYAHIEQWIDFGSLEIDANILNWWLSRVGRR  120

Query  428  IYLPP  442
            +YLPP
Sbjct  121  VYLPP  125



>ref|XP_009388887.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=290

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            VLH+   NKN   ALI AEY GV++E+  NFQMGVSN TPEFLKMNPIGKVP+LETPDGP
Sbjct  32   VLHATRTNKNGIKALIAAEYSGVEIEMAKNFQMGVSNTTPEFLKMNPIGKVPLLETPDGP  91

Query  257  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  436
            IFESNAIARYVA++K DNPL+GSSL EY  IEQW DFA+TEID N A+W YPR G   Y 
Sbjct  92   IFESNAIARYVARLKADNPLYGSSLFEYALIEQWIDFASTEIDPNIAQWFYPRHGLKPYF  151



>gb|KDP42461.1| hypothetical protein JCGZ_00258 [Jatropha curcas]
Length=423

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNAF  LI AEY GV V+L  NF+MGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHSGKTNKNAFKTLIAAEYSGVNVKLVENFEMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYV ++K +NPL GSS  EY  IEQW DFA+ EIDAN   WL PR G  
Sbjct  61   DGPLFESNAIARYVTRLKANNPLLGSSTYEYALIEQWIDFASLEIDANILGWLVPRFGRS  120

Query  428  IYLPPA  445
             YLPPA
Sbjct  121  PYLPPA  126



>ref|NP_001241223.1| uncharacterized protein LOC100787125 [Glycine max]
 gb|ACU24574.1| unknown [Glycine max]
 gb|AJE59627.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=419

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+   NKNAF  LI AEY GV+VEL  NF+MGVSN+TPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKANKNAFKTLIAAEYSGVQVELAPNFEMGVSNRTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++K DN LF SS I+  HI+QW DF++ EIDAN  K   PRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDNALFSSSAIDNAHIDQWIDFSSLEIDANIMKLYLPRLGFA  120

Query  428  IYLPP  442
             YLPP
Sbjct  121  PYLPP  125



>gb|ABK25057.1| unknown [Picea sitchensis]
Length=424

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL LH+ + NKNAF ALI AEY GVK+ L  NF+MGV+NK+ +FL MNPIGKVPVLETP
Sbjct  1    MALTLHAGHTNKNAFKALIAAEYVGVKINLAPNFEMGVTNKSQKFLSMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G +FESNAIARYVA++K DN LFGSSLI+YGH+EQW DF++ EID N  +W +PR+G  
Sbjct  61   EGAVFESNAIARYVARLKDDNSLFGSSLIDYGHVEQWIDFSSLEIDINIMRWYFPRMGHG  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  LYLPPA  126



>gb|AHC03515.1| gamma class glutathione S-transferase [Larix kaempferi]
Length=422

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL LH+ N NKNAF ALI AEY GVK+ L  NF+MGV+NK+PEFL MNPIGKVPVLETP
Sbjct  1    MALTLHAGNGNKNAFKALIAAEYVGVKIGLAPNFEMGVTNKSPEFLNMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G +FESNAIARYVA++K DN LFG SLI+  H+EQW DF++ EID N  +W +PRLG+ 
Sbjct  61   EGTVFESNAIARYVARLKGDNTLFGFSLIDCAHVEQWIDFSSLEIDINITRWYFPRLGYG  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  LYLPPA  126



>ref|XP_006845799.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
 gb|ERN07474.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
Length=430

 Score =   186 bits (473),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            +LH+ + NKNAF  LI AEY GV+V+L  +F+MGVSNKTPEFLKMNP+GKVPVLETP GP
Sbjct  11   ILHAGSNNKNAFKPLIAAEYTGVEVKLVESFEMGVSNKTPEFLKMNPMGKVPVLETPKGP  70

Query  257  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  436
            IFESNAIARYVA++K DN L+GSSL EY  IEQW DFA+ EID +T++W YPRLGF++YL
Sbjct  71   IFESNAIARYVARLKGDNILYGSSLFEYALIEQWIDFASLEIDTHTSRWFYPRLGFMVYL  130

Query  437  P  439
            P
Sbjct  131  P  131



>ref|XP_004308137.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=420

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+ + NKNA+  LI A Y GV+V L  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNAYKTLIAAGYTGVQVALAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYV +++ DNPL+GSS I+Y HIEQW DF + EIDAN   WL PR+G  
Sbjct  61   DGPIFESNAIARYVTRLQADNPLYGSSSIDYAHIEQWIDFGSLEIDANLGNWLRPRMGRG  120

Query  428  IYL  436
            +YL
Sbjct  121  VYL  123



>ref|XP_010907209.1| PREDICTED: elongation factor 1-gamma 2-like [Elaeis guineensis]
Length=419

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+L++ + NKN F ALI AE  GV+VEL  NF+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALILYAGSTNKNGFKALIAAECSGVQVELAKNFEMGVSNKTPEFLKMNPMGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPI ESNAIARYV ++K DNPLFG SLI+Y  IEQW DFA+ EIDAN + WLYPR+G++
Sbjct  61   DGPISESNAIARYVTRLKADNPLFGYSLIDYARIEQWIDFASIEIDANISWWLYPRMGYI  120



>gb|KHN03584.1| Elongation factor 1-gamma [Glycine soja]
Length=420

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  253
            L+LH+   NKN++  LI AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHAGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  254  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
            PIFESNAIARYV ++K DN L+GSSLIEY HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PIFESNAIARYVTRLKGDNTLYGSSLIEYAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  434  LPPA  445
            LPPA
Sbjct  124  LPPA  127



>ref|XP_006600242.1| PREDICTED: elongation factor 1-gamma isoform X1 [Glycine max]
 gb|AJE59628.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  253
            L+LH+   NKN++  LI AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHAGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  254  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
            PIFESNAIARYV ++K DN L+GSSLIEY HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PIFESNAIARYVTRLKGDNTLYGSSLIEYAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  434  LPPA  445
            LPPA
Sbjct  124  LPPA  127



>ref|XP_008456982.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=422

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M LVLH+   NKN+F ALI AEY GV+V++  +F+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MVLVLHAGKTNKNSFKALIAAEYNGVEVKVVPDFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYVA++K D+PL+GS LI+YGHIEQW +FA+ E+D+N   W  PR+G  
Sbjct  61   NGPIFESNAIARYVARLKADSPLYGSFLIDYGHIEQWIEFASLEVDSNILTWFRPRMGRA  120

Query  428  IYLPP  442
             YLPP
Sbjct  121  AYLPP  125



>ref|XP_010101278.1| Elongation factor 1-gamma [Morus notabilis]
 gb|EXB88213.1| Elongation factor 1-gamma [Morus notabilis]
Length=460

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 100/137 (73%), Gaps = 14/137 (10%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            VL++ N NKN F  LI AEY GVK+EL  NF+MG+SNKTPEFLKMNPIGKVPVL+TPDGP
Sbjct  23   VLYAGNTNKNGFKVLIAAEYSGVKIELVKNFEMGISNKTPEFLKMNPIGKVPVLQTPDGP  82

Query  257  IFESNAIARY--------------VAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANT  394
            IFESNAIARY                 +K DNPLFGSSLI+Y H+EQW DFA  EID N 
Sbjct  83   IFESNAIARYGENKLRIPYSAYENFTHLKADNPLFGSSLIDYAHVEQWIDFATLEIDTNI  142

Query  395  AKWLYPRLGFVIYLPPA  445
             +W  PR+GF +YLPPA
Sbjct  143  LRWFIPRIGFSVYLPPA  159



>gb|AGC13144.1| EF1Bgamma class glutathione S-transferase [Pinus tabuliformis]
Length=421

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL LH+ + NKN F A I AEY GVK+ L  NF MG SNK+PEFLKMNPIGK+PVLETP
Sbjct  1    MALTLHASSINKNGFKARITAEYAGVKLNLAPNFVMGESNKSPEFLKMNPIGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G +FESN IARYVA++K DN LFGSSLI+Y H+EQW DF++ EIDAN  +W +PR+G  
Sbjct  61   EGAVFESNVIARYVARLKGDNTLFGSSLIDYAHVEQWIDFSSIEIDANVMRWYFPRIGSG  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|NP_001235707.1| elongation factor 1-gamma [Glycine max]
 gb|AAL82617.1|AF475939_1 elongation factor 1-gamma [Glycine max]
Length=420

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  253
            L+LH+   NKN++  LI AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHAGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  254  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
            PIFESNAIARYV ++K DN L+GSSLIEY HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PIFESNAIARYVTRLKGDNTLYGSSLIEYAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  434  LPPA  445
            LPP 
Sbjct  124  LPPT  127



>ref|XP_010553691.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=415

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALV+H+   NK AF ALI AEY GVK+E+  +FQMGV+NK+PEFLK+NPIGKVPVLETP
Sbjct  1    MALVMHTYPGNKGAFKALIAAEYTGVKIEVPSDFQMGVTNKSPEFLKLNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV+++K DN L GSSLIEY  IEQW DFA+ E+D N  +W  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRLKGDNSLVGSSLIEYAQIEQWIDFASMEVDVNILRWFAPRMGYA  120

Query  428  IYLPPA  445
             +L PA
Sbjct  121  PFLAPA  126



>ref|XP_010414808.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=244

 Score =   176 bits (447),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK AF AL+ AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALVAAEYAGVKIEEAADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G IFESNAIARYV++   +N L GSSLIEY  IEQW DF++ EIDAN  KW  PRLG+ 
Sbjct  61   EGAIFESNAIARYVSRKNGENSLNGSSLIEYAQIEQWIDFSSLEIDANMLKWFAPRLGYA  120

Query  428  IYLPPA  445
             +  PA
Sbjct  121  PFSAPA  126



>ref|NP_001242737.1| uncharacterized protein LOC100810452 [Glycine max]
 gb|ACU18062.1| unknown [Glycine max]
Length=420

 Score =   181 bits (459),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  253
            L+LH    NKN++  LI AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHGGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  254  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
            P+FESNAIARYV ++K DN L+GSSLIE+ HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PVFESNAIARYVTQLKGDNTLYGSSLIEHAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  434  LPPA  445
            LPPA
Sbjct  124  LPPA  127



>gb|KHN40193.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59625.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   181 bits (459),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  253
            L+LH    NKN++  LI AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHGGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  254  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
            P+FESNAIARYV ++K DN L+GSSLIE+ HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PVFESNAIARYVTQLKGDNTLYGSSLIEHAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  434  LPPA  445
            LPPA
Sbjct  124  LPPA  127



