BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF027B15

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KEH32684.1|  oligopeptide transporter OPT family protein             335   5e-109   Medicago truncatula
ref|XP_009590288.1|  PREDICTED: oligopeptide transporter 3              337   4e-107   Nicotiana tomentosiformis
ref|XP_006352325.1|  PREDICTED: oligopeptide transporter 3-like         335   2e-106   Solanum tuberosum [potatoes]
gb|KEH32683.1|  oligopeptide transporter OPT family protein             333   6e-106   Medicago truncatula
ref|XP_011095913.1|  PREDICTED: oligopeptide transporter 3              333   7e-106   Sesamum indicum [beniseed]
ref|XP_004250295.1|  PREDICTED: oligopeptide transporter 3              332   4e-105   Solanum lycopersicum
emb|CDP04526.1|  unnamed protein product                                329   2e-104   Coffea canephora [robusta coffee]
gb|KDO78545.1|  hypothetical protein CISIN_1g004659mg                   317   6e-104   Citrus sinensis [apfelsine]
gb|EYU27660.1|  hypothetical protein MIMGU_mgv1a001879mg                328   8e-104   Erythranthe guttata [common monkey flower]
gb|KDO78543.1|  hypothetical protein CISIN_1g004659mg                   318   6e-103   Citrus sinensis [apfelsine]
gb|KDO78544.1|  hypothetical protein CISIN_1g004659mg                   319   2e-102   Citrus sinensis [apfelsine]
ref|XP_010939248.1|  PREDICTED: oligopeptide transporter 3-like         322   8e-102   Elaeis guineensis
ref|XP_004507597.1|  PREDICTED: oligopeptide transporter 3-like         322   1e-101   Cicer arietinum [garbanzo]
ref|XP_002308764.1|  OLIGOPEPTIDE TRANSPORTER family protein            321   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_008785648.1|  PREDICTED: oligopeptide transporter 3-like         321   2e-101   Phoenix dactylifera
ref|XP_007026363.1|  Oligopeptide transporter isoform 2                 319   3e-101   
ref|XP_011040169.1|  PREDICTED: oligopeptide transporter 3              321   3e-101   Populus euphratica
ref|XP_011002374.1|  PREDICTED: oligopeptide transporter 3-like         321   4e-101   Populus euphratica
emb|CBI18634.3|  unnamed protein product                                320   1e-100   Vitis vinifera
ref|XP_002273768.2|  PREDICTED: oligopeptide transporter 3              319   2e-100   Vitis vinifera
ref|XP_007154044.1|  hypothetical protein PHAVU_003G086500g             319   2e-100   Phaseolus vulgaris [French bean]
ref|XP_009773627.1|  PREDICTED: oligopeptide transporter 3              319   2e-100   Nicotiana sylvestris
ref|XP_006283198.1|  hypothetical protein CARUB_v10004230mg             318   2e-100   Capsella rubella
sp|O23482.3|OPT3_ARATH  RecName: Full=Oligopeptide transporter 3;...    318   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380132.1|  PREDICTED: oligopeptide transporter 3-like         318   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007026362.1|  Oligopeptide transporter isoform 1                 318   2e-100   
ref|NP_567493.5|  oligopeptide transporter                              318   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414361.1|  hypothetical protein EUTSA_v10024512mg             318   4e-100   Eutrema salsugineum [saltwater cress]
ref|XP_010907563.1|  PREDICTED: oligopeptide transporter 3-like         318   5e-100   Elaeis guineensis
gb|KJB67417.1|  hypothetical protein B456_010G190300                    317   7e-100   Gossypium raimondii
ref|XP_002868139.1|  hypothetical protein ARALYDRAFT_355122             317   8e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_010440168.1|  PREDICTED: oligopeptide transporter 3-like         317   8e-100   Camelina sativa [gold-of-pleasure]
gb|AAK96781.1|  Unknown protein                                         317   9e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449801.1|  PREDICTED: oligopeptide transporter 3              317   9e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006449924.1|  hypothetical protein CICLE_v10014396mg             316   2e-99    Citrus clementina [clementine]
ref|XP_003529676.1|  PREDICTED: oligopeptide transporter 3-like         316   3e-99    Glycine max [soybeans]
gb|KDO78542.1|  hypothetical protein CISIN_1g004659mg                   316   3e-99    Citrus sinensis [apfelsine]
ref|XP_006467278.1|  PREDICTED: oligopeptide transporter 3-like         316   3e-99    Citrus sinensis [apfelsine]
gb|KHG20373.1|  Oligopeptide transporter 3 -like protein                315   3e-99    Gossypium arboreum [tree cotton]
gb|KFK26550.1|  hypothetical protein AALP_AA8G263100                    315   3e-99    Arabis alpina [alpine rockcress]
ref|XP_010436532.1|  PREDICTED: oligopeptide transporter 3              315   5e-99    Camelina sativa [gold-of-pleasure]
ref|XP_009124517.1|  PREDICTED: oligopeptide transporter 3              315   7e-99    Brassica rapa
ref|XP_003549274.1|  PREDICTED: oligopeptide transporter 3-like         315   9e-99    Glycine max [soybeans]
ref|XP_008780991.1|  PREDICTED: oligopeptide transporter 3-like         314   1e-98    Phoenix dactylifera
ref|XP_010087657.1|  Oligopeptide transporter 3                         313   2e-98    
ref|XP_008224626.1|  PREDICTED: oligopeptide transporter 3              313   2e-98    Prunus mume [ume]
ref|XP_010270227.1|  PREDICTED: oligopeptide transporter 3              312   6e-98    Nelumbo nucifera [Indian lotus]
emb|CDY42539.1|  BnaC08g10640D                                          311   2e-97    Brassica napus [oilseed rape]
gb|ABF70152.1|  oligopeptide transporter OPT family protein             311   2e-97    Musa acuminata [banana]
ref|XP_008464311.1|  PREDICTED: oligopeptide transporter 3              309   9e-97    Cucumis melo [Oriental melon]
gb|KDP35505.1|  hypothetical protein JCGZ_08943                         309   9e-97    Jatropha curcas
ref|XP_009397220.1|  PREDICTED: oligopeptide transporter 3-like         309   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|ADW09325.1|  oligopeptide transporter 3                              309   1e-96    Noccaea caerulescens
ref|XP_010039442.1|  PREDICTED: oligopeptide transporter 3-like         308   3e-96    Eucalyptus grandis [rose gum]
ref|XP_004139520.1|  PREDICTED: oligopeptide transporter 3-like         308   3e-96    Cucumis sativus [cucumbers]
ref|XP_003559475.2|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    301   3e-96    
ref|XP_008345787.1|  PREDICTED: oligopeptide transporter 3-like         308   5e-96    Malus domestica [apple tree]
ref|XP_007211357.1|  hypothetical protein PRUPE_ppa001984mg             307   5e-96    
ref|XP_010686627.1|  PREDICTED: oligopeptide transporter 3              307   7e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009374520.1|  PREDICTED: oligopeptide transporter 3              306   2e-95    Pyrus x bretschneideri [bai li]
ref|XP_010057794.1|  PREDICTED: oligopeptide transporter 3-like         305   5e-95    Eucalyptus grandis [rose gum]
ref|XP_010542186.1|  PREDICTED: oligopeptide transporter 3              304   9e-95    Tarenaya hassleriana [spider flower]
gb|AAO32313.1|  putative oligopeptide transporter protein               303   2e-94    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051290.1|  Os03g0751100                                       303   4e-94    
ref|XP_009404107.1|  PREDICTED: oligopeptide transporter 3-like         302   4e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004295330.1|  PREDICTED: oligopeptide transporter 3              300   2e-93    Fragaria vesca subsp. vesca
dbj|BAK07444.1|  predicted protein                                      300   3e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006651827.1|  PREDICTED: oligopeptide transporter 3-like         300   3e-93    
ref|XP_008349335.1|  PREDICTED: oligopeptide transporter 3-like         299   9e-93    
ref|XP_009374859.1|  PREDICTED: oligopeptide transporter 3-like         299   1e-92    Pyrus x bretschneideri [bai li]
ref|XP_002463867.1|  hypothetical protein SORBIDRAFT_01g007880          296   1e-91    Sorghum bicolor [broomcorn]
gb|ACL82964.1|  glutathione transporter                                 296   1e-91    Zea mays [maize]
gb|EMT33592.1|  Oligopeptide transporter 3                              295   2e-91    
gb|KCW45990.1|  hypothetical protein EUGRSUZ_L00158                     295   2e-91    Eucalyptus grandis [rose gum]
ref|XP_004981750.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    294   5e-91    
ref|XP_006856263.1|  hypothetical protein AMTR_s00047p00062520          293   1e-90    Amborella trichopoda
ref|XP_008665425.1|  PREDICTED: oligopeptide transporter 3              292   4e-90    
ref|XP_010039444.1|  PREDICTED: oligopeptide transporter 3-like i...    292   4e-90    Eucalyptus grandis [rose gum]
gb|EMS48793.1|  Oligopeptide transporter 3                              286   2e-89    Triticum urartu
gb|ABB55328.1|  small oligopeptide transporter, OPT family              290   3e-89    Asparagus officinalis
gb|AAQ91200.1|  putative glutathione transporter                        286   6e-88    Zea mays [maize]
gb|ADW66457.1|  oligopeptide transporter                                273   4e-83    Phytolacca americana [common pokeberry]
gb|KHN42268.1|  Oligopeptide transporter 3                              272   7e-83    Glycine soja [wild soybean]
ref|XP_010039443.1|  PREDICTED: oligopeptide transporter 3-like         257   2e-77    Eucalyptus grandis [rose gum]
ref|XP_002522882.1|  Oligopeptide transporter, putative                 253   2e-75    
emb|CAB10414.1|  isp4 like protein                                      248   8e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008361590.1|  PREDICTED: oligopeptide transporter 2-like         238   3e-71    
gb|AEJ88342.1|  putative oligopeptide transporter                       236   7e-71    Tamarix hispida
ref|XP_008374100.1|  PREDICTED: oligopeptide transporter 7-like i...    229   2e-70    
ref|XP_010090590.1|  Oligopeptide transporter 7                         239   2e-70    
gb|KJB32170.1|  hypothetical protein B456_005G227300                    239   2e-70    Gossypium raimondii
gb|EYU33488.1|  hypothetical protein MIMGU_mgv1a0023121mg               234   7e-70    Erythranthe guttata [common monkey flower]
gb|KJB32172.1|  hypothetical protein B456_005G227300                    232   1e-69    Gossypium raimondii
ref|XP_011078507.1|  PREDICTED: oligopeptide transporter 4-like         237   2e-69    Sesamum indicum [beniseed]
ref|XP_004136415.1|  PREDICTED: oligopeptide transporter 2-like         237   2e-69    Cucumis sativus [cucumbers]
ref|XP_011070370.1|  PREDICTED: oligopeptide transporter 7              237   2e-69    Sesamum indicum [beniseed]
ref|XP_008338986.1|  PREDICTED: oligopeptide transporter 2-like         236   2e-69    
ref|XP_002981747.1|  hypothetical protein SELMODRAFT_179057             237   2e-69    Selaginella moellendorffii
ref|XP_002967597.1|  hypothetical protein SELMODRAFT_88962              237   3e-69    Selaginella moellendorffii
ref|XP_010553673.1|  PREDICTED: oligopeptide transporter 2              236   4e-69    Tarenaya hassleriana [spider flower]
ref|XP_009366376.1|  PREDICTED: oligopeptide transporter 2-like         236   4e-69    Pyrus x bretschneideri [bai li]
dbj|BAJ97716.1|  predicted protein                                      231   8e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008466130.1|  PREDICTED: oligopeptide transporter 2              235   9e-69    Cucumis melo [Oriental melon]
ref|XP_010676880.1|  PREDICTED: oligopeptide transporter 7-like         235   9e-69    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006376658.1|  hypothetical protein POPTR_0012s02660g             226   1e-68    
ref|XP_002963418.1|  hypothetical protein SELMODRAFT_166204             234   2e-68    Selaginella moellendorffii
ref|XP_002283680.1|  PREDICTED: oligopeptide transporter 4              234   2e-68    Vitis vinifera
ref|XP_009775420.1|  PREDICTED: oligopeptide transporter 2-like         234   2e-68    Nicotiana sylvestris
emb|CDY06509.1|  BnaC06g11350D                                          221   2e-68    
gb|KDP41518.1|  hypothetical protein JCGZ_15925                         234   3e-68    Jatropha curcas
ref|XP_004143945.1|  PREDICTED: oligopeptide transporter 7-like         234   3e-68    Cucumis sativus [cucumbers]
ref|XP_011087976.1|  PREDICTED: oligopeptide transporter 4              234   3e-68    Sesamum indicum [beniseed]
gb|KJB24153.1|  hypothetical protein B456_004G130200                    234   4e-68    Gossypium raimondii