>ref|XP_008218698.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=420

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVL++   ++  F   IVAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLYAVKGHEYGFKTRIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLVTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  PR G  
Sbjct  61   DGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANVMSWFKPRFGSA  120

Query  428  IYLPPA  445
            +YLPPA
Sbjct  121  VYLPPA  126



>ref|XP_006392370.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 ref|XP_006392371.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29656.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29657.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=414

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK A+ ALI AEY GVK+E   NFQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAYKALIAAEYVGVKIEEPSNFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV+++  +N L GSSLI+Y HIEQW DFA  EIDAN  +W  PR+GF 
Sbjct  61   EGPIFESNAIARYVSRLNGENSLNGSSLIDYAHIEQWIDFATLEIDANMLRWFAPRMGFA  120

Query  428  IYLPPA  445
             +  PA
Sbjct  121  PFSAPA  126



>ref|XP_004485430.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Cicer arietinum]
 ref|XP_004485431.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Cicer arietinum]
Length=420

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+   NKNA+ ALI AEY GV+VEL  +FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKGNKNAYKALIAAEYVGVQVELVPDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYVA+   D  LFGSSLI++ +++QW DF++ EID N  K   PRLG+ 
Sbjct  61   EGPVFESNAIARYVARSNGDKTLFGSSLIDHANVDQWIDFSSFEIDTNIMKLYLPRLGYA  120

Query  428  IYLPP  442
             YLPP
Sbjct  121  PYLPP  125



>dbj|BAH56923.1| AT1G57720 [Arabidopsis thaliana]
Length=391

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALV+H+   NK A  ALI AEY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV++   DN L GSSLIEY HIEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  428  IYLPPA  445
             +  PA
Sbjct  121  PFSAPA  126



>gb|AAK59587.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
Length=413

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALV+H+   NK A  ALI AEY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV++   DN L GSSLIEY HIEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  428  IYLPPA  445
             +  PA
Sbjct  121  PFSAPA  126



>ref|NP_176084.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 ref|NP_001031202.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|Q9FVT2.1|EF1G2_ARATH RecName: Full=Probable elongation factor 1-gamma 2; Short=EF-1-gamma 
2; AltName: Full=eEF-1B gamma 2 [Arabidopsis thaliana]
 gb|AAG50755.1|AC079733_23 elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAK43879.1|AF370502_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL11623.1|AF424630_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL16277.1|AF428347_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL47343.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47351.1| At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAM62488.1| elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAN41373.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
 gb|AEE33455.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 gb|AEE33456.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=413

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALV+H+   NK A  ALI AEY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV++   DN L GSSLIEY HIEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  428  IYLPPA  445
             +  PA
Sbjct  121  PFSAPA  126



>ref|XP_010544111.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=416

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK A  ALI AEY GV++E+  +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGANKALIAAEYTGVQIEVPSDFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV+++K DN L GSSLIEY  IEQW DFA+ E+D N  +W  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRLKGDNSLVGSSLIEYAQIEQWIDFASMEVDVNILRWFIPRVGYA  120

Query  428  IYLPP  442
             +L P
Sbjct  121  PFLAP  125



>gb|EMT01475.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=604

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  95   ENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNA  274
            E +     LI AEY GV VEL  +FQMGVSN TP+FLKMNPIGKVPVLETPDGP+FESNA
Sbjct  191  ETRMRLRHLIAAEYSGVNVELVKDFQMGVSNHTPDFLKMNPIGKVPVLETPDGPVFESNA  250

Query  275  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  436
            IARYVA++K D+PL+GSSL+EY HIEQW DF+ TE+DAN  KWLYPRLGF  Y+
Sbjct  251  IARYVARMKADSPLYGSSLMEYSHIEQWIDFSTTEVDANIGKWLYPRLGFYPYV  304



>ref|XP_002892012.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68271.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
Length=413

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALV+H+   NK A  AL+ AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALVAAEYAGVKIEEASDFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV++   DN L GSSLIEY H+EQW DFA+ EIDA+  KW  PRLGF 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHVEQWIDFASLEIDAHMLKWFAPRLGFA  120

Query  428  IYLPPA  445
             +  PA
Sbjct  121  PFSAPA  126



>ref|XP_007153909.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
 gb|ESW25903.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
Length=420

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  253
            L+LH    NKN++  LI A+Y GV+VEL  NF+MGVSNKTP+FL+MNPIGKVPVLETPDG
Sbjct  4    LILHGGKTNKNSYKTLIAAQYAGVQVELAPNFEMGVSNKTPQFLQMNPIGKVPVLETPDG  63

Query  254  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
            P+FESN+IARYVA++  DN L+GSS  EY  IEQW DF++ EIDAN  KW  PR G   Y
Sbjct  64   PVFESNSIARYVARLSGDNTLYGSSFFEYAQIEQWIDFSSLEIDANIIKWYAPRFGRGPY  123

Query  434  LPPA  445
            LPPA
Sbjct  124  LPPA  127



>ref|NP_001274793.1| elongation factor 1-gamma 2-like [Solanum tuberosum]
 gb|ABB87108.1| putative elongation factor 1-gamma-like [Solanum tuberosum]
Length=414

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LHS N NKN   ALI AEY GVKV+L  +FQMGVSNKTPEFL+MNPIGKVPVL+TP
Sbjct  1    MALILHSTNNNKNTSKALIAAEYTGVKVDLAKDFQMGVSNKTPEFLEMNPIGKVPVLQTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPL-FGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
             GP+FESNAIARYV   +    L FGSS  EY   EQW DF+ATE+DAN A+WLYPRLG+
Sbjct  61   YGPVFESNAIARYVTNNETLTILYFGSSFFEYPLCEQWNDFSATEVDANIARWLYPRLGY  120

Query  425  VIYLPPA  445
             +Y+P A
Sbjct  121  GVYIPQA  127



>ref|XP_010511351.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=414

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK AF AL+ AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALVAAEYAGVKIEEAADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV++   +N L GSSLIEY  IEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGENSLNGSSLIEYAQIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  428  IYLPPA  445
             +  PA
Sbjct  121  PFSAPA  126



>ref|XP_010470318.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=413

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK AF AL+ AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALVAAEYAGVKIEEAADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G IFESNAIARYV++   +N L GSSLIEY  IEQW DF++ EIDAN  KW  PRLG+ 
Sbjct  61   EGAIFESNAIARYVSRKNGENSLNGSSLIEYAQIEQWIDFSSLEIDANMLKWFAPRLGYA  120

Query  428  IYLPPA  445
             +  PA
Sbjct  121  PFSAPA  126



>ref|XP_008365322.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Malus domestica]
Length=419

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKN +  LIVAEY GVKV L  NF++GV+NKTPE+LK+NPIGK P+L TP
Sbjct  1    MALVLHAGKTNKNGYKVLIVAEYSGVKV-LAPNFEIGVTNKTPEYLKLNPIGKYPLLITP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++KPDNPL GSSLI+Y HIEQW DF + EIDAN   W  PR+G  
Sbjct  60   DGPIFESNAIARYVARLKPDNPLCGSSLIDYAHIEQWIDFGSMEIDANVLNWWLPRVGQR  119

Query  428  IY  433
            +Y
Sbjct  120  VY  121



>gb|EPS67955.1| elongation factor 1 gamma-like protein, partial [Genlisea aurea]
Length=422

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            +LHS  +NKN   ALI AEY GVKVEL  +F+MGVSNKTPEF+KMNPIGK+PVLETPDG 
Sbjct  1    ILHS-TQNKNTNKALIAAEYNGVKVELVKDFEMGVSNKTPEFIKMNPIGKIPVLETPDGA  59

Query  257  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  436
            IFESNAIARYVA+  P+  LFG++LI+Y HIEQW DF+  EIDAN   WL PR+G   Y 
Sbjct  60   IFESNAIARYVARSNPNTELFGANLIDYAHIEQWIDFSTNEIDANILSWLLPRVGRRPYF  119

Query  437  PPA  445
            PPA
Sbjct  120  PPA  122



>ref|XP_006302321.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
 gb|EOA35219.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
Length=413

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK AF ALI  EY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALIAGEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV++   DN L GSSLIEY  IEQW DF+  EID++  KW  PR G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAQIEQWIDFSTLEIDSHMLKWFAPRAGYA  120

Query  428  IYLPPA  445
             +  PA
Sbjct  121  PFSAPA  126



>ref|XP_003592902.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|AES63153.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = +2

Query  71   ALVLHSPNE-NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            AL+LH+PN  NKN +  LI AEY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLETP
Sbjct  3    ALILHAPNNGNKNVYKTLIAAEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETP  62

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  428  IYLPP  442
             Y PP
Sbjct  122  TYFPP  126



>ref|XP_003592901.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|ABE91935.1| Elongation factor 1, gamma chain; Glutathione S-transferase, 
C-terminal; Thioredoxin-like fold [Medicago truncatula]
 gb|AES63152.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = +2

Query  71   ALVLHSPNE-NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            AL+LH+PN  NKN +  LI AEY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLETP
Sbjct  3    ALILHAPNNGNKNVYKTLIAAEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETP  62

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  428  IYLPP  442
             Y PP
Sbjct  122  TYFPP  126



>emb|CDY22629.1| BnaC08g42630D [Brassica napus]
Length=415

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNA  ALI AEY GVK+++  +F MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHTYKGNKNADKALIAAEYVGVKIDVPSDFAMGVTNKTPEFLKMNPMGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYV+++  +N L GSSLIEY H+EQW+DF+  EI  N  KW  PR+GF+
Sbjct  61   EGPVFESNAIARYVSRLNGENSLNGSSLIEYAHVEQWSDFSTLEIYGNILKWFGPRMGFM  120

Query  428  IYLPPA  445
             Y  P 
Sbjct  121  PYSAPG  126



>ref|NP_001184949.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 dbj|BAH56947.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28473.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=265

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK+A  ALI AEY GV++++  +FQMGV+NKTP FLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSAEKALIAAEYVGVQIDVPSDFQMGVTNKTPAFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G +FESNAIARYV+++  DN L GSSLIEY  IEQW DF++ EI A+  +W  PR+GF+
Sbjct  61   EGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQIEQWIDFSSLEIYASILRWFGPRMGFM  120

Query  428  IYLPPA  445
             Y  PA
Sbjct  121  PYSAPA  126



>ref|XP_009118302.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNA  ALI AEY GVK+++  +F MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHTYKGNKNADKALIAAEYVGVKIDVPSDFAMGVTNKTPEFLKMNPMGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYV+++  +N L GSSLIEY H+EQW+DF+  EI  N  KW  PR+GF+
Sbjct  61   EGPVFESNAIARYVSRLNGENSLNGSSLIEYAHVEQWSDFSTLEIYGNILKWFGPRMGFM  120

Query  428  IYLPPA  445
             Y  P 
Sbjct  121  PYSAPG  126



>ref|XP_008452241.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=410

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNAF ALI AEY GVKV+L+ +F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAFKALIAAEYNGVKVDLSPDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID N +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDNNLSVILRPRFGYA  119

Query  428  IYLP  439
            +Y P
Sbjct  120  VYHP  123



>ref|XP_002889762.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66021.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
Length=414

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK+A  ALI AEY GVK+++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVKIDVPSDFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G +FESNAIARYV+++  DN L GSSLIEY  +EQW+DFA+ EI  N  +W  PR+GF+
Sbjct  61   EGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQVEQWSDFASLEIYGNILRWFGPRMGFM  120

Query  428  IYLPPA  445
             Y  PA
Sbjct  121  PYSAPA  126



>gb|AFK34308.1| unknown [Medicago truncatula]
Length=418

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = +2

Query  71   ALVLHSPNE-NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            AL+LH+PN  NKN +  LI  EY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLETP
Sbjct  3    ALILHAPNNGNKNVYKTLIAVEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETP  62

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  428  IYLPP  442
             Y PP
Sbjct  122  TYFPP  126



>emb|CDY06365.1| BnaA09g48380D [Brassica napus]
Length=413

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NKNA  ALI AEY GVK+++  +F MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHTYKGNKNADKALIAAEYVGVKIDVPSDFAMGVTNKTPEFLKMNPMGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GP+FESNAIARYV+++  +N L GSSLIEY H+EQW+DF+  EI  N  KW  PR+GF+
Sbjct  61   EGPVFESNAIARYVSRLNGENSLNGSSLIEYAHVEQWSDFSTLEIYGNILKWFGPRMGFM  120

Query  428  IY  433
             Y
Sbjct  121  PY  122



>ref|XP_006417552.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
 gb|ESQ35905.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
Length=413

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK+A  ALI AEY GVK+++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYAGVKIDVP-DFEMGVTNKTPEFLKMNPIGKVPVLETP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV+++  DN L GSSLIEY HIEQW+DF++ EI  N  KWL PRLG++
Sbjct  60   EGPIFESNAIARYVSRLNGDNSLNGSSLIEYAHIEQWSDFSSLEIYGNFWKWLGPRLGYM  119

Query  428  IY  433
             Y
Sbjct  120  PY  121



>ref|XP_001758671.1| predicted protein [Physcomitrella patens]
 gb|EDQ76649.1| predicted protein [Physcomitrella patens]
 gb|AFZ39148.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +2

Query  71   ALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPD  250
             LVLHSP  NKNA+  LI AEY GVKVE T +FQMGV+NKTPEFLK+NPIGKVPVL+TPD
Sbjct  3    GLVLHSPKVNKNAYKTLIAAEYVGVKVETTPDFQMGVTNKTPEFLKLNPIGKVPVLQTPD  62

Query  251  GPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVI  430
            GPIFESNA+ARYVA  K D  L GSS  E   +EQW DF++ E+DAN  +W+YPRLG+  
Sbjct  63   GPIFESNAMARYVAN-KKDVGLTGSSAYEKALVEQWIDFSSLEVDANIGRWVYPRLGYFA  121

Query  431  YL  436
            ++
Sbjct  122  FI  123



>ref|XP_004172027.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like, 
partial [Cucumis sativus]
Length=363

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   +KN +  LI AEY GVKV+L  +F MGVSNK+PEFLKMNPIGKVP+L+TP
Sbjct  1    MALVLHSWTPSKNVYKVLIAAEYNGVKVDLAPDFTMGVSNKSPEFLKMNPIGKVPLLQTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAI RYVA++K D+ LFGSS I+YGH+EQW DF++ EID + +  L PR G+ 
Sbjct  61   DGPIFESNAITRYVARLK-DSILFGSSPIDYGHVEQWIDFSSLEIDIHISTILAPRFGYG  119

Query  428  IYLPPA  445
            +Y  PA
Sbjct  120  VYHAPA  125



>emb|CDY20681.1| BnaC08g13770D [Brassica napus]
Length=558

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALV+HS   NKN+  A I AE+ GVK+++   F+MGV+NKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVMHSYKGNKNSDKAFIAAEFAGVKIDMPSGFEMGVTNKTPEFLKMNPLGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV+++  DN L GSSLIEY HIEQW DF++ EI  N   W  PR+GF+
Sbjct  61   EGPIFESNAIARYVSRLNGDNSLNGSSLIEYAHIEQWIDFSSLEIYGNIFNWFVPRMGFM  120

Query  428  IYLPPA  445
             Y  P 
Sbjct  121  PYSVPG  126



>gb|ACJ85171.1| unknown [Medicago truncatula]
Length=418

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 97/125 (78%), Gaps = 2/125 (2%)
 Frame = +2

Query  71   ALVLHSPNE-NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            AL+LH+PN  NKN +  LI  EY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLET 
Sbjct  3    ALILHAPNNGNKNVYKTLIAVEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETR  62

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  428  IYLPP  442
             Y PP
Sbjct  122  TYFPP  126



>ref|XP_010490215.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   168 bits (425),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK+A  ALI AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVK-PDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DFA+ EI  NT +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFASLEIYGNTLRWFGPRMGF  120

Query  425  VIYLPPA  445
            + Y  PA
Sbjct  121  MPYSAPA  127



>ref|XP_010458260.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   167 bits (424),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK+A  ALI AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVK-PDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DFA+ EI  NT +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFASLEIYGNTLRWFGPRMGF  120

Query  425  VIYLPPA  445
            + Y  PA
Sbjct  121  MPYSAPA  127



>gb|KGN56266.1| hypothetical protein Csa_3G110630 [Cucumis sativus]
Length=402

 Score =   167 bits (424),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   +KN +  LI AEY GVKV+L  +F MGVSNK+PEFLKMNPIGKVP+L+TP
Sbjct  1    MALVLHSWTPSKNVYKVLIAAEYNGVKVDLAPDFTMGVSNKSPEFLKMNPIGKVPLLQTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAI RYVA++K D+ LFGSS I+YGH+EQW DF++ EID + +  L PR G+ 
Sbjct  61   DGPIFESNAITRYVARLK-DSILFGSSPIDYGHVEQWIDFSSLEIDIHISTILAPRFGYG  119

Query  428  IYLPPA  445
            +Y  PA
Sbjct  120  VYHAPA  125



>ref|XP_004133719.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus]
Length=409

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   +KN +  LI AEY GVKV+L  +F MGVSNK+PEFLKMNPIGKVP+L+TP
Sbjct  1    MALVLHSWTPSKNVYKVLIAAEYNGVKVDLAPDFTMGVSNKSPEFLKMNPIGKVPLLQTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAI RYVA++K D+ LFGSS I+YGH+EQW DF++ EID + +  L PR G+ 
Sbjct  61   DGPIFESNAITRYVARLK-DSILFGSSPIDYGHVEQWIDFSSLEIDIHISTILAPRFGYG  119

Query  428  IYLPPA  445
            +Y  PA
Sbjct  120  VYHAPA  125



>ref|NP_563848.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|O04487.1|EF1G1_ARATH RecName: Full=Probable elongation factor 1-gamma 1; Short=EF-1-gamma 
1; AltName: Full=eEF-1B gamma 1 [Arabidopsis thaliana]
 gb|AAB60721.1| Similar to elongation factor 1-gamma (gb|EF1G_XENLA). ESTs gb|T20564,gb|T45940,gb|T04527 
come from this gene [Arabidopsis 
thaliana]
 dbj|BAH20206.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28472.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=414

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK+A  ALI AEY GV++++  +FQMGV+NKTP FLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSAEKALIAAEYVGVQIDVPSDFQMGVTNKTPAFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G +FESNAIARYV+++  DN L GSSLIEY  IEQW DF++ EI A+  +W  PR+GF+
Sbjct  61   EGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQIEQWIDFSSLEIYASILRWFGPRMGFM  120

Query  428  IYLPPA  445
             Y  PA
Sbjct  121  PYSAPA  126



>gb|KGN56265.1| hypothetical protein Csa_3G110620 [Cucumis sativus]
Length=379

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNA+ ALI AEY GVKV+L+ +F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAYKALIAAEYNGVKVDLSQDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID   +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDIPVSTKLRPRFGYA  119

Query  428  IYLP  439
             + P
Sbjct  120  AFHP  123



>ref|XP_004134257.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus]
Length=364

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNA+ ALI AEY GVKV+L+ +F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAYKALIAAEYNGVKVDLSQDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID   +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDIPVSTKLRPRFGYA  119

Query  428  IYLP  439
             + P
Sbjct  120  AFHP  123



>gb|KEH34076.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 96/125 (77%), Gaps = 1/125 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+   NKNA+  LI AEY G+KVEL  +FQMGVSNK+P+F+ MNPIGKVPVLETP
Sbjct  1    MALILHAQKGNKNAYKTLIAAEYSGIKVELAPDFQMGVSNKSPQFINMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGP+FESNA+ARYVA++   N LFGSS I+  H+EQW DF++ EID N  K   PR GF 
Sbjct  61   DGPVFESNAMARYVARLGESN-LFGSSPIDQAHVEQWIDFSSMEIDDNIMKLYRPRRGFS  119

Query  428  IYLPP  442
             YL P
Sbjct  120  PYLAP  124



>ref|XP_009110814.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=412

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALV+HS   NKN+  A I AE+ GVK+++   F+MGV+NKTPEFLK+NP+GK+PVLETP
Sbjct  1    MALVMHSYKGNKNSDKAFIAAEFAGVKIDMPSGFEMGVTNKTPEFLKINPLGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV+++  +N L GSSLIEY HIEQW DF++ EI  N   W  PR+GF+
Sbjct  61   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAHIEQWIDFSSLEIYGNIFNWFVPRMGFM  120

Query  428  IYLPPA  445
             Y  P 
Sbjct  121  PYSVPG  126



>ref|XP_004155227.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Cucumis sativus]
Length=409

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   NKNA+ ALI AEY GVKV+L+ +F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAYKALIAAEYNGVKVDLSPDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID   +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDIPVSTKLRPRFGYA  119

Query  428  IYLP  439
             + P
Sbjct  120  AFHP  123



>emb|CDY31074.1| BnaA08g26240D [Brassica napus]
Length=412

 Score =   165 bits (417),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALV+HS   NKN+  A I AE+ GVK+++   F+MGV+NKT EFLKMNP+GK+PVLETP
Sbjct  1    MALVMHSYKGNKNSDKAFIAAEFAGVKIDMPSGFEMGVTNKTTEFLKMNPLGKIPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV+++  +N L GSSLIEY HIEQW DF++ EI  N   W  PR+GF+
Sbjct  61   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAHIEQWIDFSSLEIYGNIFNWFVPRMGFM  120