ref|XP_011016978.1|  PREDICTED: oligopeptide transporter 2              233   4e-68    Populus euphratica
ref|XP_004163578.1|  PREDICTED: oligopeptide transporter 7-like         234   4e-68    
ref|XP_006851884.1|  hypothetical protein AMTR_s00041p00121000          233   5e-68    
ref|XP_009790410.1|  PREDICTED: oligopeptide transporter 4              233   6e-68    Nicotiana sylvestris
ref|XP_002263530.1|  PREDICTED: oligopeptide transporter 4              233   7e-68    Vitis vinifera
ref|XP_002301110.1|  oligopeptide transporter OPT family protein        233   7e-68    
ref|XP_010254620.1|  PREDICTED: oligopeptide transporter 4-like         233   7e-68    Nelumbo nucifera [Indian lotus]
ref|XP_009619170.1|  PREDICTED: oligopeptide transporter 2-like         233   8e-68    Nicotiana tomentosiformis
gb|KHG17687.1|  Oligopeptide transporter 7                              233   8e-68    Gossypium arboreum [tree cotton]
ref|XP_002313213.2|  hypothetical protein POPTR_0009s08290g             233   8e-68    Populus trichocarpa [western balsam poplar]
emb|CAN79818.1|  hypothetical protein VITISV_040328                     232   1e-67    Vitis vinifera
ref|XP_002971556.1|  hypothetical protein SELMODRAFT_172313             232   1e-67    Selaginella moellendorffii
gb|KHG17686.1|  Oligopeptide transporter 7                              233   1e-67    Gossypium arboreum [tree cotton]
ref|XP_002283691.1|  PREDICTED: oligopeptide transporter 2              232   2e-67    Vitis vinifera
ref|XP_006343795.1|  PREDICTED: oligopeptide transporter 7-like         232   2e-67    Solanum tuberosum [potatoes]
ref|XP_002272972.2|  PREDICTED: oligopeptide transporter 7              232   2e-67    Vitis vinifera
ref|XP_004245468.1|  PREDICTED: oligopeptide transporter 7-like         232   2e-67    Solanum lycopersicum
emb|CDP12213.1|  unnamed protein product                                232   2e-67    Coffea canephora [robusta coffee]
ref|XP_004238028.1|  PREDICTED: oligopeptide transporter 4-like         232   2e-67    Solanum lycopersicum
ref|XP_006364985.1|  PREDICTED: oligopeptide transporter 2-like i...    231   2e-67    
ref|XP_009359568.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    232   2e-67    Pyrus x bretschneideri [bai li]
ref|XP_006364982.1|  PREDICTED: oligopeptide transporter 4-like         231   2e-67    Solanum tuberosum [potatoes]
emb|CDO97358.1|  unnamed protein product                                221   2e-67    Coffea canephora [robusta coffee]
gb|KDP25233.1|  hypothetical protein JCGZ_20389                         231   3e-67    Jatropha curcas
ref|XP_010267481.1|  PREDICTED: oligopeptide transporter 7-like         231   3e-67    Nelumbo nucifera [Indian lotus]
emb|CDP19589.1|  unnamed protein product                                231   3e-67    Coffea canephora [robusta coffee]
ref|XP_002267184.1|  PREDICTED: oligopeptide transporter 1-like         231   3e-67    Vitis vinifera
emb|CBI19303.3|  unnamed protein product                                232   4e-67    Vitis vinifera
ref|XP_006364984.1|  PREDICTED: oligopeptide transporter 2-like i...    231   4e-67    Solanum tuberosum [potatoes]
ref|XP_011003045.1|  PREDICTED: oligopeptide transporter 4              231   4e-67    Populus euphratica
ref|XP_008390300.1|  PREDICTED: oligopeptide transporter 7 isofor...    230   4e-67    
gb|EMT01286.1|  Oligopeptide transporter 4                              230   4e-67    
ref|XP_006376659.1|  hypothetical protein POPTR_0012s02660g             226   5e-67    
gb|KJB32169.1|  hypothetical protein B456_005G227300                    230   6e-67    Gossypium raimondii
gb|EMS65129.1|  Oligopeptide transporter 7                              231   6e-67    Triticum urartu
ref|XP_007200086.1|  hypothetical protein PRUPE_ppa021086mg             230   6e-67    Prunus persica
ref|XP_010691453.1|  PREDICTED: oligopeptide transporter 4              230   6e-67    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006417516.1|  hypothetical protein EUTSA_v10009349mg             230   6e-67    Eutrema salsugineum [saltwater cress]
ref|XP_008239235.1|  PREDICTED: oligopeptide transporter 7-like         230   7e-67    Prunus mume [ume]
gb|EPS60835.1|  hypothetical protein M569_13965                         230   7e-67    Genlisea aurea
ref|XP_010538850.1|  PREDICTED: oligopeptide transporter 7              230   7e-67    Tarenaya hassleriana [spider flower]
ref|XP_004288878.1|  PREDICTED: oligopeptide transporter 2-like         230   8e-67    Fragaria vesca subsp. vesca
gb|KHG09371.1|  Oligopeptide transporter 4 -like protein                230   8e-67    Gossypium arboreum [tree cotton]
ref|XP_010676881.1|  PREDICTED: oligopeptide transporter 7              230   1e-66    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010475851.1|  PREDICTED: oligopeptide transporter 2-like         229   1e-66    Camelina sativa [gold-of-pleasure]
ref|XP_009132469.1|  PREDICTED: oligopeptide transporter 9-like         229   1e-66    Brassica rapa
ref|XP_007039426.1|  Oligopeptide transporter 7 isoform 1               230   1e-66    
ref|XP_008390299.1|  PREDICTED: oligopeptide transporter 7 isofor...    229   1e-66    Malus domestica [apple tree]
ref|XP_002437735.1|  hypothetical protein SORBIDRAFT_10g001530          230   1e-66    Sorghum bicolor [broomcorn]
gb|EMS68344.1|  Oligopeptide transporter 4                              229   1e-66    Triticum urartu
ref|XP_009358688.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    229   1e-66    
ref|XP_010501399.1|  PREDICTED: oligopeptide transporter 2              229   1e-66    Camelina sativa [gold-of-pleasure]
ref|XP_004309550.1|  PREDICTED: oligopeptide transporter 7              229   1e-66    Fragaria vesca subsp. vesca
ref|XP_006394156.1|  hypothetical protein EUTSA_v10003716mg             229   1e-66    Eutrema salsugineum [saltwater cress]
ref|XP_009765351.1|  PREDICTED: oligopeptide transporter 7-like         229   1e-66    Nicotiana sylvestris
gb|KDO67986.1|  hypothetical protein CISIN_1g029091mg                   215   1e-66    Citrus sinensis [apfelsine]
ref|XP_004309115.1|  PREDICTED: oligopeptide transporter 6-like         229   2e-66    Fragaria vesca subsp. vesca
emb|CDX86844.1|  BnaA09g22340D                                          229   2e-66    
ref|XP_010644607.1|  PREDICTED: oligopeptide transporter 1-like         229   2e-66    Vitis vinifera
ref|XP_009612437.1|  PREDICTED: oligopeptide transporter 4              229   2e-66    Nicotiana tomentosiformis
ref|XP_009801973.1|  PREDICTED: oligopeptide transporter 6-like         229   2e-66    Nicotiana sylvestris
ref|XP_006351838.1|  PREDICTED: oligopeptide transporter 4-like         229   2e-66    Solanum tuberosum [potatoes]
emb|CBI39770.3|  unnamed protein product                                229   2e-66    Vitis vinifera
ref|XP_010065750.1|  PREDICTED: oligopeptide transporter 4-like         229   2e-66    Eucalyptus grandis [rose gum]
ref|XP_004231372.1|  PREDICTED: oligopeptide transporter 4              229   2e-66    Solanum lycopersicum
ref|XP_009616769.1|  PREDICTED: oligopeptide transporter 2-like         229   2e-66    Nicotiana tomentosiformis
ref|XP_009108224.1|  PREDICTED: oligopeptide transporter 7              229   2e-66    Brassica rapa
emb|CBI19304.3|  unnamed protein product                                229   2e-66    Vitis vinifera
ref|XP_008437437.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    229   2e-66    Cucumis melo [Oriental melon]
ref|XP_009368318.1|  PREDICTED: oligopeptide transporter 4              229   2e-66    Pyrus x bretschneideri [bai li]
ref|XP_010458316.1|  PREDICTED: oligopeptide transporter 2-like         228   2e-66    Camelina sativa [gold-of-pleasure]
gb|KJB32171.1|  hypothetical protein B456_005G227300                    230   2e-66    Gossypium raimondii
ref|XP_002892535.1|  ATOPT2                                             228   2e-66    Arabidopsis lyrata subsp. lyrata
ref|XP_008349603.1|  PREDICTED: oligopeptide transporter 5-like         221   3e-66    
ref|XP_009608843.1|  PREDICTED: oligopeptide transporter 7-like         228   3e-66    Nicotiana tomentosiformis
ref|XP_007210345.1|  hypothetical protein PRUPE_ppa001827mg             228   3e-66    Prunus persica
ref|XP_009130453.1|  PREDICTED: oligopeptide transporter 4              228   3e-66    Brassica rapa
emb|CDY31321.1|  BnaA02g34200D                                          228   3e-66    Brassica napus [oilseed rape]
emb|CDY46800.1|  BnaC02g43080D                                          228   3e-66    Brassica napus [oilseed rape]
ref|XP_008803572.1|  PREDICTED: oligopeptide transporter 4-like i...    226   4e-66    Phoenix dactylifera
ref|XP_006397011.1|  hypothetical protein EUTSA_v10028453mg             228   4e-66    Eutrema salsugineum [saltwater cress]
gb|AAM64614.1|  Isp4-like protein                                       228   4e-66    Arabidopsis thaliana [mouse-ear cress]
emb|CDP00949.1|  unnamed protein product                                228   4e-66    Coffea canephora [robusta coffee]
ref|XP_006304646.1|  hypothetical protein CARUB_v10011782mg             228   4e-66    Capsella rubella
ref|XP_010484229.1|  PREDICTED: oligopeptide transporter 4              228   4e-66    Camelina sativa [gold-of-pleasure]
ref|XP_010444374.1|  PREDICTED: oligopeptide transporter 4-like         228   4e-66    Camelina sativa [gold-of-pleasure]
ref|XP_008803573.1|  PREDICTED: oligopeptide transporter 4-like i...    225   4e-66    Phoenix dactylifera
ref|XP_010461766.1|  PREDICTED: oligopeptide transporter 4-like         228   4e-66    Camelina sativa [gold-of-pleasure]
ref|NP_201246.1|  oligopeptide transporter 4                            228   4e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009615073.1|  PREDICTED: oligopeptide transporter 4-like         228   5e-66    Nicotiana tomentosiformis
ref|XP_004252726.1|  PREDICTED: oligopeptide transporter 2-like         228   6e-66    Solanum lycopersicum
ref|XP_007220230.1|  hypothetical protein PRUPE_ppa002014mg             227   6e-66    Prunus persica
gb|KHN03544.1|  Oligopeptide transporter 3                              227   6e-66    Glycine soja [wild soybean]
ref|XP_006289826.1|  hypothetical protein CARUB_v10003431mg             228   6e-66    Capsella rubella
ref|XP_006280078.1|  hypothetical protein CARUB_v10025959mg             227   6e-66    Capsella rubella
ref|XP_006851891.1|  hypothetical protein AMTR_s00041p00133990          228   6e-66    
ref|XP_008234693.1|  PREDICTED: oligopeptide transporter 6-like         227   6e-66    Prunus mume [ume]
ref|XP_008239237.1|  PREDICTED: oligopeptide transporter 7              228   6e-66    Prunus mume [ume]
gb|KCW63396.1|  hypothetical protein EUGRSUZ_G01042                     227   7e-66    Eucalyptus grandis [rose gum]
ref|NP_172464.1|  oligopeptide transporter 2                            227   7e-66    Arabidopsis thaliana [mouse-ear cress]
gb|ABE65610.1|  oligopeptide transporter OPT family protein             227   7e-66    Arabidopsis thaliana [mouse-ear cress]
gb|EEE68909.1|  hypothetical protein OsJ_27765                          227   7e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002303684.2|  hypothetical protein POPTR_0003s14540g             228   7e-66    
ref|XP_010065749.1|  PREDICTED: oligopeptide transporter 4-like         227   8e-66    
ref|XP_010455470.1|  PREDICTED: oligopeptide transporter 7-like         228   8e-66    Camelina sativa [gold-of-pleasure]
ref|XP_003555686.1|  PREDICTED: oligopeptide transporter 7              227   8e-66    Glycine max [soybeans]
ref|XP_010520948.1|  PREDICTED: oligopeptide transporter 6              227   8e-66    Tarenaya hassleriana [spider flower]
gb|KFK31865.1|  hypothetical protein AALP_AA6G168500                    227   9e-66    Arabis alpina [alpine rockcress]
emb|CDY14374.1|  BnaA10g06810D                                          226   9e-66    Brassica napus [oilseed rape]
ref|XP_002866614.1|  hypothetical protein ARALYDRAFT_496649             227   1e-65    Arabidopsis lyrata subsp. lyrata
ref|XP_008237085.1|  PREDICTED: oligopeptide transporter 4-like         227   1e-65    Prunus mume [ume]
gb|EPS60258.1|  hypothetical protein M569_14546                         226   1e-65    Genlisea aurea
ref|XP_004147543.1|  PREDICTED: oligopeptide transporter 4-like         227   1e-65    Cucumis sativus [cucumbers]
gb|KDO76687.1|  hypothetical protein CISIN_1g010747mg                   220   1e-65    Citrus sinensis [apfelsine]