Query  428  IYLPPA  445
             Y  P 
Sbjct  121  PYSVPG  126



>ref|XP_007148576.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
 gb|ESW20570.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
Length=419

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH+   NKN + +LI AEY GV++EL  NF+M V+ KTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATRRNKNVYKSLIAAEYSGVELELAPNFEMFVTTKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPIFESNAIARYVA++  DN L+ S+ I+   I+QW DF++ EIDAN  K   PRLG+ 
Sbjct  61   DGPIFESNAIARYVARLNGDNALYLSTPIDNARIDQWIDFSSLEIDANILKVYIPRLGYT  120

Query  428  IYLPP  442
             Y PP
Sbjct  121  PYFPP  125



>ref|XP_010475804.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X1 [Camelina 
sativa]
Length=415

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK+A  ALI AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVK-PDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DF++ EI  N  +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFSSLEIYGNILRWFGPRMGF  120

Query  425  VIYLPPA  445
            + Y  PA
Sbjct  121  MPYSAPA  127



>ref|XP_010475805.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X2 [Camelina 
sativa]
Length=435

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK+A  ALI AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVK-PDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DF++ EI  N  +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFSSLEIYGNILRWFGPRMGF  120

Query  425  VIYLPPA  445
            + Y  PA
Sbjct  121  MPYSAPA  127



>ref|XP_001771013.1| predicted protein [Physcomitrella patens]
 gb|EDQ64168.1| predicted protein [Physcomitrella patens]
 gb|AFZ39147.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=431

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = +2

Query  71   ALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPD  250
             LV+HS   NKN++ +LI AEY GVKVE+  +FQMGV+NK+PEFLKMNPIGKVPVL+TP+
Sbjct  3    GLVIHSQKVNKNSYKSLIAAEYVGVKVEIVPDFQMGVTNKSPEFLKMNPIGKVPVLQTPE  62

Query  251  GPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVI  430
            GPIFESNA+ARYVA  K D  L GSS  E   +EQW DFA  EID N   W+YPRLGF +
Sbjct  63   GPIFESNAMARYVAN-KKDVGLVGSSAYEKALVEQWIDFATMEIDVNAGGWVYPRLGFGL  121

Query  431  Y  433
            Y
Sbjct  122  Y  122



>ref|XP_008452240.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=409

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLHS   +KN +  LI AEY GVKV+L  +F MGVSNK+PEFLKMNPIGKVP+L+TP
Sbjct  1    MALVLHSWTPSKNVYKVLIAAEYNGVKVDLAPDFTMGVSNKSPEFLKMNPIGKVPLLQTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DG IFESNAI RYVA++K D+ L+GSS I+YGHIEQW DF++ EID++ +  L PR G+ 
Sbjct  61   DGAIFESNAITRYVARLK-DSGLYGSSPIDYGHIEQWIDFSSLEIDSHISTILAPRYGYG  119

Query  428  IY  433
            +Y
Sbjct  120  VY  121



>ref|XP_006307657.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
 gb|EOA40555.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
Length=415

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK+A  ALI AEY GV++++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  248  DGPIFESNAIARYVAKVKPD-NPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G +FESNAIARYV+++  + N L GSSLIEY  IEQW+DF++ EI  N  +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGEKNSLNGSSLIEYAQIEQWSDFSSLEIYGNILRWFGPRMGF  120

Query  425  VIY  433
            + Y
Sbjct  121  MPY  123



>emb|CDX93494.1| BnaA06g05540D [Brassica napus]
Length=413

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK A  ALI AEY GVK+ +  +F+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAEKALIAAEYTGVKINVP-DFEMGVSNKTPEFLKMNPIGKVPVLETP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV+++  +N L GSSLIEY  IEQW DF++ EI  +   W   R+G+ 
Sbjct  60   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAQIEQWIDFSSLEIFGSIFMWFGARIGYK  119

Query  428  IYLPPA  445
             Y  P 
Sbjct  120  PYSVPG  125



>ref|XP_009148264.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   154 bits (390),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK A  ALI AEY GVK+++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAEKALIAAEYTGVKIDVP-DFEMGVANKTPEFLKMNPIGKVPVLETP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV+++  +N L GSSLIEY  IEQW DF++ EI  +   W   R+G+ 
Sbjct  60   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAQIEQWIDFSSLEIFGSIFMWFGARIGYK  119

Query  428  IYLPPA  445
             Y  P 
Sbjct  120  PYSVPG  125



>emb|CDY50887.1| BnaCnng19790D [Brassica napus]
Length=413

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MALVLH+   NK A  ALI AEY GV++ +  +F+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAEKALIAAEYTGVQINVP-DFEMGVSNKTPEFLKMNPIGKVPVLETP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPIFESNAIARYV+++  +N L GSSLIEY  IEQW DF++ EI  +   W   R+G+ 
Sbjct  60   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAQIEQWIDFSSLEIFGSIFMWFGARIGYK  119

Query  428  IYLPPA  445
             Y  P 
Sbjct  120  PYSVPG  125



>gb|KDO42760.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=387

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  352
            MGV+NKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVA++K DNPL GSSLI+  HIE
Sbjct  1    MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIE  60

Query  353  QWTDFAATEIDANTAKWLYPRLGFVIYLPPA  445
            QW DF++ EID N  +W  PR+GF +YLP A
Sbjct  61   QWIDFSSLEIDTNILRWFIPRVGFAVYLPQA  91



>ref|XP_008789740.1| PREDICTED: elongation factor 1-gamma 1 isoform X2 [Phoenix dactylifera]
Length=384

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  173  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  352
            MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYV ++K +NPL+GSSLIEY  IE
Sbjct  1    MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVTRLKAENPLYGSSLIEYARIE  60

Query  353  QWTDFAATEIDANTAKWLYPRLGFV  427
            QW DFA+ EIDAN A+WL PRLGFV
Sbjct  61   QWIDFASMEIDANIARWLLPRLGFV  85



>ref|XP_002984514.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
 gb|EFJ14564.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
Length=430

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 93/124 (75%), Gaps = 3/124 (2%)
 Frame = +2

Query  71   ALVLH-SPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
             LVLH +   NKNA   LIVAE  GVKV+L  +F+MGVSNKTPEFLK+NP+GKVPVLETP
Sbjct  3    GLVLHVNAGINKNAHKVLIVAEIVGVKVDLVPDFEMGVSNKTPEFLKLNPLGKVPVLETP  62

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            DGPI ESNAIARYVA +K    L GS+L +   ++QW DFA TE+D +  +WLYPR G++
Sbjct  63   DGPISESNAIARYVANLK--GKLTGSTLYQTALVDQWIDFATTEVDTSLGRWLYPRFGYL  120

Query  428  IYLP  439
             Y P
Sbjct  121  PYAP  124



>gb|KEH32761.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=384

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  352
            MGVSNKTP+FL MNP+GKVPVLETPDGP+FESNAIARYVA+   +N L+GSSLI+Y  IE
Sbjct  1    MGVSNKTPQFLDMNPLGKVPVLETPDGPVFESNAIARYVARQNNNNTLYGSSLIQYAQIE  60

Query  353  QWTDFAATEIDANTAKWLYPRLGFVIYLPPA  445
            QW DF++ E+D+N  KWLYPRLG+ +YLPPA
Sbjct  61   QWIDFSSLEVDSNINKWLYPRLGYGVYLPPA  91



>gb|AFW76480.1| elongation factor gamma1 [Zea mays]
Length=382

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  173  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  352
            MGVSNKTPEFLKMNP+GKVPVLETPDGP+FESNAIARYVA++K DNPLFGSS IE  H+E
Sbjct  1    MGVSNKTPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVE  60

Query  353  QWTDFAATEIDANTAKWLYPRLGFVIYL  436
            QW DFAATE+D   A +LYPRLG++ Y+
Sbjct  61   QWMDFAATEVDPGVAWYLYPRLGYLPYV  88



>ref|XP_002973046.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
 gb|EFJ26267.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
Length=418

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 88/114 (77%), Gaps = 2/114 (2%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            NKNA   LIVAE  GVKV+L  +F+MGVSNKTPEFLK+NP+GKVPVLETPDGPI ESNAI
Sbjct  1    NKNAHKVLIVAEIVGVKVDLVPDFEMGVSNKTPEFLKLNPLGKVPVLETPDGPISESNAI  60

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLP  439
            ARYVA +K    L GS++ +   ++QW DFA TE+D +  +WLYPR G++ Y P
Sbjct  61   ARYVANLK--GKLTGSTVYQTALVDQWIDFATTEVDTSLGRWLYPRFGYLPYAP  112



>gb|AFW87006.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
 gb|AFW87007.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
Length=382

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  173  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  352
            MGVSNKTPEFLKMNP+GKVPVLETPDGP+FESNAIARYVA++K DNPLFGSS IE  H+E
Sbjct  1    MGVSNKTPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVE  60

Query  353  QWTDFAATEIDANTAKWLYPRLGFVIY  433
            QW DFAATE+D     +LYPRLG++ Y
Sbjct  61   QWMDFAATEVDPGVGWYLYPRLGYIPY  87



>ref|XP_006841161.1| hypothetical protein AMTR_s00086p00155150 [Amborella trichopoda]
 gb|ERN02836.1| hypothetical protein AMTR_s00086p00155150 [Amborella trichopoda]
Length=124

 Score =   129 bits (325),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            +LH+ N NKN F ALI AEY GV+V    +F++GVSNKT +FLKMNP+GK P+L+TP+GP
Sbjct  1    MLHAGNNNKNVFKALIAAEYAGVEVNPIESFEVGVSNKTLKFLKMNPMGKAPMLKTPEGP  60

Query  257  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDF  367
            IFESNAIAR+VA +K ++ L+G+SL EY  IEQW DF
Sbjct  61   IFESNAIARFVAHLKGNDILYGTSLFEYERIEQWIDF  97



>ref|XP_008867564.1| hypothetical protein H310_04829 [Aphanomyces invadans]
 gb|ETW03335.1| hypothetical protein H310_04829 [Aphanomyces invadans]
Length=418

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M+  L  P  +  AF  LI AEY GV +E+  +FQMGV NK+ EFLK+NP+GKVPVL+TP
Sbjct  1    MSYKLFVPQGSSRAFKILIAAEYNGVNLEIPEHFQMGVDNKSAEFLKLNPLGKVPVLQTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +GPIFESNAIARYVA+++ D  L G +  E G ++QW DF A E++      LYP  G+
Sbjct  61   EGPIFESNAIARYVARIRADTGLLGKTFYESGQVDQWVDFVANELEVPLNALLYPIFGY  119