ref|XP_010422002.1|  PREDICTED: oligopeptide transporter 7              227   1e-65    Camelina sativa [gold-of-pleasure]
dbj|BAJ87692.1|  predicted protein                                      226   1e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010436760.1|  PREDICTED: oligopeptide transporter 7-like         227   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_009601745.1|  PREDICTED: oligopeptide transporter 7-like         226   1e-65    Nicotiana tomentosiformis
gb|KDO76688.1|  hypothetical protein CISIN_1g010747mg                   220   1e-65    Citrus sinensis [apfelsine]
ref|NP_192815.1|  oligopeptide transporter 7                            227   2e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119900.1|  PREDICTED: oligopeptide transporter 9              226   2e-65    Brassica rapa
ref|XP_006655737.1|  PREDICTED: oligopeptide transporter 7-like         226   2e-65    
gb|EMT31419.1|  Oligopeptide transporter 7                              213   2e-65    
ref|XP_009128701.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    226   2e-65    Brassica rapa
gb|KJB58808.1|  hypothetical protein B456_009G227000                    226   2e-65    Gossypium raimondii
gb|KJB58807.1|  hypothetical protein B456_009G227000                    226   2e-65    Gossypium raimondii
gb|KFK26970.1|  hypothetical protein AALP_AA8G317000                    226   2e-65    Arabis alpina [alpine rockcress]
ref|XP_002283674.1|  PREDICTED: oligopeptide transporter 4-like         226   2e-65    Vitis vinifera
gb|KHG27446.1|  Oligopeptide transporter 4 -like protein                226   2e-65    Gossypium arboreum [tree cotton]
ref|XP_010267482.1|  PREDICTED: oligopeptide transporter 7-like         226   2e-65    Nelumbo nucifera [Indian lotus]
ref|XP_010029951.1|  PREDICTED: oligopeptide transporter 4-like         226   2e-65    Eucalyptus grandis [rose gum]
gb|KJB40152.1|  hypothetical protein B456_007G049100                    224   3e-65    Gossypium raimondii
ref|XP_006376657.1|  hypothetical protein POPTR_0012s02650g             226   3e-65    
ref|NP_001062118.1|  Os08g0492000                                       226   3e-65    
ref|XP_011043664.1|  PREDICTED: oligopeptide transporter 9-like         226   3e-65    Populus euphratica
ref|XP_011022429.1|  PREDICTED: oligopeptide transporter 7-like         226   3e-65    Populus euphratica
gb|EEC79904.1|  hypothetical protein OsI_21444                          226   3e-65    Oryza sativa Indica Group [Indian rice]
emb|CAN81605.1|  hypothetical protein VITISV_025060                     225   3e-65    Vitis vinifera
ref|XP_004160803.1|  PREDICTED: oligopeptide transporter 6-like         225   4e-65    
ref|XP_010537060.1|  PREDICTED: oligopeptide transporter 6-like         225   4e-65    Tarenaya hassleriana [spider flower]
ref|XP_004138881.1|  PREDICTED: oligopeptide transporter 6-like         225   4e-65    
ref|XP_004964383.1|  PREDICTED: oligopeptide transporter 7-like i...    226   4e-65    Setaria italica
ref|XP_010053083.1|  PREDICTED: oligopeptide transporter 7              225   5e-65    Eucalyptus grandis [rose gum]
ref|XP_003581597.1|  PREDICTED: oligopeptide transporter 4-like         225   5e-65    Brachypodium distachyon [annual false brome]
emb|CDY25261.1|  BnaA02g21950D                                          224   6e-65    Brassica napus [oilseed rape]
ref|XP_010246854.1|  PREDICTED: oligopeptide transporter 7-like         225   7e-65    Nelumbo nucifera [Indian lotus]
ref|NP_001056665.1|  Os06g0127700                                       225   7e-65    
ref|XP_002317799.2|  hypothetical protein POPTR_0012s02660g             224   8e-65    Populus trichocarpa [western balsam poplar]
ref|XP_010244695.1|  PREDICTED: oligopeptide transporter 4-like         224   8e-65    Nelumbo nucifera [Indian lotus]
dbj|BAJ85948.1|  predicted protein                                      224   8e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP42149.1|  hypothetical protein JCGZ_03016                         224   9e-65    Jatropha curcas
gb|KDO76686.1|  hypothetical protein CISIN_1g010747mg                   220   9e-65    Citrus sinensis [apfelsine]
ref|XP_004502063.1|  PREDICTED: oligopeptide transporter 7-like         224   9e-65    Cicer arietinum [garbanzo]
emb|CDY35662.1|  BnaC09g29840D                                          224   9e-65    Brassica napus [oilseed rape]
ref|XP_006401695.1|  hypothetical protein EUTSA_v10016096mg             224   1e-64    Eutrema salsugineum [saltwater cress]
ref|XP_008454451.1|  PREDICTED: oligopeptide transporter 4              224   1e-64    Cucumis melo [Oriental melon]
ref|XP_009407958.1|  PREDICTED: oligopeptide transporter 7-like         224   1e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803571.1|  PREDICTED: oligopeptide transporter 4-like i...    224   1e-64    Phoenix dactylifera
emb|CDY19030.1|  BnaC01g20380D                                          224   2e-64    Brassica napus [oilseed rape]
gb|EYU45286.1|  hypothetical protein MIMGU_mgv1a0020142mg               219   2e-64    Erythranthe guttata [common monkey flower]
ref|XP_007145948.1|  hypothetical protein PHAVU_006G000100g             224   2e-64    Phaseolus vulgaris [French bean]
ref|XP_006380596.1|  hypothetical protein POPTR_0007s09650g             224   2e-64    Populus trichocarpa [western balsam poplar]
ref|XP_010671041.1|  PREDICTED: oligopeptide transporter 2              223   2e-64    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002518892.1|  Oligopeptide transporter, putative                 224   2e-64    Ricinus communis
ref|XP_002275134.2|  PREDICTED: oligopeptide transporter 6-like         223   2e-64    
ref|XP_002447030.1|  hypothetical protein SORBIDRAFT_06g027230          223   2e-64    Sorghum bicolor [broomcorn]
ref|XP_010320236.1|  PREDICTED: oligopeptide transporter 2-like         223   2e-64    
ref|XP_009795358.1|  PREDICTED: oligopeptide transporter 2-like         223   2e-64    
ref|XP_011078837.1|  PREDICTED: oligopeptide transporter 7-like i...    223   3e-64    
gb|AES71704.2|  oligopeptide transporter OPT family protein             223   3e-64    
ref|XP_003601453.1|  Oligopeptide transporter                           223   3e-64    
ref|XP_010104574.1|  Oligopeptide transporter 4                         223   3e-64    
ref|XP_011078828.1|  PREDICTED: oligopeptide transporter 7-like i...    223   3e-64    
ref|XP_004235114.1|  PREDICTED: oligopeptide transporter 6              223   3e-64    
ref|XP_008790539.1|  PREDICTED: oligopeptide transporter 7-like         223   3e-64    
ref|XP_008349390.1|  PREDICTED: oligopeptide transporter 1-like         215   3e-64    
ref|XP_010048814.1|  PREDICTED: oligopeptide transporter 6              223   3e-64    
ref|XP_006350626.1|  PREDICTED: oligopeptide transporter 7-like         223   4e-64    
ref|XP_003564333.1|  PREDICTED: oligopeptide transporter 7-like         223   4e-64    
ref|XP_010029956.1|  PREDICTED: oligopeptide transporter 4-like         223   4e-64    
ref|XP_009349149.1|  PREDICTED: oligopeptide transporter 1-like         223   4e-64    
ref|NP_001056651.1|  Os06g0125500                                       223   4e-64    
gb|KCW56912.1|  hypothetical protein EUGRSUZ_I02589                     223   4e-64    
gb|KDO59178.1|  hypothetical protein CISIN_1g0044241mg                  222   4e-64    
ref|XP_010934151.1|  PREDICTED: oligopeptide transporter 7-like         223   4e-64    
gb|KJB40153.1|  hypothetical protein B456_007G049100                    223   5e-64    
ref|XP_006474840.1|  PREDICTED: oligopeptide transporter 1-like         223   5e-64    
ref|XP_008445079.1|  PREDICTED: oligopeptide transporter 6-like         222   5e-64    
ref|XP_008800083.1|  PREDICTED: oligopeptide transporter 4-like         222   5e-64    
ref|XP_002874647.1|  ATOPT7                                             223   5e-64    
ref|NP_200163.1|  oligopeptide transporter 9                            222   5e-64    
ref|XP_008806360.1|  PREDICTED: oligopeptide transporter 7-like         223   5e-64    
ref|XP_006452634.1|  hypothetical protein CICLE_v10007552mg             222   5e-64    
gb|KGN53886.1|  hypothetical protein Csa_4G179700                       222   6e-64    
ref|XP_008394097.1|  PREDICTED: oligopeptide transporter 7-like         222   6e-64    
ref|XP_008378664.1|  PREDICTED: oligopeptide transporter 2-like         222   7e-64    
emb|CDP19590.1|  unnamed protein product                                222   9e-64    
ref|XP_006433763.1|  hypothetical protein CICLE_v10003230mg             221   9e-64    
ref|XP_009412736.1|  PREDICTED: oligopeptide transporter 7-like         222   9e-64    
ref|XP_008663549.1|  PREDICTED: oligopeptide transporter 4-like         221   1e-63    
ref|XP_002864247.1|  ATOPT9                                             221   1e-63    
ref|XP_010244696.1|  PREDICTED: oligopeptide transporter 4-like         221   1e-63    
gb|KHG27803.1|  Oligopeptide transporter 7 -like protein                221   1e-63    
ref|XP_010112260.1|  Oligopeptide transporter 4                         221   1e-63    
ref|XP_007042780.1|  Oligopeptide transporter 4                         223   1e-63    
ref|XP_010252553.1|  PREDICTED: oligopeptide transporter 7-like         221   2e-63    
emb|CDP04527.1|  unnamed protein product                                220   2e-63    
ref|XP_004289821.1|  PREDICTED: oligopeptide transporter 4              221   2e-63    
ref|XP_002527347.1|  Oligopeptide transporter, putative                 221   2e-63    
ref|XP_008241834.1|  PREDICTED: oligopeptide transporter 7-like         221   2e-63    
ref|XP_008806363.1|  PREDICTED: oligopeptide transporter 7-like         221   2e-63    
gb|KFK28135.1|  hypothetical protein AALP_AA8G476800                    222   2e-63    
ref|XP_002306519.1|  hypothetical protein POPTR_0005s19410g             221   2e-63    
ref|XP_010482752.1|  PREDICTED: oligopeptide transporter 9              221   2e-63    
gb|KFK29294.1|  hypothetical protein AALP_AA7G114600                    220   2e-63    
ref|XP_007207290.1|  hypothetical protein PRUPE_ppa014997mg             221   2e-63    
ref|XP_008445076.1|  PREDICTED: oligopeptide transporter 6-like         220   2e-63    
ref|XP_006856596.1|  hypothetical protein AMTR_s00046p00213370          220   3e-63    
ref|XP_007039133.1|  Oligopeptide transporter 1 isoform 2               218   3e-63    
ref|XP_006475109.1|  PREDICTED: oligopeptide transporter 1-like         220   3e-63    
ref|XP_010520694.1|  PREDICTED: oligopeptide transporter 4              220   3e-63    
ref|XP_002518328.1|  Oligopeptide transporter, putative                 220   3e-63    
ref|XP_006660244.1|  PREDICTED: oligopeptide transporter 5-like         220   3e-63    
ref|XP_010933427.1|  PREDICTED: oligopeptide transporter 4-like         220   3e-63    
ref|XP_010064976.1|  PREDICTED: oligopeptide transporter 1-like         220   3e-63    
gb|KCW70462.1|  hypothetical protein EUGRSUZ_F03679                     219   4e-63    
dbj|BAD67732.1|  putative sexual differentiation process protein ...    220   4e-63    
ref|XP_003603705.1|  Oligopeptide transporter                           219   4e-63    
ref|XP_011015796.1|  PREDICTED: oligopeptide transporter 4-like         220   4e-63    
ref|XP_010064977.1|  PREDICTED: oligopeptide transporter 1-like         219   4e-63    
gb|EMT07894.1|  Oligopeptide transporter 7                              220   5e-63    
gb|EPS62495.1|  hypothetical protein M569_12295                         219   5e-63    
ref|XP_007204095.1|  hypothetical protein PRUPE_ppa002122mg             219   5e-63    
gb|KCW53168.1|  hypothetical protein EUGRSUZ_J02449                     216   5e-63    
ref|XP_002529653.1|  Oligopeptide transporter, putative                 220   5e-63    
ref|XP_006486776.1|  PREDICTED: oligopeptide transporter 4-like         219   5e-63    
ref|XP_009143920.1|  PREDICTED: oligopeptide transporter 6              219   5e-63    
ref|XP_009379386.1|  PREDICTED: oligopeptide transporter 7-like         219   6e-63    
ref|NP_001130398.1|  uncharacterized protein LOC100191494               220   6e-63    
ref|XP_006472404.1|  PREDICTED: oligopeptide transporter 4-like         219   6e-63    
ref|XP_006452632.1|  hypothetical protein CICLE_v10010604mg             219   6e-63    
ref|XP_006474839.1|  PREDICTED: oligopeptide transporter 1-like         219   7e-63    
ref|XP_004953568.1|  PREDICTED: oligopeptide transporter 4-like i...    219   7e-63    
ref|XP_004160804.1|  PREDICTED: oligopeptide transporter 6-like         219   7e-63    