>ref|XP_009825362.1| hypothetical protein H257_03107 [Aphanomyces astaci]
 gb|ETV85344.1| hypothetical protein H257_03107 [Aphanomyces astaci]
Length=419

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MA  L  P     AF   I AEY GV +E+   F MGV NK+ EFLK+NP+GKVPVL+TP
Sbjct  1    MAYKLFVPQGGARAFKIFIAAEYSGVNLEIPETFVMGVDNKSAEFLKLNPLGKVPVLQTP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +GPIFESNAIARY+A+++ DN L G +  E G ++QW DF + E++      LYP  G+
Sbjct  61   EGPIFESNAIARYIARIRADNGLLGKTFYESGQVDQWVDFVSNELELPLNALLYPIFGY  119



>ref|XP_008605170.1| hypothetical protein SDRG_01423 [Saprolegnia diclina VS20]
 gb|EQC41456.1| hypothetical protein SDRG_01423 [Saprolegnia diclina VS20]
Length=416

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MA  L++P     AF  LI AEY GV + +   F MGV NKTPEFL +NP+GKVPVL TP
Sbjct  1    MAYTLYAPQAGSRAFKILIAAEYNGVDLNVPETFVMGVDNKTPEFLALNPLGKVPVLATP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +GPI+ESNAIARYVA+++ D  L G +  E G ++QW DF   E++      LYP  G+ 
Sbjct  61   EGPIYESNAIARYVARLRADTGLTGKTFYESGQVDQWVDFVTNEMETPLGALLYPIFGYA  120

Query  428  IY  433
             Y
Sbjct  121  KY  122



>ref|XP_006828297.1| hypothetical protein AMTR_s00023p00230860 [Amborella trichopoda]
 gb|ERM95713.1| hypothetical protein AMTR_s00023p00230860 [Amborella trichopoda]
Length=86

 Score =   118 bits (296),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL+LH  N NKNAF  LI AEY GV+V+L   F++ VSNKTPEF+KMNP+ KV VLETP
Sbjct  1    MALILHVGNNNKNAFKVLIAAEYAGVEVKLVEYFEVEVSNKTPEFIKMNPMCKVLVLETP  60

Query  248  DGPIFESNAIARYVAKVKPDNPLFGS  325
            +GPIFESNAIAR+VA++K DN L G+
Sbjct  61   EGPIFESNAIARFVARLKGDNILCGT  86



>ref|XP_005645852.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE21308.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
Length=441

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  253
            L L++   NKNA+ A I AEY GVK+++   F+MG +NK+P+FLK+NP GKVP L+TP+G
Sbjct  4    LRLYTFPGNKNAWKAQIAAEYVGVKLDVPA-FEMGKTNKSPQFLKLNPNGKVPTLQTPEG  62

Query  254  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
             I+ESNAIARYVA++  D  LFG++  +   +EQW +FA  E+DA  A W YP  G++ Y
Sbjct  63   GIWESNAIARYVARLA-DKGLFGATAYDAALVEQWIEFATGELDAPLASWYYPIAGYMEY  121



>ref|XP_001774148.1| predicted protein [Physcomitrella patens]
 gb|EDQ61062.1| predicted protein [Physcomitrella patens]
 gb|AFZ39149.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = +2

Query  71   ALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPD  250
             L L++   NKNA+ ALI AEY GVK+E T       + K+P++L MNP+GKVPVLETP+
Sbjct  3    GLKLYANPVNKNAYKALIAAEYVGVKIEFTEITDWSTT-KSPQYLAMNPMGKVPVLETPE  61

Query  251  GPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            G IFESNAIARYVA +K D  L G        I+QW DFAA EID N   W+ P LG 
Sbjct  62   GSIFESNAIARYVAGLK-DVGLLGVPGYNKAQIDQWIDFAALEIDINARAWVLPHLGL  118



>ref|XP_009041108.1| hypothetical protein AURANDRAFT_39051 [Aureococcus anophagefferens]
 gb|EGB04257.1| hypothetical protein AURANDRAFT_39051 [Aureococcus anophagefferens]
Length=411

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M L L++   N  AF AL+ AEY GV +++  +F M  + KTP FL M+P+GKVPVL+TP
Sbjct  1    MTLQLYTYPGNFRAFKALVAAEYVGVDIDVP-DFDMEKTAKTPSFLAMSPMGKVPVLKTP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
             G IFESNAIARYVA+++ D+ ++G +  E   I+ W DF A E++     W+YP +G++
Sbjct  60   QGAIFESNAIARYVARLRKDSEIYGRTFYESALIDSWVDFCAHELELPCTMWVYPIIGYM  119



>ref|XP_009040775.1| hypothetical protein AURANDRAFT_70385 [Aureococcus anophagefferens]
 gb|EGB04522.1| hypothetical protein AURANDRAFT_70385 [Aureococcus anophagefferens]
Length=421

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M L L++   N  AF AL+ AEY GV +++  +F M  + KTP FL M+P+GKVPVL+TP
Sbjct  1    MTLQLYTYPGNFRAFKALVAAEYVGVDIDVP-DFDMEKTAKTPSFLAMSPMGKVPVLKTP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
             G IFESNAIARYVA+++ D+ ++G +  E   I+ W DF A E++     W+YP +G++
Sbjct  60   QGAIFESNAIARYVARLRKDSEIYGRTFYESALIDSWVDFCAHELELPCTMWVYPIIGYM  119



>emb|CBJ27519.1| eukaryotic elongation factor-1 B gamma [Ectocarpus siliculosus]
Length=420

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL L +   N  AF  LI AEY GV++E+   F     +K+P+FL  +P+G+VPVLETP
Sbjct  1    MALKLWTNPANFRAFKVLIAAEYNGVELEVP-EFNHPSDSKSPDFLAKSPLGRVPVLETP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
             G IFESNAIARYVA+++ D  L+G S  E   ++ W DF A EI+     W YP +G++
Sbjct  60   QGSIFESNAIARYVARMRRDTELYGVSFFESAQVDSWIDFCAHEIELPATIWCYPVIGYM  119

Query  428  IY  433
             Y
Sbjct  120  PY  121



>ref|XP_009519315.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
 gb|ACH68459.1| calcium-dependent protein 1 [Phytophthora sojae]
 gb|EGZ24027.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
Length=405

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M   L++   N   F  LI AEY GV +EL   F M    K+ EF    P+GKVP+LET 
Sbjct  1    MVFKLYTYPANYRVFKVLIAAEYNGVDIELP-EFDMATDLKSEEFQSKTPVGKVPILETE  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +G IFES AIA+YVA+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGTIFESGAIAKYVARLRNDTGLYGKTFFESGQVDSWIDFSAYELEIPLQAWLYPILGWA  119

Query  428  IY  433
             Y
Sbjct  120  KY  121



>emb|CCA15330.1| calciumdependent protein 1 putative [Albugo laibachii Nc14]
Length=422

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = +2

Query  65   AMALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLET  244
            A  + L+S   N   F  LI AEY GV +E+   F M  + K+ EFL  NP+GKVPVLET
Sbjct  13   ASKMKLYSYPGNYRVFKILIAAEYNGVDIEVP-EFDM-TTIKSKEFLAKNPLGKVPVLET  70

Query  245  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
             +G +FESNAIARYVA+++ D+ L G +  E G ++ W DF+A E++     WLYP  G+
Sbjct  71   ENGSLFESNAIARYVARLRADSGLSGRTFFESGQVDSWMDFSAHELEVPLQMWLYPVFGY  130

Query  425  VIY  433
            + +
Sbjct  131  MKF  133



>gb|ETM49731.1| hypothetical protein L914_06086, partial [Phytophthora parasitica]
Length=148

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N   F  LI AEY GV +EL   F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELP-EFDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILG  115



>gb|KDO34814.1| hypothetical protein SPRG_00875 [Saprolegnia parasitica CBS 223.65]
Length=404

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MA  L++P     AF  LI AEY GV + +   F MGV NKTPEFL +NP+GKVP     
Sbjct  1    MAYTLYAPQAGSRAFKILIAAEYNGVDLNVPEKFVMGVDNKTPEFLALNPLGKVP-----  55

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
                  SNAIARYVA+++ D  L G +  E G ++QW DF   E++   A  LYP  G+ 
Sbjct  56   ------SNAIARYVARLRADTGLTGKTFYESGQVDQWVDFVTNEMETPLAALLYPIFGYA  109

Query  428  IY  433
             Y
Sbjct  110  KY  111



>ref|XP_004353907.1| glutathione S-transferase domain-containing protein [Dictyostelium 
fasciculatum]
 gb|EGG14498.1| glutathione S-transferase domain-containing protein [Dictyostelium 
fasciculatum]
Length=412

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 81/126 (64%), Gaps = 3/126 (2%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M++ ++S  +N   + ALI A+Y GV++E+   F     +K+ EFLK+ P GKVPV+ T 
Sbjct  1    MSMKIYSYPQNPRVYKALIAAKYVGVEIEVPA-FDFQKDSKSAEFLKVAPHGKVPVMVTE  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
             G IFESN+IARYVA++     ++GS   E   I+QW DFA  E++A+   WLYP +GFV
Sbjct  60   KGSIFESNSIARYVARL--GGKIYGSDAYEASVIDQWLDFATNEVEASAVAWLYPIMGFV  117

Query  428  IYLPPA  445
             + P A
Sbjct  118  KFNPEA  123



>gb|ETP47818.1| hypothetical protein F442_06319, partial [Phytophthora parasitica 
P10297]
Length=170

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N   F  LI AEY GV +EL   F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELP-EFDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILG  115



>gb|ETI50110.1| hypothetical protein F443_06278, partial [Phytophthora parasitica 
P1569]
Length=173

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N   F  LI AEY GV +EL   F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  12   NYRVFKVLIAAEYNGVDIELP-EFDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  70

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG
Sbjct  71   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILG  118



>emb|CCI44608.1| unnamed protein product [Albugo candida]
Length=407

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N   F  LI AEY G+ +E+   F M  + K+ EFL  NP+GKVPVLET +G +FESNAI
Sbjct  9    NYRVFKILIAAEYNGIDIEVP-EFDM-TTIKSKEFLAKNPLGKVPVLETENGALFESNAI  66

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
            ARYVA+++ D  L+G +  E G ++ W DF+A E++     WLYP  G++ +
Sbjct  67   ARYVARLRADTGLYGQTFFESGQVDSWIDFSAHELEVPLQMWLYPIFGYMKF  118



>gb|ETI50094.1| hypothetical protein F443_06281, partial [Phytophthora parasitica 
P1569]
Length=172

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 72/119 (61%), Gaps = 1/119 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M L L++   N   F ALI AE+ G+ VEL   F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDVELP-EFDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGW  118



>gb|ETO78833.1| hypothetical protein F444_06337, partial [Phytophthora parasitica 
P1976]
Length=190

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N   F  LI AEY GV +EL   F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELP-EFDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILG  115



>gb|ETK89985.1| hypothetical protein L915_06155, partial [Phytophthora parasitica]
 gb|ETP47804.1| hypothetical protein F442_06322, partial [Phytophthora parasitica 
P10297]
Length=192

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 72/119 (61%), Gaps = 1/119 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M L L++   N   F ALI AE+ G+ VEL   F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDVELP-EFDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGW  118



>ref|XP_002901767.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
 gb|EEY57157.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
Length=406

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 73/119 (61%), Gaps = 1/119 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M L L++   N  AF ALI AE+ GV +EL   F      KT EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRAFKALIAAEFNGVDIELP-EFDFAKDVKTKEFKAKTPAGKVPLLETD  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G IFES AIA+YVA+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+
Sbjct  60   EGCIFESGAIAKYVARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGW  118



>gb|ETM49723.1| hypothetical protein L914_06088, partial [Phytophthora parasitica]
Length=215

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 72/119 (61%), Gaps = 1/119 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M L L++   N   F ALI AE+ G+ VEL   F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDVELP-EFDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGW  118



>ref|XP_008891716.1| hypothetical protein PPTG_02396 [Phytophthora parasitica INRA-310]
 gb|ETN22467.1| hypothetical protein PPTG_02396 [Phytophthora parasitica INRA-310]
Length=229

 Score =   103 bits (256),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N   F  LI AEY GV +EL   F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELP-EFDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILG  115



>ref|XP_009519320.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
 gb|EGZ24032.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
Length=451

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N   F  LI AEY G+ +EL   F M    KT  F    P+GKVPVLET +G IFES AI
Sbjct  57   NYRVFKVLIAAEYNGIHIELP-KFDMAKDLKTKSFKAKTPVGKVPVLETKEGTIFESGAI  115

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
            ARY+A+++PD  L+G +  E G ++ W DF+A E++     W++P LG
Sbjct  116  ARYIARLRPDTGLYGKTFFESGQVDSWIDFSAYELEVPLEVWVHPILG  163



>ref|XP_004341586.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR19500.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
Length=408

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            +   PN N   + A I   + G+++E    FQ+GV NKTPEF    P+ KVP LETP+GP
Sbjct  5    IFSYPN-NHRVWKAQIAGNFTGLQIE-APAFQIGVDNKTPEFAAKFPLQKVPALETPEGP  62

Query  257  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  412
            +FESNAIARY A+    + ++GSS  E   I+QW DF+A EI+   + WLYP
Sbjct  63   LFESNAIARYAARYGGSSKIYGSSPYEASLIDQWIDFSANEIELPASAWLYP  114



>ref|XP_002901771.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
 gb|EEY57161.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
Length=367

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N  AF  LI AEY GV +EL   F      KT EF    PIGKVP+LET +G IFES AI
Sbjct  9    NYRAFKVLIAAEYNGVDIELPA-FDFAKDIKTKEFKAKTPIGKVPILETEEGAIFESGAI  67

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL  418
            ARY+A+++PD  L+G +  E G ++ W DF+A E++     W+YP L
Sbjct  68   ARYIARLRPDTGLYGKTFFESGLVDAWIDFSAYELEVPLEVWVYPIL  114



>gb|ETL96570.1| hypothetical protein L917_05968, partial [Phytophthora parasitica]
Length=267

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 72/119 (61%), Gaps = 1/119 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M L L++   N   F ALI AE+ G+ +EL   F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDIELP-EFDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGW  118



>gb|ETL96579.1| hypothetical protein L917_05965, partial [Phytophthora parasitica]
Length=350

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N   F  LI AEY GV +EL   F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELP-EFDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILG  115



>gb|ETP19871.1| hypothetical protein F441_06281 [Phytophthora parasitica CJ01A1]
Length=407

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N   F  LI AEY GV +EL   F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  12   NYRVFKVLIAAEYNGVDIELP-EFDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  70

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG
Sbjct  71   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILG  118



>gb|ETK89994.1| hypothetical protein L915_06152 [Phytophthora parasitica]
 gb|ETL43394.1| hypothetical protein L916_06088 [Phytophthora parasitica]
Length=404

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +2

Query  98   NKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  277
            N   F  LI AEY GV +EL   F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELP-EFDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  278  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILG  115



>ref|XP_005707114.1| elongation factor EF-1 gamma subunit [Galdieria sulphuraria]
 gb|EME30594.1| elongation factor EF-1 gamma subunit [Galdieria sulphuraria]
Length=1284

 Score =   104 bits (260),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 54/108 (50%), Positives = 68/108 (63%), Gaps = 2/108 (2%)
 Frame = +2

Query  89   PNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFES  268
            PN N  A  ALI AEY  V V++   F+MG  NK+PEFLK+ P+GK+P LETP GP+ ES
Sbjct  895  PN-NPRAQKALIAAEYAQVSVQVP-KFEMGKDNKSPEFLKLFPLGKIPALETPQGPVSES  952

Query  269  NAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  412
             AIA Y AK++PD  L G+SL E   ++QW  FA      +    LYP
Sbjct  953  PAIAWYFAKLRPDKGLCGNSLYEECQVQQWISFAEDAFAKHYPVLLYP  1000



>ref|XP_008891718.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETL43385.1| hypothetical protein L916_06090 [Phytophthora parasitica]
 gb|ETN22469.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETO78816.1| hypothetical protein F444_06339 [Phytophthora parasitica P1976]
 gb|ETP19873.1| hypothetical protein F441_06283 [Phytophthora parasitica CJ01A1]
Length=406

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 72/119 (61%), Gaps = 1/119 (1%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M L L++   N   F ALI AE+ G+ +EL   F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDIELP-EFDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGW  118



>gb|EFA79702.1| glutathione S-transferase domain-containing protein [Polysphondylium 
pallidum PN500]
Length=432

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M+  +++  +N  A  ALI A+Y GV +++   F+    NK  E L  NP GKVP   TP
Sbjct  1    MSTTIYTYPQNPRAAKALIAAKYTGVTIDVPA-FEFSPVNKPVELLNANPFGKVPAAMTP  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
             GP+FESN+IARYVA+    + ++GS   E   I+QW DFA  E+++  A WLYP +GFV
Sbjct  60   QGPLFESNSIARYVARA-AGSKIYGSDAYEASVIDQWLDFATNEVESAAAAWLYPIMGFV  118



>gb|EWM21126.1| elongation factor 1 [Nannochloropsis gaditana]
Length=435

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            MAL L++   N  AF  L+ A Y GV +++  +  +    +T + L  +P GKVPVLETP
Sbjct  1    MALKLYTNPGNFRAFKILVAALYNGVDIDVV-DLDLAAKKRT-DVLAKSPAGKVPVLETP  58

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
             G +FESNAIARY+A+ + D  L+G S  + G ++ W DFAA E++     W+YP  G++
Sbjct  59   QGLLFESNAIARYIARARRDTDLYGVSFFDSGLVDAWIDFAAQEVELPATLWVYPVFGYL  118



>emb|CBK21757.2| unnamed protein product [Blastocystis hominis]
Length=392

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  116  ALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAK  295
            ALI A+Y  V + +   F+MGV NK+ EFLKMNP GKVPVL+TP+G IFES AIARYVA+
Sbjct  3    ALIAAQYNNVYIHVP-KFEMGVENKSEEFLKMNPNGKVPVLKTPEGAIFESTAIARYVAR  61

Query  296  VKPDNPLFGSSLIEYGHIEQWTDFA  370
            ++ D  L G +  E G ++QW D+A
Sbjct  62   MRNDTGLLGRTFFEEGKVDQWIDWA  86



>ref|XP_005760139.1| hypothetical protein EMIHUDRAFT_438506 [Emiliania huxleyi CCMP1516]
 gb|EOD07710.1| hypothetical protein EMIHUDRAFT_438506 [Emiliania huxleyi CCMP1516]
Length=189

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   LHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPI  259
            L++   N +A   LIVA Y GV +E+   F+MG  NK+  FLK +P+GKVPVLET  G I
Sbjct  3    LYTFAGNTHALQTLIVARYNGVDIEVPA-FEMGKDNKSAAFLKKSPLGKVPVLETASGCI  61

Query  260  FESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
             E+ A+ARYVA+++ D  +FG++  E G ++ W +FA  E+D     W++P LGF+
Sbjct  62   CEAAAVARYVARMRADTNMFGATFFEAGQVDMWVEFAKNELDLPVGMWVFPILGFI  117



>dbj|GAM21220.1| hypothetical protein SAMD00019534_043950 [Acytostelium subglobosum 
LB1]
Length=416

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVEL-TXNFQMGVSNKTPEFLKMNPIGKVPVLET  244
            M++ + +   N  A  +LI A+Y GV +E+   +     +NK  E +  NP GKVP   T
Sbjct  1    MSVSIITYPSNPRACKSLIAAKYTGVNIEIPNVDLSQLATNKPVELMNANPFGKVPAAMT  60

Query  245  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            P GP+FESN+IARYVA+ +  N ++G+   E   I+QW DF++ EI++    WLYP LG+
Sbjct  61   PQGPLFESNSIARYVAR-QGGNKIYGNDAYEASVIDQWLDFSSNEIESAAVAWLYPILGY  119



>sp|P12261.3|EF1G_ARTSA RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: 
Full=eEF-1B gamma [Artemia salina]
 pir||S00162 translation elongation factor eEF-1 gamma chain - brine shrimp
 gb|AAC83401.1| elongation factor 1-gamma [Artemia sp.]
Length=430

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 73/123 (59%), Gaps = 5/123 (4%)
 Frame = +2

Query  80   LHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP-  256
            L++  EN  AF ALI A+Y G K+E+  +F  G +NK+  FLK  P+GKVP  E+ DG  
Sbjct  6    LYTYPENFRAFKALIAAQYSGAKLEIAKSFVFGETNKSDAFLKSFPLGKVPAFESADGHC  65

Query  257  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  436
            I ESNAIA YVA    +  L GSS +E   I QW  FA TEI   +  W++P LG + + 
Sbjct  66   IAESNAIAYYVA----NETLRGSSDLEKAQIIQWMTFADTEILPASCTWVFPVLGIMQFN  121