ref|XP_011043662.1|  PREDICTED: oligopeptide transporter 9-like         219   8e-63    
ref|XP_009126974.1|  PREDICTED: oligopeptide transporter 1              219   8e-63    
ref|XP_007039132.1|  Oligopeptide transporter 1 isoform 1               219   8e-63    
emb|CDY06549.1|  BnaC02g12730D                                          219   9e-63    
ref|XP_006340746.1|  PREDICTED: oligopeptide transporter 7-like         219   9e-63    
emb|CDP01884.1|  unnamed protein product                                219   9e-63    
gb|EMS45172.1|  Oligopeptide transporter 7                              220   1e-62    
ref|XP_004953567.1|  PREDICTED: oligopeptide transporter 4-like i...    219   1e-62    
ref|XP_002864248.1|  predicted protein                                  219   1e-62    
ref|XP_010649021.1|  PREDICTED: oligopeptide transporter 7-like         219   1e-62    
ref|XP_004973781.1|  PREDICTED: oligopeptide transporter 1-like         219   1e-62    
ref|XP_002960906.1|  hypothetical protein SELMODRAFT_229868             218   1e-62    
ref|XP_010030910.1|  PREDICTED: oligopeptide transporter 4-like         218   1e-62    
ref|XP_003522539.1|  PREDICTED: oligopeptide transporter 9-like         218   1e-62    
gb|KCW53167.1|  hypothetical protein EUGRSUZ_J02449                     216   2e-62    
ref|XP_006422647.1|  hypothetical protein CICLE_v10027887mg             218   2e-62    
gb|KDO59179.1|  hypothetical protein CISIN_1g004845mg                   218   2e-62    
gb|KDP35526.1|  hypothetical protein JCGZ_08964                         218   2e-62    
ref|XP_007137663.1|  hypothetical protein PHAVU_009G145300g             218   2e-62    
ref|XP_006476310.1|  PREDICTED: oligopeptide transporter 7-like i...    218   2e-62    
ref|XP_006422648.1|  hypothetical protein CICLE_v10027887mg             218   2e-62    
ref|XP_009391956.1|  PREDICTED: oligopeptide transporter 7-like         218   2e-62    
ref|XP_010934487.1|  PREDICTED: oligopeptide transporter 7              218   2e-62    
gb|EYU21027.1|  hypothetical protein MIMGU_mgv1a026700mg                218   2e-62    
emb|CDY69955.1|  BnaCnng66090D                                          218   2e-62    
ref|XP_006476309.1|  PREDICTED: oligopeptide transporter 7-like i...    218   2e-62    
ref|XP_009118291.1|  PREDICTED: oligopeptide transporter 2              218   2e-62    
ref|XP_008219410.1|  PREDICTED: oligopeptide transporter 1-like         218   2e-62    
ref|XP_007046673.1|  Oligopeptide transporter 7 isoform 1               218   2e-62    
gb|KJB39494.1|  hypothetical protein B456_007G016300                    217   3e-62    
ref|XP_004502694.1|  PREDICTED: oligopeptide transporter 6-like         218   3e-62    
ref|XP_010109222.1|  Oligopeptide transporter 6                         218   3e-62    
ref|XP_003527991.1|  PREDICTED: oligopeptide transporter 9-like         217   3e-62    
ref|XP_006474841.1|  PREDICTED: oligopeptide transporter 1-like         218   3e-62    
ref|XP_009361323.1|  PREDICTED: oligopeptide transporter 6-like         217   3e-62    
ref|XP_006472993.1|  PREDICTED: oligopeptide transporter 2-like         217   3e-62    
ref|XP_006433764.1|  hypothetical protein CICLE_v10003491mg             217   3e-62    
ref|XP_010040072.1|  PREDICTED: oligopeptide transporter 7-like         218   3e-62    
ref|XP_007136469.1|  hypothetical protein PHAVU_009G047800g             217   4e-62    
ref|XP_006439249.1|  hypothetical protein CICLE_v10018971mg             217   4e-62    
ref|XP_009795933.1|  PREDICTED: oligopeptide transporter 7-like i...    217   4e-62    
ref|XP_011075935.1|  PREDICTED: oligopeptide transporter 6              217   4e-62    
ref|XP_009591882.1|  PREDICTED: oligopeptide transporter 7-like         217   4e-62    
ref|XP_006439250.1|  hypothetical protein CICLE_v10018971mg             217   4e-62    
ref|XP_008366119.1|  PREDICTED: oligopeptide transporter 1-like         213   4e-62    
ref|XP_006285678.1|  hypothetical protein CARUB_v10007142mg             217   4e-62    
ref|XP_010228050.1|  PREDICTED: oligopeptide transporter 7-like i...    217   4e-62    
ref|XP_003557106.2|  PREDICTED: oligopeptide transporter 7-like i...    217   4e-62    
ref|XP_002515831.1|  Oligopeptide transporter, putative                 217   4e-62    
ref|XP_004287803.1|  PREDICTED: oligopeptide transporter 7-like         217   5e-62    
ref|XP_006655730.1|  PREDICTED: oligopeptide transporter 7-like         217   5e-62    
ref|XP_009413226.1|  PREDICTED: oligopeptide transporter 4-like         217   5e-62    
ref|XP_002967106.1|  hypothetical protein SELMODRAFT_87413              217   5e-62    
ref|XP_006452635.1|  hypothetical protein CICLE_v10007550mg             217   5e-62    
gb|KCW56911.1|  hypothetical protein EUGRSUZ_I02587                     217   5e-62    
ref|NP_200164.1|  oligopeptide transporter 8                            217   5e-62    
ref|XP_009379497.1|  PREDICTED: oligopeptide transporter 1-like         217   5e-62    
ref|XP_009367290.1|  PREDICTED: oligopeptide transporter 1-like         217   5e-62    
ref|XP_011008821.1|  PREDICTED: oligopeptide transporter 7-like         217   6e-62    
ref|XP_010030911.1|  PREDICTED: oligopeptide transporter 4-like         216   6e-62    
ref|XP_010445886.1|  PREDICTED: oligopeptide transporter 8              216   7e-62    
gb|EMT05384.1|  Oligopeptide transporter 4                              204   7e-62    
ref|XP_010448085.1|  PREDICTED: oligopeptide transporter 6              216   7e-62    
ref|XP_010438561.1|  PREDICTED: oligopeptide transporter 6              216   7e-62    
ref|XP_002867483.1|  ATOPT6                                             216   8e-62    
ref|NP_194503.1|  oligopeptide transporter                              216   8e-62    
ref|XP_011074283.1|  PREDICTED: oligopeptide transporter 4-like         216   9e-62    
ref|XP_002864417.1|  ATOPT1                                             216   9e-62    
ref|XP_003519862.1|  PREDICTED: oligopeptide transporter 7-like         216   1e-61    
ref|XP_008339039.1|  PREDICTED: oligopeptide transporter 2-like         216   1e-61    
ref|XP_008440830.1|  PREDICTED: oligopeptide transporter 7-like         216   1e-61    
ref|XP_010446080.1|  PREDICTED: oligopeptide transporter 9-like         216   1e-61    
ref|XP_008663011.1|  PREDICTED: oligopeptide transporter 5-like         216   1e-61    
ref|NP_194389.1|  oligopeptide transporter 5                            216   1e-61    
ref|XP_007224505.1|  hypothetical protein PRUPE_ppa022679mg             216   1e-61    
ref|XP_008219210.1|  PREDICTED: oligopeptide transporter 2-like         216   1e-61    
ref|XP_002452706.1|  hypothetical protein SORBIDRAFT_04g031070          216   1e-61    
ref|XP_006452637.1|  hypothetical protein CICLE_v10007550mg             216   1e-61    
ref|XP_006413036.1|  hypothetical protein EUTSA_v10024519mg             216   1e-61    
ref|XP_006281882.1|  hypothetical protein CARUB_v10028080mg             216   1e-61    
dbj|BAD08159.1|  sexual differentiation process protein isp4-like       202   1e-61    
ref|XP_006343361.1|  PREDICTED: oligopeptide transporter 7-like         216   1e-61    
ref|XP_002452707.1|  hypothetical protein SORBIDRAFT_04g031080          216   1e-61    
ref|XP_008376782.1|  PREDICTED: oligopeptide transporter 6              215   1e-61    
ref|XP_004138770.1|  PREDICTED: oligopeptide transporter 6-like         216   1e-61    
emb|CDY22616.1|  BnaC08g42500D                                          216   1e-61    
gb|KFK29177.1|  hypothetical protein AALP_AA7G099400                    216   2e-61    
ref|XP_004135024.1|  PREDICTED: oligopeptide transporter 7-like         216   2e-61    
ref|XP_004972025.1|  PREDICTED: oligopeptide transporter 4-like         216   2e-61    
ref|XP_008648099.1|  PREDICTED: uncharacterized protein LOC100383...    215   2e-61    
ref|XP_004169608.1|  PREDICTED: oligopeptide transporter 7-like         216   2e-61    
gb|KGN48927.1|  hypothetical protein Csa_6G506530                       215   2e-61    
ref|XP_006425445.1|  hypothetical protein CICLE_v10024968mg             215   2e-61    
ref|XP_006401399.1|  hypothetical protein EUTSA_v10012759mg             215   2e-61    
ref|XP_007020440.1|  Oligopeptide transporter 5                         215   3e-61    
emb|CCO06497.1|  oligopeptide transporter                               215   3e-61    
ref|XP_010442919.1|  PREDICTED: oligopeptide transporter 8-like         214   3e-61    
gb|KFK27168.1|  hypothetical protein AALP_AA8G344300                    214   3e-61    
ref|XP_004953566.1|  PREDICTED: oligopeptide transporter 4-like         215   3e-61    
ref|XP_008219191.1|  PREDICTED: oligopeptide transporter 2-like         214   4e-61    
ref|XP_009366375.1|  PREDICTED: oligopeptide transporter 2-like         214   4e-61    
ref|XP_010483061.1|  PREDICTED: oligopeptide transporter 1              214   4e-61    
ref|XP_010443233.1|  PREDICTED: oligopeptide transporter 1-like         214   4e-61    
ref|XP_002436389.1|  hypothetical protein SORBIDRAFT_10g001670          214   5e-61    
gb|KDO59669.1|  hypothetical protein CISIN_1g009296mg                   211   5e-61    
ref|XP_006281558.1|  hypothetical protein CARUB_v10027665mg             214   6e-61    
ref|XP_010450442.1|  PREDICTED: oligopeptide transporter 1-like         214   6e-61    
ref|XP_002445962.1|  hypothetical protein SORBIDRAFT_07g028740          214   6e-61    
ref|XP_010064240.1|  PREDICTED: oligopeptide transporter 4-like         214   6e-61    
ref|XP_008646108.1|  PREDICTED: oligopeptide transporter 4-like         214   6e-61    
ref|XP_003572326.1|  PREDICTED: oligopeptide transporter 5-like         214   7e-61    
ref|NP_001152089.1|  oligopeptide transporter 4                         214   7e-61    
ref|XP_009773684.1|  PREDICTED: oligopeptide transporter 7-like i...    214   7e-61    
dbj|BAJ90957.1|  predicted protein                                      214   8e-61    
ref|XP_004151247.1|  PREDICTED: oligopeptide transporter 1-like         214   8e-61    
gb|AES90550.2|  oligopeptide transporter OPT family protein             213   8e-61    
ref|XP_010545870.1|  PREDICTED: oligopeptide transporter 1-like         214   9e-61    
gb|KGN44392.1|  hypothetical protein Csa_7G279240                       213   9e-61    
ref|XP_004976663.1|  PREDICTED: oligopeptide transporter 4-like         213   9e-61    
ref|XP_003593303.1|  Oligopeptide transporter                           213   1e-60    
ref|XP_006401694.1|  hypothetical protein EUTSA_v10015543mg             213   1e-60    
gb|KCW76554.1|  hypothetical protein EUGRSUZ_D00943                     213   1e-60    
ref|XP_002298878.2|  hypothetical protein POPTR_0001s37840g             213   1e-60    
ref|XP_008677393.1|  PREDICTED: oligopeptide transporter 4 isofor...    213   1e-60    
ref|XP_003608353.1|  Oligopeptide transporter                           213   1e-60    
ref|XP_007225210.1|  hypothetical protein PRUPE_ppa002011mg             213   1e-60    
ref|XP_009127158.1|  PREDICTED: oligopeptide transporter 8              213   1e-60    
ref|XP_003570148.1|  PREDICTED: oligopeptide transporter 4-like         213   1e-60    
emb|CDY28832.1|  BnaA02g10240D                                          213   1e-60    
ref|XP_004288877.2|  PREDICTED: oligopeptide transporter 2-like         213   1e-60    
ref|XP_003617851.1|  Oligopeptide transporter OPT family                213   2e-60    
ref|XP_006279740.1|  hypothetical protein CARUB_v10027572mg             213   2e-60    
ref|XP_010052485.1|  PREDICTED: oligopeptide transporter 1-like         213   2e-60    
ref|XP_008222894.1|  PREDICTED: oligopeptide transporter 1-like         210   2e-60    
emb|CDX96230.1|  BnaC02g14210D                                          212   2e-60    
gb|AET00810.2|  oligopeptide transporter OPT family protein             213   2e-60    
ref|XP_010096485.1|  Oligopeptide transporter 1                         212   2e-60    
emb|CDY38751.1|  BnaC03g14980D                                          212   3e-60    
gb|KCW66677.1|  hypothetical protein EUGRSUZ_F00450                     212   3e-60    
ref|XP_008466652.1|  PREDICTED: oligopeptide transporter 4-like         212   3e-60    
ref|XP_010064243.1|  PREDICTED: oligopeptide transporter 4-like         212   3e-60    
ref|XP_010096486.1|  Oligopeptide transporter 1                         212   3e-60    
ref|XP_007142437.1|  hypothetical protein PHAVU_008G280400g             212   3e-60    