Query  437  PPA  445
              A
Sbjct  122  KQA  124



>ref|NP_001083003.1| uncharacterized protein LOC100037382 [Danio rerio]
Length=430

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 72/123 (59%), Gaps = 5/123 (4%)
 Frame = +2

Query  80   LHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP-  256
            L++  EN  AF ALI A+Y G K+E+   F  G +NK+  FLK  P+GKVP  E+ DG  
Sbjct  6    LYTYPENFRAFKALIAAQYSGAKLEIAKGFVFGETNKSDAFLKKFPLGKVPAFESADGHC  65

Query  257  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  436
            I ESNAIA YVA    +  L GSS +E   I QW  FA TEI   +  W++P LG + + 
Sbjct  66   IAESNAIAYYVA----NETLRGSSDLEKAQIIQWMTFADTEILPASCTWVFPVLGIMQFN  121

Query  437  PPA  445
              A
Sbjct  122  KQA  124



>ref|XP_005988901.1| PREDICTED: elongation factor 1-gamma-like [Latimeria chalumnae]
Length=436

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 72/123 (59%), Gaps = 8/123 (7%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTX---NFQMGVSNKTPEFLKMNPIGKVPVLETP  247
             L++  EN  AF ALI A+Y G  V++      F  G SNKTPEFL+  P+GKVP  E  
Sbjct  5    TLYTYPENWRAFKALIAAQYSGATVKVQSTPPQFHFGQSNKTPEFLQKFPLGKVPAFEGD  64

Query  248  DG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            DG  +FESNAIA YV+    ++ L GSS +    + QW  FA +EI    + W++P LG 
Sbjct  65   DGFCVFESNAIAHYVS----NDELRGSSKVAAAQVIQWMSFADSEIVPPASTWVFPTLGI  120

Query  425  VIY  433
            + Y
Sbjct  121  MQY  123



>ref|XP_003292098.1| hypothetical protein DICPUDRAFT_156785 [Dictyostelium purpureum]
 gb|EGC31377.1| hypothetical protein DICPUDRAFT_156785 [Dictyostelium purpureum]
Length=404

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVEL-TXNFQMGVSNKTPEFLKMNPIGKVPVLET  244
            M + L +  EN  AF +LI A+Y GV++E+   NFQ      T  F  + P+ KVPVL T
Sbjct  1    MVMKLFTYPENNRAFKSLIAAKYAGVEIEVPAFNFQ--TDRDTEWFKALAPLKKVPVLST  58

Query  245  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
              GPIFESNA+ARYVA++  +  L+G+     G  +QW D+A+ EID     W Y  LGF
Sbjct  59   EQGPIFESNAMARYVARLGGN--LYGTDAYTAGVNDQWIDYASNEIDPINYGWTYSILGF  116

Query  425  V  427
            V
Sbjct  117  V  117



>ref|XP_007056947.1| PREDICTED: elongation factor 1-gamma [Chelonia mydas]
Length=432

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = +2

Query  65   AMALVLHSPNENKNAFXALIVAEYCGVKVELTX---NFQMGVSNKTPEFLKMNPIGKVPV  235
            A A  L++  EN  AF ALI A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AAAGTLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  236  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  412
             E  DG  +FESNAIA YV+    ++ L GS+      I QW  FA ++I    + W++P
Sbjct  62   FEGADGFCVFESNAIAHYVS----NDDLRGSTKETAAQIIQWVSFADSDIVPPASTWVFP  117

Query  413  RLGFVIY  433
             LG + Y
Sbjct  118  TLGIMHY  124



>ref|XP_006113632.1| PREDICTED: elongation factor 1-gamma [Pelodiscus sinensis]
Length=432

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = +2

Query  65   AMALVLHSPNENKNAFXALIVAEYCGVKVELTX---NFQMGVSNKTPEFLKMNPIGKVPV  235
            A A  L++  EN  AF ALI A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AAAGTLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  236  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  412
             E  DG  +FESNAIA YV+    ++ L GS+      I QW  FA ++I    + W++P
Sbjct  62   FEGADGFCVFESNAIAHYVS----NDELRGSTKETAAQIIQWVSFADSDIVPPASTWVFP  117

Query  413  RLGFVIY  433
             LG + Y
Sbjct  118  TLGIMHY  124



>gb|ADV40141.1| elongation factor-1 gamma [Latrodectus hesperus]
Length=321

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +2

Query  71   ALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPD  250
            A  LH+   N  A   LI A+Y G K+ ++ +F +G +N+T EFLK  P GKVP LETPD
Sbjct  4    ACTLHTYPNNFRAQKILIAAQYSGTKINVSDDFTLGQTNQTTEFLKKFPNGKVPALETPD  63

Query  251  GP-IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
               I ESNAIA YV     ++ L G ++++   I+ W DF   EI  +   W++P LG +
Sbjct  64   NKYISESNAIAHYVG----NDQLRGENVLQQSLIKMWIDFGDHEILPSACTWVFPCLGIL  119

Query  428  IY  433
             Y
Sbjct  120  QY  121



>ref|XP_007439957.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Python 
bivittatus]
Length=432

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = +2

Query  65   AMALVLHSPNENKNAFXALIVAEYCGVKVELTX---NFQMGVSNKTPEFLKMNPIGKVPV  235
            A+A  L++  EN  AF ALI A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AVAGTLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  236  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  412
             E  DG  IFESNAIA YV+    +  L G++      + QW  FA ++I    + W++P
Sbjct  62   FEGDDGFCIFESNAIAHYVS----NEELRGATKESAAQVLQWVSFADSDIVPPASTWVFP  117

Query  413  RLGFVIY  433
             LG + Y
Sbjct  118  TLGIMQY  124



>ref|XP_011334294.1| PREDICTED: elongation factor 1-gamma [Cerapachys biroi]
 gb|EZA57052.1| Elongation factor 1-gamma [Cerapachys biroi]
Length=429

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 5/120 (4%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
             L++  EN  A+ ALI A++ GV++++  +F  G +NKT  FLK  P+GKVP  ET DG 
Sbjct  5    TLYTYPENFRAYKALIAAQFSGVQIKIAEDFVFGQTNKTEAFLKKFPLGKVPAFETDDGK  64

Query  257  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
             I ESNAIA YVA    +  L G S +E   I QW  FA +EI   +  W++P LG + Y
Sbjct  65   YITESNAIAYYVA----NEQLRGKSDVERALILQWLGFADSEILPASCAWVFPLLGIMSY  120



>ref|XP_008172336.1| PREDICTED: elongation factor 1-gamma [Chrysemys picta bellii]
Length=432

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = +2

Query  65   AMALVLHSPNENKNAFXALIVAEYCGVKVELTX---NFQMGVSNKTPEFLKMNPIGKVPV  235
            A A  L++  EN  AF ALI A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AAAGTLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  236  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  412
             E  DG  +FESNAI+ YV+    ++ L GS+      I QW  FA ++I    + W++P
Sbjct  62   FEGADGFCVFESNAISHYVS----NDELRGSTKEIAAQIIQWVSFADSDIVPPASTWVFP  117

Query  413  RLGFVIY  433
             LG + Y
Sbjct  118  TLGIMHY  124



>gb|EMP38506.1| Elongation factor 1-gamma [Chelonia mydas]
Length=622

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 8/124 (6%)
 Frame = +2

Query  74   LVLHSPNENKNAFXALIVAEYCGVKVELTX---NFQMGVSNKTPEFLKMNPIGKVPVLET  244
            + L++  EN  AF ALI A+Y G K+++      F  G +NKTPEFLK  P+GKVP  E 
Sbjct  195  ITLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPAFEG  254

Query  245  PDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  421
             DG  +FESNAIA YV+    ++ L GS+      I QW  FA ++I    + W++P LG
Sbjct  255  ADGFCVFESNAIAHYVS----NDDLRGSTKETAAQIIQWVSFADSDIVPPASTWVFPTLG  310

Query  422  FVIY  433
             + Y
Sbjct  311  IMHY  314



>ref|XP_001733005.1| glutathione S-transferase domain-containing protein [Dictyostelium 
discoideum AX4]
 gb|EDR41067.1| glutathione S-transferase domain-containing protein [Dictyostelium 
discoideum AX4]
Length=410

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETP  247
            M + L++  +N  AF +LI A+Y  V +E+   F       T EF    P+GKVP L T 
Sbjct  1    MVMKLYTYPQNSRAFKSLIAAKYVNVDIEVPA-FNFETDRLTEEFKTNFPLGKVPALLTE  59

Query  248  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
             GP+FESN +ARYVA++  ++ ++GS        +QW D+AA EID N   WLY  LG+ 
Sbjct  60   QGPLFESNTMARYVARLN-NSTIYGSDAYTAALNDQWIDYAANEIDPNAIPWLYAILGYY  118

Query  428  IY  433
             Y
Sbjct  119  DY  120



>gb|EPB85278.1| hypothetical protein HMPREF1544_07959 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=408

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +2

Query  95   ENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNA  274
            +N     A I AE  GV+  +   F +   + +PEFL   P+GK+PVLE+ +  +FES++
Sbjct  12   QNPRVAKAQITAELSGVEFNVEA-FDLA-KDASPEFLTKFPLGKIPVLESSEVNLFESSS  69

Query  275  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPP  442
            IA Y A  K +NPL G++  E   I QWT F+  EI+AN A W+YP +G++ Y+ P
Sbjct  70   IAYYAAAQKENNPLLGATAAEKAEIFQWTLFSENEINANIAGWVYPLMGYMNYMKP  125



>ref|XP_003290965.1| hypothetical protein DICPUDRAFT_49566 [Dictyostelium purpureum]
 gb|EGC32515.1| hypothetical protein DICPUDRAFT_49566 [Dictyostelium purpureum]
Length=404

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 71/121 (59%), Gaps = 5/121 (4%)
 Frame = +2

Query  68   MALVLHSPNENKNAFXALIVAEYCGVKVEL-TXNFQMGVSNKTPEFLKMNPIGKVPVLET  244
            M + L +  EN  AF +LI A+Y GV++E+   NFQ      T  F  + P+ KVPVL T
Sbjct  1    MVMKLFTYPENNRAFKSLIAAKYAGVEIEVPAFNFQ--TDRDTEWFKALAPLKKVPVLST  58

Query  245  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
              GPIFESNA+ARYVA++  +  L+G+     G  +QW D+A+ EID     W Y  LG+
Sbjct  59   EQGPIFESNAMARYVARLGGN--LYGTDAYTAGVNDQWIDYASNEIDPINYGWTYSILGY  116