>gb|KEH32684.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=546

 Score =   335 bits (860),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 180/203 (89%), Gaps = 3/203 (1%)
 Frame = +2

Query  59   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+ +NP    EK +   P   RCP+EEVALVVPETDDP+LPV+TFR+WFLGITSCIILIF
Sbjct  1    MAPMNPTPDTEKASNGVPPDDRCPIEEVALVVPETDDPSLPVMTFRSWFLGITSCIILIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF +RTQPL+ISAILMQI+VLPIGKFMAATLP +++  FGRW FTLNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLTISAILMQIAVLPIGKFMAATLPTKEYNFFGRWRFTLNPGPFNMKEHV  120

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ+LSFL  L IVLTTQ++GYGWAG+LRRY
Sbjct  121  IITIFANCGVSQGGGDAYSIGAITIMKAYYKQSLSFLLALFIVLTTQILGYGWAGILRRY  180

Query  590  LVDPVDMWWPSNLAQVSLFXALH  658
            LVDPV+MWWPSNLAQVSLF ALH
Sbjct  181  LVDPVEMWWPSNLAQVSLFRALH  203



>ref|XP_009590288.1| PREDICTED: oligopeptide transporter 3 [Nicotiana tomentosiformis]
Length=751

 Score =   337 bits (863),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 180/200 (90%), Gaps = 3/200 (2%)
 Frame = +2

Query  68   LNPATAGEKTAP---SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            L P+ AG+          RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNT
Sbjct  14   LPPSAAGKLNGEPPADHERCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNT  73

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FFIYRTQPL+ISAILMQI+VLPIGKFMAATLP++ +  FGRW F+LNPGPFNIKEHVIIT
Sbjct  74   FFIYRTQPLTISAILMQIAVLPIGKFMAATLPKKNYTLFGRWGFSLNPGPFNIKEHVIIT  133

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            VMANCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLC L+IVLTTQ++GYGWAG+LRRYLVD
Sbjct  134  VMANCGVSIGGGDAYSIGAITVMKAYYKQSLNFLCALLIVLTTQIVGYGWAGMLRRYLVD  193

Query  599  PVDMWWPSNLAQVSLFXALH  658
            PVDMWWPSNLAQVSLF ALH
Sbjct  194  PVDMWWPSNLAQVSLFRALH  213



>ref|XP_006352325.1| PREDICTED: oligopeptide transporter 3-like [Solanum tuberosum]
Length=752

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 178/192 (93%), Gaps = 1/192 (1%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G+  +    RCPVEEVALVVPETDDPTLPV+TFRAWFLG++SC ILIFLNTFFIYRTQPL
Sbjct  23   GDTLSSDDDRCPVEEVALVVPETDDPTLPVMTFRAWFLGLSSCTILIFLNTFFIYRTQPL  82

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRW-SFTLNPGPFNIKEHVIITVMANCGVS  442
            +ISAILMQI+VLPIGKFMAATLP++ FA FGRW SF+LNPGPFNIKEHV+ITVMANCGVS
Sbjct  83   TISAILMQIAVLPIGKFMAATLPKKNFALFGRWGSFSLNPGPFNIKEHVVITVMANCGVS  142

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             GGGDAYSIGAIT+M+AYY Q++SFLC LIIVLTTQ++GYGWAG+LRRYLVDPVDMWWPS
Sbjct  143  IGGGDAYSIGAITVMRAYYNQSVSFLCSLIIVLTTQILGYGWAGMLRRYLVDPVDMWWPS  202

Query  623  NLAQVSLFXALH  658
            NLAQVSLF ALH
Sbjct  203  NLAQVSLFRALH  214



>gb|KEH32683.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=741

 Score =   333 bits (854),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 180/203 (89%), Gaps = 3/203 (1%)
 Frame = +2

Query  59   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+ +NP    EK +   P   RCP+EEVALVVPETDDP+LPV+TFR+WFLGITSCIILIF
Sbjct  1    MAPMNPTPDTEKASNGVPPDDRCPIEEVALVVPETDDPSLPVMTFRSWFLGITSCIILIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF +RTQPL+ISAILMQI+VLPIGKFMAATLP +++  FGRW FTLNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLTISAILMQIAVLPIGKFMAATLPTKEYNFFGRWRFTLNPGPFNMKEHV  120

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ+LSFL  L IVLTTQ++GYGWAG+LRRY
Sbjct  121  IITIFANCGVSQGGGDAYSIGAITIMKAYYKQSLSFLLALFIVLTTQILGYGWAGILRRY  180

Query  590  LVDPVDMWWPSNLAQVSLFXALH  658
            LVDPV+MWWPSNLAQVSLF ALH
Sbjct  181  LVDPVEMWWPSNLAQVSLFRALH  203



>ref|XP_011095913.1| PREDICTED: oligopeptide transporter 3 [Sesamum indicum]
Length=740

 Score =   333 bits (854),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 179/196 (91%), Gaps = 2/196 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             PA+ GE  A +  RC VEEVALVVPETDDPTLPV+TFRAW LG+ SCIILIFLNTFFIY
Sbjct  9    KPASNGE--AETEERCSVEEVALVVPETDDPTLPVMTFRAWVLGLASCIILIFLNTFFIY  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI VLPIGKFMAATLP +++  FGRWSF+LNPGPFNIKEHVIITVMAN
Sbjct  67   RTQPLTISAILMQIGVLPIGKFMAATLPTKQYTVFGRWSFSLNPGPFNIKEHVIITVMAN  126

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+++FLC L+IVLTTQ++GYGWAG+LR+YLVDPV+M
Sbjct  127  CGVSIGGGDAYSIGAITVMKAYYKQSVNFLCALLIVLTTQILGYGWAGMLRKYLVDPVEM  186

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNLAQVSLF ALH
Sbjct  187  WWPSNLAQVSLFRALH  202



>ref|XP_004250295.1| PREDICTED: oligopeptide transporter 3 [Solanum lycopersicum]
Length=755

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 179/192 (93%), Gaps = 1/192 (1%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G+ ++ +  RC VEEVALVVPETDDP+LPV+TFRAWFLG++SC ILIFLNTFFIYRTQPL
Sbjct  26   GDASSTNDERCSVEEVALVVPETDDPSLPVMTFRAWFLGLSSCTILIFLNTFFIYRTQPL  85

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRW-SFTLNPGPFNIKEHVIITVMANCGVS  442
            +ISAILMQI+VLPIGKFMAATLP++ FA FGRW SF+LNPGPFNIKEHV+ITVMANCGVS
Sbjct  86   TISAILMQIAVLPIGKFMAATLPKKSFAIFGRWGSFSLNPGPFNIKEHVVITVMANCGVS  145

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             GGGDAYSIGAIT+M+AYY Q++SFLC LIIVLTTQ++GYGWAG+LRRYLVDPVDMWWPS
Sbjct  146  IGGGDAYSIGAITVMRAYYNQSVSFLCSLIIVLTTQILGYGWAGMLRRYLVDPVDMWWPS  205

Query  623  NLAQVSLFXALH  658
            NLAQVSLF ALH
Sbjct  206  NLAQVSLFRALH  217



>emb|CDP04526.1| unnamed protein product [Coffea canephora]
Length=755

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 176/195 (90%), Gaps = 2/195 (1%)
 Frame = +2

Query  80   TAGEKTAPSG--GRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
              G+  AP+    RC VEEVALVVPETDDPTLPV+TFRAWFLG+TSC ILIFLNTFFIYR
Sbjct  23   NGGDAPAPTDHKDRCAVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTILIFLNTFFIYR  82

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  433
            TQPL+ISAILMQI+VLPIGKFMA+ LP + +  FGRWSF+LNPGPFNIKEHVIITVMANC
Sbjct  83   TQPLTISAILMQIAVLPIGKFMASALPTKTYTLFGRWSFSLNPGPFNIKEHVIITVMANC  142

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
            GVS GGGDAYSIGAIT+M+AYYKQ LSFLC L+IVLTTQ++GYGWAG+LR+YLVDPV+MW
Sbjct  143  GVSIGGGDAYSIGAITVMRAYYKQTLSFLCALLIVLTTQILGYGWAGMLRKYLVDPVEMW  202

Query  614  WPSNLAQVSLFXALH  658
            WPSNLAQVSLF ALH
Sbjct  203  WPSNLAQVSLFRALH  217



>gb|KDO78545.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=388

 Score =   317 bits (813),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 173/196 (88%), Gaps = 4/196 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNLAQVSLF ALH
Sbjct  186  WWPSNLAQVSLFRALH  201



>gb|EYU27660.1| hypothetical protein MIMGU_mgv1a001879mg [Erythranthe guttata]
Length=745

 Score =   328 bits (840),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC VEEVALVVPETDDPTLPV+TFRAW LG+ SC ILIFLNTFFIYRTQPLSISAILMQI
Sbjct  26   RCSVEEVALVVPETDDPTLPVMTFRAWVLGLVSCTILIFLNTFFIYRTQPLSISAILMQI  85

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLP+G+FMAATLP +++A FGRW F+LNPGPFNIKEHVIITVMANCGVS GGGDAYSIG
Sbjct  86   AVLPVGRFMAATLPTKEYALFGRWRFSLNPGPFNIKEHVIITVMANCGVSVGGGDAYSIG  145

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ+L+FLC L+IVLTTQ++GYGWAG+LR+YLVDPV+MWWPSNLAQVSLF A
Sbjct  146  AITVMKAYYKQSLNFLCALLIVLTTQILGYGWAGMLRKYLVDPVEMWWPSNLAQVSLFRA  205

Query  653  LH  658
            LH
Sbjct  206  LH  207



>gb|KDO78543.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=490

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 173/196 (88%), Gaps = 4/196 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNLAQVSLF ALH
Sbjct  186  WWPSNLAQVSLFRALH  201



>gb|KDO78544.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=554

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 173/196 (88%), Gaps = 4/196 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNLAQVSLF ALH
Sbjct  186  WWPSNLAQVSLFRALH  201



>ref|XP_010939248.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=729

 Score =   322 bits (826),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             EK      RCPVEEVALVVPETDD +LPV+TFRAWFLGITSC +LIFLNTFF YRTQPL
Sbjct  2    AEKQEVDQERCPVEEVALVVPETDDMSLPVMTFRAWFLGITSCTVLIFLNTFFTYRTQPL  61

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQISVLP+G+FMA+ LP ++   FG+W F LNPGPFNIKEHVIITV ANCGVSP
Sbjct  62   TISAILMQISVLPLGRFMASALPNKEVKVFGQWGFNLNPGPFNIKEHVIITVFANCGVSP  121

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSN  625
            GGGDAYSIGAIT+MKAYY+Q+LSFLCGLIIV+TTQL+GYGWAG++R++LVDPV+MWWPS 
Sbjct  122  GGGDAYSIGAITVMKAYYRQSLSFLCGLIIVMTTQLLGYGWAGMMRKFLVDPVEMWWPST  181

Query  626  LAQVSLFXALH  658
            LAQVSLF ALH
Sbjct  182  LAQVSLFRALH  192



>ref|XP_004507597.1| PREDICTED: oligopeptide transporter 3-like [Cicer arietinum]
Length=739

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 178/203 (88%), Gaps = 4/203 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+  N  T  EK A   P   RCP+EEVALVVPETDDPTLPV+TFR+WFLGI SCI+LIF
Sbjct  1    MAPKNQTTDTEKAANGAPPDDRCPIEEVALVVPETDDPTLPVMTFRSWFLGIASCILLIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF +RTQPL+ISAILMQI+VLPIG+FMA+TLP ++++  G W F+LNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLAISAILMQIAVLPIGRFMASTLPTKEYSVLG-WRFSLNPGPFNMKEHV  119

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ++SFLC L IVLTTQ++GYGWAG+LRRY
Sbjct  120  IITIFANCGVSYGGGDAYSIGAITIMKAYYKQSISFLCALFIVLTTQILGYGWAGILRRY  179

Query  590  LVDPVDMWWPSNLAQVSLFXALH  658
            LVDPV+MWWPSNLAQVSLF ALH
Sbjct  180  LVDPVEMWWPSNLAQVSLFRALH  202



>ref|XP_002308764.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEE92287.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=744

 Score =   321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 175/201 (87%), Gaps = 4/201 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
              +GL   ++ E+      RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSCIILIFLN
Sbjct  11   HTNGLGLDSSAEEQHE---RCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCIILIFLN  67

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP R +   G WSF+LNPGPFN+KEHVII
Sbjct  68   TFFTYRTQPLTISAILMQIAVLPIGKFMAKTLPTRDYRILG-WSFSLNPGPFNMKEHVII  126

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSFLCGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  TIFANCGVSFGGGDAYSIGAITVMKAYYKQNLSFLCGLFIVLTTQILGYGWAGMLRRYLV  186

Query  596  DPVDMWWPSNLAQVSLFXALH  658
             PV+MWWPSNLAQVSLF ALH
Sbjct  187  YPVEMWWPSNLAQVSLFRALH  207



>ref|XP_008785648.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=730

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             EK      RCPVEEVALVVPE DDP+LPV+TFRAWFLGITSC +LIFLNTFF YRTQPL
Sbjct  2    AEKQEVEQERCPVEEVALVVPENDDPSLPVMTFRAWFLGITSCTVLIFLNTFFTYRTQPL  61

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQISVLP+G+ MA+ LP ++   FGRW F LNPGPFN+KEH IITV ANCGVSP
Sbjct  62   TISAILMQISVLPLGRLMASALPNKEVKVFGRWGFNLNPGPFNVKEHTIITVFANCGVSP  121

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSN  625
            GGGDAYSIGAIT+MKAYY+Q+LSFLCGLIIV+TTQL+GYGWAG+LR++LVDP +MWWPS+
Sbjct  122  GGGDAYSIGAITVMKAYYRQSLSFLCGLIIVITTQLLGYGWAGMLRKFLVDPAEMWWPSS  181

Query  626  LAQVSLFXALH  658
            LAQVSLF ALH
Sbjct  182  LAQVSLFRALH  192



>ref|XP_007026363.1| Oligopeptide transporter isoform 2 [Theobroma cacao]
 gb|EOY28985.1| Oligopeptide transporter isoform 2 [Theobroma cacao]
Length=680

 Score =   319 bits (818),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 1/188 (1%)
 Frame = +2

Query  95   TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSIS  274
             A    R PVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+IS
Sbjct  15   NAAEDDRSPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCMLLIFLNTFFTYRTQPLTIS  74

Query  275  AILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGG  454
            AILMQISVLPIGKFMA TLP R+++  GR SF+LNPGPFN+KEHVIIT+ ANCGVS GGG
Sbjct  75   AILMQISVLPIGKFMARTLPTREYSLLGR-SFSLNPGPFNMKEHVIITIFANCGVSFGGG  133

Query  455  DAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQ  634
            DAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQ
Sbjct  134  DAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQ  193

Query  635  VSLFXALH  658
            VSLF ALH
Sbjct  194  VSLFRALH  201



>ref|XP_011040169.1| PREDICTED: oligopeptide transporter 3 [Populus euphratica]
Length=743

 Score =   321 bits (822),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 172/190 (91%), Gaps = 1/190 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            +  A    RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSC+ILIFLNTFF YRTQPL+
Sbjct  18   DSAAEHHERCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCVILIFLNTFFTYRTQPLT  77

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            ISAILMQI+VLPIGKFMA TLP + +   G WSF+LNPGPFN+KEHVIIT+ ANCGVS G
Sbjct  78   ISAILMQIAVLPIGKFMAKTLPTKDYRILG-WSFSLNPGPFNMKEHVIITIFANCGVSYG  136

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
            GGDAYSIGAIT+MKAYY+Q+LSFLCGL+IVLTTQ++GYGWAG+LRRYLV PV+MWWPSNL
Sbjct  137  GGDAYSIGAITVMKAYYRQSLSFLCGLLIVLTTQILGYGWAGMLRRYLVYPVEMWWPSNL  196

Query  629  AQVSLFXALH  658
            AQVSLF ALH
Sbjct  197  AQVSLFRALH  206



>ref|XP_011002374.1| PREDICTED: oligopeptide transporter 3-like [Populus euphratica]
Length=744

 Score =   321 bits (822),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 175/201 (87%), Gaps = 4/201 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
              +GL   ++ E+      RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSCIILIFLN
Sbjct  11   HTNGLGLDSSAEEQHE---RCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCIILIFLN  67

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP R +   G WSF+LNPGPFN+KEHVII
Sbjct  68   TFFTYRTQPLTISAILMQIAVLPIGKFMAKTLPPRDYRILG-WSFSLNPGPFNMKEHVII  126

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSFLCGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  TIFANCGVSFGGGDAYSIGAITVMKAYYKQNLSFLCGLFIVLTTQILGYGWAGMLRRYLV  186

Query  596  DPVDMWWPSNLAQVSLFXALH  658
             PV+MWWPSNLAQVSLF ALH
Sbjct  187  YPVEMWWPSNLAQVSLFRALH  207



>emb|CBI18634.3| unnamed protein product [Vitis vinifera]
Length=752

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 176/197 (89%), Gaps = 3/197 (2%)
 Frame = +2

Query  74   PATAGEKT--APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            P T G++   AP G R PVEEVALVVPETDD TLPV+TFRAWFLGI SC +LIFLNTFF 
Sbjct  15   PTTNGKEATQAPEGERTPVEEVALVVPETDDQTLPVMTFRAWFLGIISCSLLIFLNTFFS  74

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRTQPL+ISAILMQI+VLP+GKFMA+TLP R+F  FG W F+LNPGPFN+KEHVIITV A
Sbjct  75   YRTQPLTISAILMQIAVLPVGKFMASTLPRREFKVFG-WGFSLNPGPFNMKEHVIITVFA  133

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LR+YLV+P +
Sbjct  134  NCGVSYGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRKYLVEPAE  193

Query  608  MWWPSNLAQVSLFXALH  658
            MWWPSNLAQVSLF ALH
Sbjct  194  MWWPSNLAQVSLFRALH  210



>ref|XP_002273768.2| PREDICTED: oligopeptide transporter 3 [Vitis vinifera]
Length=748

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 176/197 (89%), Gaps = 3/197 (2%)
 Frame = +2

Query  74   PATAGEKT--APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            P T G++   AP G R PVEEVALVVPETDD TLPV+TFRAWFLGI SC +LIFLNTFF 
Sbjct  15   PTTNGKEATQAPEGERTPVEEVALVVPETDDQTLPVMTFRAWFLGIISCSLLIFLNTFFS  74

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRTQPL+ISAILMQI+VLP+GKFMA+TLP R+F  FG W F+LNPGPFN+KEHVIITV A
Sbjct  75   YRTQPLTISAILMQIAVLPVGKFMASTLPRREFKVFG-WGFSLNPGPFNMKEHVIITVFA  133

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LR+YLV+P +
Sbjct  134  NCGVSYGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRKYLVEPAE  193

Query  608  MWWPSNLAQVSLFXALH  658
            MWWPSNLAQVSLF ALH
Sbjct  194  MWWPSNLAQVSLFRALH  210



>ref|XP_007154044.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
 gb|ESW26038.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
Length=741

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 177/204 (87%), Gaps = 5/204 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSG----GRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILI  226
            M+     T   + A +G     RCPVEEVALVVPETDDP+LPV+TFRAWFLG+ SC++LI
Sbjct  1    MAAAKTTTKDSEKAENGESPPDRCPVEEVALVVPETDDPSLPVMTFRAWFLGLASCVVLI  60

Query  227  FLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEH  406
            FLNTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP ++++  G W FTLNPGPFN+KEH
Sbjct  61   FLNTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYSFLG-WRFTLNPGPFNMKEH  119

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            VIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRR
Sbjct  120  VIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMLGYGWAGILRR  179

Query  587  YLVDPVDMWWPSNLAQVSLFXALH  658
            YLVDPV+MWWP+NLAQVSLF ALH
Sbjct  180  YLVDPVEMWWPANLAQVSLFRALH  203



>ref|XP_009773627.1| PREDICTED: oligopeptide transporter 3 [Nicotiana sylvestris]
Length=751

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNTFFIYRTQPL+ISAILMQI
Sbjct  32   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNTFFIYRTQPLTISAILMQI  91

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMAATLP++ +  FGRW F+LNPGPFNIKEHVIITVMANCGVS GGGDAYSIG
Sbjct  92   AVLPIGKFMAATLPKKSYTLFGRWGFSLNPGPFNIKEHVIITVMANCGVSIGGGDAYSIG  151

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ+L+FLC L++VLTTQL+GYGWAG+LRRYLVDPVDMWWPSNLAQVSLF A
Sbjct  152  AITVMKAYYKQSLNFLCALLLVLTTQLVGYGWAGMLRRYLVDPVDMWWPSNLAQVSLFRA  211

Query  653  LH  658
            LH
Sbjct  212  LH  213



>ref|XP_006283198.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
 gb|EOA16096.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
Length=737

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 175/201 (87%), Gaps = 5/201 (2%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   AG+K     +    RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLN
Sbjct  1    MDAEKAGDKNNAHLSSDHERCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLN  60

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G W+F+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WNFSLNPGPFNIKEHVII  119