Query  425  V  427
             
Sbjct  117  T  117



>gb|EFZ22579.1| hypothetical protein SINV_13881 [Solenopsis invicta]
Length=434

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 5/120 (4%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            +L++  EN  A+ ALI A++ G ++++  +F  G SNK+  FLK  P+GKVP  ET DG 
Sbjct  1    ILYTYPENFRAYKALIAAQFSGTQIKVADDFVFGESNKSATFLKKFPLGKVPAFETCDGK  60

Query  257  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
             I ESNAIA YVA    +  L G + IE   I QW  FA +EI   +  W++P LG + Y
Sbjct  61   YITESNAIAYYVA----NEQLRGKTDIERALIIQWLGFADSEILPASCAWVFPLLGLMAY  116



>ref|XP_011162880.1| PREDICTED: elongation factor 1-gamma [Solenopsis invicta]
Length=438

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 5/120 (4%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            +L++  EN  A+ ALI A++ G ++++  +F  G SNK+  FLK  P+GKVP  ET DG 
Sbjct  5    ILYTYPENFRAYKALIAAQFSGTQIKVADDFVFGESNKSATFLKKFPLGKVPAFETCDGK  64

Query  257  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
             I ESNAIA YVA    +  L G + IE   I QW  FA +EI   +  W++P LG + Y
Sbjct  65   YITESNAIAYYVA----NEQLRGKTDIERALIIQWLGFADSEILPASCAWVFPLLGLMAY  120



>gb|AJD25298.1| elongation factor-1 gamma-like protein [Plectreurys tristis]
Length=273

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 5/106 (5%)
 Frame = +2

Query  119  LIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP-IFESNAIARYVAK  295
            LI A++ G  V++  +F  G +NK+PEFL+  P+GKVP LET D   IFESNAIA YV  
Sbjct  19   LIAAKFSGFDVKVADDFVFGETNKSPEFLEKFPVGKVPALETSDKKYIFESNAIAYYVG-  77

Query  296  VKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
               +  L G++LI+   I QW  FA  EI +    WL+P LG + Y
Sbjct  78   ---NEQLRGNNLIDRAQILQWISFADNEILSPACTWLFPCLGIMQY  120



>emb|CEI89465.1| hypothetical protein RMCBS344292_03820 [Rhizopus microsporus]
Length=407

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 69/119 (58%), Gaps = 3/119 (3%)
 Frame = +2

Query  89   PNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFES  268
            PN N     A I A Y G++  +   F +   ++TPEF    P+GK+PVLE+    +FES
Sbjct  11   PN-NARVAKACIAAAYNGLEFNVE-EFDLA-KDRTPEFYAKFPLGKIPVLESAQVDLFES  67

Query  269  NAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPA  445
            +AI  Y A +K D+PL G + +E   I QW  F  TE++ N   WLYP LGF+ YL P+
Sbjct  68   SAIGYYAAALKEDSPLLGKNAVEKALILQWVLFCETELNTNLGGWLYPLLGFMPYLKPS  126



>ref|XP_006271018.1| PREDICTED: elongation factor 1-gamma-like [Alligator mississippiensis]
Length=438

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = +2

Query  65   AMALVLHSPNENKNAFXALIVAEYCGVKVELTX---NFQMGVSNKTPEFLKMNPIGKVPV  235
            A+A  L++  EN  AF ALI A++ G KV++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AVAGTLYTYPENWRAFKALIAAQFSGAKVKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  236  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  412
             E  DG  +FESNAIA YV+    +  L G+S      + QW  FA +++    + W++P
Sbjct  62   FEGDDGFXVFESNAIAYYVS----NEELRGASAEAAAQVLQWVSFADSDVVPPASTWVFP  117

Query  413  RLGFVIY  433
             LG + Y
Sbjct  118  TLGIMHY  124



>emb|CEG74026.1| hypothetical protein RMATCC62417_09299 [Rhizopus microsporus]
Length=407

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 69/119 (58%), Gaps = 3/119 (3%)
 Frame = +2

Query  89   PNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFES  268
            PN N     A I A Y G++  +   F +   ++TPEF    P+GK+PVLE+    +FES
Sbjct  11   PN-NARVAKACIAAAYNGLEFNVE-EFDLA-KDRTPEFYAKFPLGKIPVLESAQVDLFES  67

Query  269  NAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPA  445
            +AI  Y A +K D+PL G + +E   I QW  F  TE++ N   WLYP LGF+ YL P+
Sbjct  68   SAIGYYAAALKEDSPLLGKNAVEKALILQWVLFCETELNTNLGGWLYPLLGFMPYLKPS  126



>emb|CEI97373.1| hypothetical protein RMCBS344292_11508 [Rhizopus microsporus]
Length=407

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 67/110 (61%), Gaps = 2/110 (2%)
 Frame = +2

Query  116  ALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAK  295
            A I A Y G++  +   F +   ++TPEF    P+GK+PVLE+    +FES+AI  Y A 
Sbjct  19   ACIAAAYNGLEFNVE-QFDLA-KDRTPEFYARFPLGKIPVLESAQVNLFESSAIGYYAAA  76

Query  296  VKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPA  445
            +K D+PL G + +E   I QW  F  TE+++N   WLYP +GF+ YL P+
Sbjct  77   LKEDSPLLGKNAVEKALIMQWVLFCETELNSNLGGWLYPLMGFMPYLKPS  126



>ref|XP_006033236.1| PREDICTED: elongation factor 1-gamma isoform X1 [Alligator sinensis]
 ref|XP_006033237.1| PREDICTED: elongation factor 1-gamma isoform X2 [Alligator sinensis]
Length=438

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = +2

Query  65   AMALVLHSPNENKNAFXALIVAEYCGVKVELTX---NFQMGVSNKTPEFLKMNPIGKVPV  235
            A+A  L++  EN  AF ALI A++ G KV++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AVAGTLYTYPENWRAFKALIAAQFSGAKVKVLSAPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  236  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  412
             E  DG  +FESNAIA YV+    +  L G+S      + QW  FA +++    + W++P
Sbjct  62   FEGDDGFCVFESNAIAYYVS----NEELRGASAEAAAQVIQWVSFADSDVVPPASTWVFP  117

Query  413  RLGFVIY  433
             LG + Y
Sbjct  118  TLGIMHY  124



>gb|ACJ12080.1| translation elongation factor EF-1 gamma [Bombina orientalis]
Length=432

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 71/123 (58%), Gaps = 8/123 (7%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXN---FQMGVSNKTPEFLKMNPIGKVPVLETP  247
             L++  +N  A+ ALI A+Y G   ++      FQ GV+NKTPEFLK  P+GKVP  E  
Sbjct  5    TLYTYPDNWRAYKALIAAQYSGFSFKVASTSPEFQFGVTNKTPEFLKKFPLGKVPAFEGD  64

Query  248  DG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  424
            DG  +FESNAIA YVA    +  L G+S +    I QW  F+ + I    + W++P LG 
Sbjct  65   DGFCLFESNAIAHYVA----NEELRGTSRVHQAQIIQWVSFSDSHIVPPASAWVFPTLGI  120

Query  425  VIY  433
            + +
Sbjct  121  MQF  123



>gb|EFN62393.1| Elongation factor 1-gamma [Camponotus floridanus]
Length=2656

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/119 (45%), Positives = 71/119 (60%), Gaps = 5/119 (4%)
 Frame = +2

Query  80   LHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP-  256
            L++  EN  A+ ALI A++ G +V++  +F  G +NKT  FLK  P+GKVP  ET DG  
Sbjct  6    LYTYPENFRAYKALIAAQFSGAQVKVAEDFIFGETNKTEAFLKKFPLGKVPAFETTDGKY  65

Query  257  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
            I ESNAIA YVA    +  L G + IE   I QW  FA +EI   +  W++P LG + Y
Sbjct  66   ITESNAIAYYVA----NEQLRGKTDIERALIIQWLGFADSEILPASCAWVFPLLGIMPY  120



>ref|XP_011428586.1| PREDICTED: elongation factor 1-gamma-like, partial [Crassostrea 
gigas]
Length=323

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = +2

Query  41   CVGSF*SEAMAL-VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNP  217
            C   F S AMA   L++  +N  AF ALI A+Y G  V+++  F+ G +NK+  FL+  P
Sbjct  5    CYFLFLSSAMASGTLYTFPDNFRAFKALIAAQYSGADVKISPGFKFGETNKSKSFLEKFP  64

Query  218  IGKVPVLETPDGP-IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANT  394
            +GKVP  E+  G  +FESNAIA+YV+  +    L G++  +   ++QW +FA  E+   +
Sbjct  65   LGKVPAFESASGDCLFESNAIAQYVSNAQ----LMGANSRDAAFVQQWINFADNEVLPAS  120

Query  395  AKWLYPRLGFVIY  433
              W++P LG + +
Sbjct  121  CTWVFPCLGIMQF  133



>ref|XP_011068058.1| PREDICTED: elongation factor 1-gamma [Acromyrmex echinatior]
 gb|EGI69678.1| Elongation factor 1-gamma [Acromyrmex echinatior]
Length=432

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 74/120 (62%), Gaps = 5/120 (4%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            +L++  EN  A+ ALI A++ G+++++  +F  G +NK+  FLK  P+GKVP  ET DG 
Sbjct  5    ILYTYPENFRAYKALIAAQFSGIQIKIADDFVFGETNKSEAFLKKFPLGKVPAFETCDGK  64

Query  257  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  433
             I ESNAIA YVA    ++ L G + IE   + QW  FA +EI   +  W++P LG + Y
Sbjct  65   YITESNAIAYYVA----NDQLRGKTDIERALVIQWLGFADSEILPASCAWVFPLLGIMPY  120



>gb|ABS57446.1| elongation factor 1 gamma [Heliconius melpomene]
Length=193

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 69/119 (58%), Gaps = 6/119 (5%)
 Frame = +2

Query  77   VLHSPNENKNAFXALIVAEYCGVKVELTXNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  256
            VL++  EN  A+ ALI A+Y G  V++  NF  G SNK+ EFLK  P GKVP  E+ DG 
Sbjct  5    VLYTYPENFRAYKALIAAQYSGADVKVDPNFVFGESNKSEEFLKKFPAGKVPAYESADGK  64

Query  257  IF--ESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  427
            +   ESNAIA YVA    +  L GS +     I QW  +A +E+   +  W++P LG +
Sbjct  65   VLLTESNAIAYYVA----NAALRGSDVAFQAAIYQWASWADSELLPASCAWVFPYLGIM  119



>gb|ABB02642.1| unknown [Solanum tuberosum]
Length=144

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  287  VAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLP  439
            +  +KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLG+ +Y+P
Sbjct  14   LLNLKPNNPLFGSSLIEYAQIEQWNDFSATEVDANIGRWLYPRLGYRVYIP  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880