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179

Query  596  DPVDMWWPSNLAQVSLFXALH  658
            DPVDMWWPSNLAQVSLF ALH
Sbjct  180  DPVDMWWPSNLAQVSLFRALH  200



>sp|O23482.3|OPT3_ARATH RecName: Full=Oligopeptide transporter 3; Short=AtOPT3 [Arabidopsis 
thaliana]
 gb|AAN72034.1| isp4 like protein [Arabidopsis thaliana]
Length=737

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 175/201 (87%), Gaps = 5/201 (2%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFRAWFLG+TSC++LIFLN
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRAWFLGLTSCVLLIFLN  60

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  119

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179

Query  596  DPVDMWWPSNLAQVSLFXALH  658
            DPVDMWWPSNLAQVSLF ALH
Sbjct  180  DPVDMWWPSNLAQVSLFRALH  200



>ref|XP_009380132.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=740

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 172/203 (85%), Gaps = 3/203 (1%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGG---RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+       G  TA  G    RCPVEEVALVVPETDDP+LPV+TFRAWFLG+TSC +LIF
Sbjct  1    MASKGENKGGSSTAEEGEEVERCPVEEVALVVPETDDPSLPVMTFRAWFLGLTSCSLLIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF YRTQPL+ISAILMQI+VLP G+FMA+ LP+R+   F  W F LNPGPFNIKEHV
Sbjct  61   LNTFFTYRTQPLTISAILMQIAVLPAGRFMASVLPDREVKVFRNWGFHLNPGPFNIKEHV  120

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC LIIVLTTQ++GYGWAG++RRY
Sbjct  121  IITIFANCGVSIGGGDAYSIGAITVMKAYYKQSLSFLCALIIVLTTQILGYGWAGMMRRY  180

Query  590  LVDPVDMWWPSNLAQVSLFXALH  658
            LVDP +MWWPSNLAQVSLF ALH
Sbjct  181  LVDPAEMWWPSNLAQVSLFRALH  203



>ref|XP_007026362.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
 gb|EOY28984.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
Length=739

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 1/188 (1%)
 Frame = +2

Query  95   TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSIS  274
             A    R PVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+IS
Sbjct  15   NAAEDDRSPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCMLLIFLNTFFTYRTQPLTIS  74

Query  275  AILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGG  454
            AILMQISVLPIGKFMA TLP R+++  GR SF+LNPGPFN+KEHVIIT+ ANCGVS GGG
Sbjct  75   AILMQISVLPIGKFMARTLPTREYSLLGR-SFSLNPGPFNMKEHVIITIFANCGVSFGGG  133

Query  455  DAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQ  634
            DAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQ
Sbjct  134  DAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQ  193

Query  635  VSLFXALH  658
            VSLF ALH
Sbjct  194  VSLFRALH  201



>ref|NP_567493.5| oligopeptide transporter [Arabidopsis thaliana]
 gb|AEE83738.1| oligopeptide transporter [Arabidopsis thaliana]
Length=737

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 175/201 (87%), Gaps = 5/201 (2%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFRAWFLG+TSC++LIFLN
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRAWFLGLTSCVLLIFLN  60

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  119

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179

Query  596  DPVDMWWPSNLAQVSLFXALH  658
            DPVDMWWPSNLAQVSLF ALH
Sbjct  180  DPVDMWWPSNLAQVSLFRALH  200



>ref|XP_006414361.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
 gb|ESQ55814.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
Length=736

 Score =   318 bits (815),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  19   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQI  78

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W F+LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  79   AVLPIGKFMARTLPTTSHKLMG-WEFSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  137

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLVDPVDMWWPSNLAQVSLF A
Sbjct  138  AITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  197

Query  653  LH  658
            LH
Sbjct  198  LH  199



>ref|XP_010907563.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=735

 Score =   318 bits (814),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +2

Query  83   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  262
            A  +  P   RCPVEEVALVVPETDDP+LPV+TFRAWFLG+ SCIILIFLNTFF YRTQP
Sbjct  7    ARPQAQPPEERCPVEEVALVVPETDDPSLPVMTFRAWFLGLASCIILIFLNTFFTYRTQP  66

Query  263  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            L+ISAILMQI+ LP+G+FMA+ LP ++    G WSF LNPGPFNIKEHVIIT+ ANCGVS
Sbjct  67   LTISAILMQIAALPLGQFMASVLPNKEVRLPGNWSFNLNPGPFNIKEHVIITIFANCGVS  126

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             GGGDAYSIGAIT+MKAYYKQ+LSFLC LIIVLTTQ++GYGWAG+LRRYLV+PV+MWWPS
Sbjct  127  IGGGDAYSIGAITVMKAYYKQSLSFLCALIIVLTTQILGYGWAGMLRRYLVEPVEMWWPS  186

Query  623  NLAQVSLFXALH  658
            NLAQVSLF ALH
Sbjct  187  NLAQVSLFRALH  198



>gb|KJB67417.1| hypothetical protein B456_010G190300 [Gossypium raimondii]
Length=741

 Score =   317 bits (813),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 174/196 (89%), Gaps = 3/196 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  AG  TA + G  PVEEVALVVPETDDPTLPVLTFRAWFLG+ SC++LIFLNTFF Y
Sbjct  11   KPNAAG--TAENEGMSPVEEVALVVPETDDPTLPVLTFRAWFLGLVSCVLLIFLNTFFTY  68

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQISVLPIGKFMA TLP  +++  G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  69   RTQPLTISAILMQISVLPIGKFMARTLPTTQYSLLG-WHFSLNPGPFNIKEHVIITIFAN  127

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCG++IVLTTQ++GYGWAG+LRRYLVDP +M
Sbjct  128  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGVLIVLTTQILGYGWAGMLRRYLVDPAEM  187

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNLAQVSLF ALH
Sbjct  188  WWPSNLAQVSLFRALH  203



>ref|XP_002868139.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44398.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
Length=737

 Score =   317 bits (813),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W+F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSHNLLG-WNFSLNPGPFNIKEHVIITIFANCGVSYGGGDAYSIG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLVDPVDMWWPSNLAQVSLF A
Sbjct  139  AITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  198

Query  653  LH  658
            LH
Sbjct  199  LH  200



>ref|XP_010440168.1| PREDICTED: oligopeptide transporter 3-like [Camelina sativa]
Length=737

 Score =   317 bits (812),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W FTLNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSRNLLG-WKFTLNPGPFNIKEHVIITIFANCGVSYGGGDAYSIG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ+L+F+CGL IVLTTQ+IGYGWAG+LRRYLVDPVDMWWPSNLAQVSLF A
Sbjct  139  AITVMKAYYKQSLTFICGLFIVLTTQIIGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  198

Query  653  LH  658
            LH
Sbjct  199  LH  200



>gb|AAK96781.1| Unknown protein [Arabidopsis thaliana]
Length=737

 Score =   317 bits (812),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 174/201 (87%), Gaps = 5/201 (2%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFR WFLG+TSC++LIFLN
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRTWFLGLTSCVLLIFLN  60

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  119

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179

Query  596  DPVDMWWPSNLAQVSLFXALH  658
            DPVDMWWPSNLAQVSLF ALH
Sbjct  180  DPVDMWWPSNLAQVSLFRALH  200



>ref|XP_010449801.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=737

 Score =   317 bits (812),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSRNLLG-WKFSLNPGPFNIKEHVIITIFANCGVSYGGGDAYSIG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ+LSF+CGL IVLTTQ+IGYGWAG+LRRYLVDPVDMWWPSNLAQVSLF A
Sbjct  139  AITVMKAYYKQSLSFICGLFIVLTTQIIGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  198

Query  653  LH  658
            LH
Sbjct  199  LH  200



>ref|XP_006449924.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
 gb|ESR63164.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
Length=739

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +RTQPL+ISAILMQI
Sbjct  21   RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTFRTQPLTISAILMQI  80

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  81   AVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFANCGVSFGGGDAYSIG  139

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+MWWPSNLAQVSLF A
Sbjct  140  AITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEMWWPSNLAQVSLFRA  199

Query  653  LH  658
            LH
Sbjct  200  LH  201



>ref|XP_003529676.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=742

 Score =   316 bits (809),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 174/199 (87%), Gaps = 4/199 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGG---RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            + +T  EK A       RCPVEEVALVVPETDDP+LPV+TFRAWFLGI SC++LIFLNTF
Sbjct  7    SSSTDAEKAANGESPPERCPVEEVALVVPETDDPSLPVMTFRAWFLGIASCVLLIFLNTF  66

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  421
            F +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G W FT NPGPFN+KEHVIIT+
Sbjct  67   FTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLG-WRFTFNPGPFNMKEHVIITI  125

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYLVDP
Sbjct  126  FANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMLGYGWAGILRRYLVDP  185

Query  602  VDMWWPSNLAQVSLFXALH  658
            V+MWWP+NLAQVSLF ALH
Sbjct  186  VEMWWPANLAQVSLFRALH  204



>gb|KDO78542.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=739

 Score =   316 bits (809),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 173/196 (88%), Gaps = 4/196 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNLAQVSLF ALH
Sbjct  186  WWPSNLAQVSLFRALH  201



>ref|XP_006467278.1| PREDICTED: oligopeptide transporter 3-like [Citrus sinensis]
Length=739

 Score =   316 bits (809),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 173/196 (88%), Gaps = 4/196 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNLAQVSLF ALH
Sbjct  186  WWPSNLAQVSLFRALH  201



>gb|KHG20373.1| Oligopeptide transporter 3 -like protein [Gossypium arboreum]
Length=741

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             E TA +    PVEEVALVVPETDDPTLPVLTFRAWFLG+ SC++LIFLNTFF YRTQPL
Sbjct  14   AEGTAENEDTSPVEEVALVVPETDDPTLPVLTFRAWFLGLVSCVLLIFLNTFFTYRTQPL  73

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQISVLPIGKFMA TLP  +++  G W F+LNPGPFNIKEHVIIT+ ANCGVS 
Sbjct  74   TISAILMQISVLPIGKFMARTLPTTQYSLLG-WHFSLNPGPFNIKEHVIITIFANCGVSF  132

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSN  625
            GGGDAYSIGAIT+MKAYYKQ+L+FLCG++IVLTTQ++GYGWAG+LRRYLVDP +MWWPSN
Sbjct  133  GGGDAYSIGAITVMKAYYKQSLNFLCGVLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSN  192

Query  626  LAQVSLFXALH  658
            LAQVSLF ALH
Sbjct  193  LAQVSLFRALH  203



>gb|KFK26550.1| hypothetical protein AALP_AA8G263100 [Arabis alpina]
Length=734

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 171/194 (88%), Gaps = 5/194 (3%)
 Frame = +2

Query  89   EKTAPSGG----RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            EK A + G    RCPVEEVALVVPETDDPTLPV+TFRAW LG+TSC++LIFLNTFF YRT
Sbjct  4    EKAAATNGVDHERCPVEEVALVVPETDDPTLPVMTFRAWSLGLTSCVLLIFLNTFFTYRT  63

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
            QPL+ISAILMQI+VLPIGKFMA TLP   +   GR  F+LNPGPFNIKEHVIIT+ ANCG
Sbjct  64   QPLTISAILMQIAVLPIGKFMARTLPTTSYHLLGR-EFSLNPGPFNIKEHVIITIFANCG  122

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
            VS GGGDAYSIGAIT+MKAYYKQ+LSF+C L IVLTTQ++GYGWAG+LRRYLVDPV+MWW
Sbjct  123  VSFGGGDAYSIGAITVMKAYYKQSLSFICALFIVLTTQILGYGWAGILRRYLVDPVEMWW  182

Query  617  PSNLAQVSLFXALH  658
            PSNLAQVSLF ALH
Sbjct  183  PSNLAQVSLFRALH  196



>ref|XP_010436532.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=726

 Score =   315 bits (807),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP++PV+TFRAWFLG++SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLSSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W F+LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSRNLLG-WKFSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ+LSF+CGL IVLTTQ+IGYGWAG+LRRYLVDPVDMWWPSNLAQVSLF A
Sbjct  139  AITVMKAYYKQSLSFICGLFIVLTTQIIGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  198

Query  653  LH  658
            LH
Sbjct  199  LH  200



>ref|XP_009124517.1| PREDICTED: oligopeptide transporter 3 [Brassica rapa]
 emb|CDY22769.1| BnaA08g05990D [Brassica napus]
Length=735

 Score =   315 bits (806),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG++SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  18   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLSSCVLLIFLNTFFTYRTQPLTISAILMQI  77

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W ++LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  78   AVLPIGKFMARTLPTTSHRLMG-WEWSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  136

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLVDPVDMWWPSNLAQVSLF A
Sbjct  137  AITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  196

Query  653  LH  658
            LH
Sbjct  197  LH  198



>ref|XP_003549274.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=741

 Score =   315 bits (806),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            V+ S ++   A    +P   RCPVEEVALVVPETDDP+LPV+TFRAWFLGI SC++LIFL
Sbjct  4    VKSSSMDAEKAANGESPPE-RCPVEEVALVVPETDDPSLPVMTFRAWFLGIASCVLLIFL  62

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVI  412
            NTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G   FT NPGPFN+KEHVI
Sbjct  63   NTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLGS-RFTFNPGPFNMKEHVI  121

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            IT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYL
Sbjct  122  ITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMMGYGWAGILRRYL  181

Query  593  VDPVDMWWPSNLAQVSLFXALH  658
            VDPV+MWWP+NLAQVSLF ALH
Sbjct  182  VDPVEMWWPANLAQVSLFRALH  203



>ref|XP_008780991.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=735

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  101  PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAI  280
            P   RCPVEEVALVVPETDDP+LPV+TFRAWFLG+ SC ILIFLNTFF YRTQPL ISAI
Sbjct  13   PPEERCPVEEVALVVPETDDPSLPVMTFRAWFLGLASCTILIFLNTFFTYRTQPLIISAI  72

Query  281  LMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDA  460
            LMQI+ LP+G+FMA+ LP ++    G WSF LNPGPFNIKEHVIIT+ ANCGVS GGGDA
Sbjct  73   LMQIAALPMGQFMASVLPNKEVRVLGNWSFNLNPGPFNIKEHVIITIFANCGVSIGGGDA  132

Query  461  YSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVS  640
            YSIGAIT+MKAYYKQ+LSFLC LIIVLTTQ++GYGWAG+LRRYLV+P++MWWPSNLAQVS
Sbjct  133  YSIGAITVMKAYYKQSLSFLCALIIVLTTQILGYGWAGMLRRYLVEPIEMWWPSNLAQVS  192

Query  641  LFXALH  658
            LF ALH
Sbjct  193  LFRALH  198



>ref|XP_010087657.1| Oligopeptide transporter 3 [Morus notabilis]
 gb|EXB29550.1| Oligopeptide transporter 3 [Morus notabilis]
Length=724

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 174/201 (87%), Gaps = 1/201 (0%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            + +G    T       S  RC VEEVALVVPETDDP+LPVLTFRAW LG+ SC++LIFLN
Sbjct  4    KTNGQGTETEKPNVESSEERCSVEEVALVVPETDDPSLPVLTFRAWVLGLGSCVLLIFLN  63

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQISVLPIGKFMAATLP ++++  GR  F+LNPGPFN+KEHVII
Sbjct  64   TFFTYRTQPLTISAILMQISVLPIGKFMAATLPTKEYSLLGR-RFSLNPGPFNMKEHVII  122

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+++FLC L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  123  TIFANCGVSFGGGDAYSIGAITVMKAYYKQSVNFLCALLIVLTTQILGYGWAGMLRRYLV  182

Query  596  DPVDMWWPSNLAQVSLFXALH  658
            DPV+MWWP+NLAQVSLF ALH
Sbjct  183  DPVEMWWPANLAQVSLFRALH  203



>ref|XP_008224626.1| PREDICTED: oligopeptide transporter 3 [Prunus mume]
Length=739

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 175/197 (89%), Gaps = 1/197 (1%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            ++P  A   ++    RC +EEVALVVPETDDP++PV+TFRAWFLG+T+CIILIFLNTFF 
Sbjct  7    MDPEKAANGSSEDHERCAIEEVALVVPETDDPSMPVMTFRAWFLGLTTCIILIFLNTFFT  66

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            +RTQPLSISAILMQI+ LPIGK MA+TLP+R+++  G W F+LNPGPFN+KEHVIIT+ A
Sbjct  67   FRTQPLSISAILMQIASLPIGKLMASTLPKREYSLLG-WRFSLNPGPFNMKEHVIITIFA  125

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCG+S GGGDAYSIGAITIMKAYYKQ+LSFL  LIIVLT+Q++GYGWAG+LRR+LVDPV+
Sbjct  126  NCGISYGGGDAYSIGAITIMKAYYKQSLSFLLALIIVLTSQILGYGWAGILRRFLVDPVE  185

Query  608  MWWPSNLAQVSLFXALH  658
            MWWPSNLAQVSLF ALH
Sbjct  186  MWWPSNLAQVSLFRALH  202



>ref|XP_010270227.1| PREDICTED: oligopeptide transporter 3 [Nelumbo nucifera]
Length=746

 Score =   312 bits (800),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 172/204 (84%), Gaps = 4/204 (2%)
 Frame = +2

Query  56   EMSGLNP---ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILI  226
            E  G N     T      P   RCPVEEV LVVPETDDP+LPV+TFRAWFLGI SC +LI
Sbjct  6    ETKGQNKKFTTTQKLDDEPPEERCPVEEVRLVVPETDDPSLPVMTFRAWFLGIISCTLLI  65

Query  227  FLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEH  406
            FLNTFFIYRTQPL+ISAILMQI+VLPIGKFMA+TLP ++    G  SF LNPGPFN+KEH
Sbjct  66   FLNTFFIYRTQPLTISAILMQIAVLPIGKFMASTLPNKEIKVLGM-SFNLNPGPFNMKEH  124

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            VIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+L+F+CGL+IVLTTQ++GYGWAG+LRR
Sbjct  125  VIITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLNFVCGLLIVLTTQILGYGWAGMLRR  184

Query  587  YLVDPVDMWWPSNLAQVSLFXALH  658
            YLVDP +MWWPSNLAQVSLF ALH
Sbjct  185  YLVDPAEMWWPSNLAQVSLFRALH  208



>emb|CDY42539.1| BnaC08g10640D [Brassica napus]
Length=735

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 166/183 (91%), Gaps = 3/183 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG++SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  18   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLSSCVLLIFLNTFFTYRTQPLTISAILMQI  77

Query  293  SVLPIGKFMAATLPERKFAPFG-RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
            +VLPIGKFMA TLP       G  WS  LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSI
Sbjct  78   AVLPIGKFMARTLPTTSHRLMGCEWS--LNPGPFNIKEHVIITIFANCGVAYGGGDAYSI  135

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFX  649
            GAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAGVLRRYLVDPVDMWWPSNLAQVSLF 
Sbjct  136  GAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFR  195

Query  650  ALH  658
            ALH
Sbjct  196  ALH  198



>gb|ABF70152.1| oligopeptide transporter OPT family protein [Musa acuminata]
Length=748

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVEEVALVVPETDDP+LPV+TFRAWF+G+ SCIILIFLNTFF YRTQPL+ISAIL QI+ 
Sbjct  32   PVEEVALVVPETDDPSLPVMTFRAWFIGLASCIILIFLNTFFTYRTQPLTISAILAQITA  91

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+G+FMA+ LP R+   F  W F LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIGAI
Sbjct  92   LPVGRFMASVLPNREIRVFRNWGFNLNPGPFNIKEHVIITIFANCGVSIGGGDAYSIGAI  151

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T+MKAYYKQ+LSFLCGLIIVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQVSLF ALH
Sbjct  152  TVMKAYYKQSLSFLCGLIIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQVSLFRALH  211



>ref|XP_008464311.1| PREDICTED: oligopeptide transporter 3 [Cucumis melo]
Length=745

 Score =   309 bits (792),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G    PS  RCPVEEVALVVPETDDP+LPV+TFR+W LG+ SC +LIFLNTFF YR+QPL
Sbjct  19   GGGELPSEDRCPVEEVALVVPETDDPSLPVMTFRSWVLGLASCCLLIFLNTFFTYRSQPL  78

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQI+VLPIG+FMA+TLP R F  F RW F+LNPGPFN+KEHVIIT+ ANCG+S 
Sbjct  79   AISAILMQIAVLPIGRFMASTLPNRDFH-FLRWKFSLNPGPFNMKEHVIITIFANCGISY  137

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSN  625
            GGGDAYSIGAIT+MKAYYKQ+L+F   L+IVLTTQ++GYGWAG+LRRYLVDPV+MWWP+N
Sbjct  138  GGGDAYSIGAITVMKAYYKQSLNFFLALLIVLTTQVLGYGWAGMLRRYLVDPVEMWWPAN  197

Query  626  LAQVSLFXALH  658
            LAQVSLF ALH
Sbjct  198  LAQVSLFRALH  208



>gb|KDP35505.1| hypothetical protein JCGZ_08943 [Jatropha curcas]
Length=743

 Score =   309 bits (792),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 168/198 (85%), Gaps = 1/198 (1%)
 Frame = +2

Query  65   GLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFF  244
            G     A    +    RC +EEVALVVPETDDPTLPV+TFRAWFLG+ SC +LIFLNTFF
Sbjct  9    GTESEKAANGDSTEHERCSIEEVALVVPETDDPTLPVMTFRAWFLGLASCSLLIFLNTFF  68

Query  245  IYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVM  424
             YRTQPL+ISAILMQI VLPIGKFMA TLP +++  FG + FTLNPGPFNIKEHVIIT+ 
Sbjct  69   TYRTQPLTISAILMQIGVLPIGKFMARTLPSKEYKIFG-YGFTLNPGPFNIKEHVIITIF  127

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            ANCGVS GGGDAYSIGAIT+MKAYYKQ L+FL  LIIVLT+Q++GYGWAG+LRRYLVDPV
Sbjct  128  ANCGVSYGGGDAYSIGAITVMKAYYKQGLNFLLALIIVLTSQILGYGWAGMLRRYLVDPV  187

Query  605  DMWWPSNLAQVSLFXALH  658
            +MWWPSNLAQVSLF ALH
Sbjct  188  EMWWPSNLAQVSLFRALH  205



>ref|XP_009397220.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=748

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVEEVALVVPETDDP+LPV+TFRAWF+G+ SC ILIFLNTFF YRTQPL+ISAIL QI+ 
Sbjct  32   PVEEVALVVPETDDPSLPVMTFRAWFIGLASCTILIFLNTFFTYRTQPLTISAILAQITA  91

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+G+FMA+ LP R+   F  W F LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIGAI
Sbjct  92   LPVGRFMASVLPNREIRVFRNWGFNLNPGPFNIKEHVIITIFANCGVSIGGGDAYSIGAI  151

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T+MKAYYKQ+LSFLCGLIIVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQVSLF ALH
Sbjct  152  TVMKAYYKQSLSFLCGLIIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQVSLFRALH  211



>gb|ADW09325.1| oligopeptide transporter 3 [Noccaea caerulescens]
Length=736

 Score =   309 bits (791),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG+ SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  19   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLASCVLLIFLNTFFTYRTQPLTISAILMQI  78

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA  LP       G+  F+LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  79   AVLPIGKFMARILPTTSHKLMGK-EFSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  137

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ+L+F+CGL IVLTTQ++GYGWAG+LRRYLVDPVD WWPSNLAQVSLF A
Sbjct  138  AITVMKAYYKQSLTFICGLFIVLTTQILGYGWAGILRRYLVDPVDTWWPSNLAQVSLFRA  197

Query  653  LH  658
            LH
Sbjct  198  LH  199



>ref|XP_010039442.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW45989.1| hypothetical protein EUGRSUZ_L00157 [Eucalyptus grandis]
Length=745

 Score =   308 bits (789),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP+LPV+TFR W LG+ SCIILIFLNTFF +RTQPL+ISAILMQI
Sbjct  27   RCPVEEVALVVPETDDPSLPVMTFRVWTLGLASCIILIFLNTFFTFRTQPLTISAILMQI  86

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIG+FMA TLP R++   G + F+LNPGPFN+KEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  87   AVLPIGRFMAKTLPSREYKVLG-YGFSLNPGPFNMKEHVIITIFANCGVSIGGGDAYSIG  145

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ LSFLCGL+IVLTTQ++GYGWAG+LR+YLVDPV+MWWP+NLAQVSLF A
Sbjct  146  AITVMKAYYKQNLSFLCGLVIVLTTQILGYGWAGLLRKYLVDPVEMWWPANLAQVSLFRA  205

Query  653  LH  658
            LH
Sbjct  206  LH  207



>ref|XP_004139520.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus]
 ref|XP_004162504.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus]
 gb|KGN65011.1| hypothetical protein Csa_1G180750 [Cucumis sativus]
Length=745

 Score =   308 bits (789),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G    PS  RC VEEVALVVPETDDPTLPV+TFR+W LG+ SC +LIFLNTFF YR+QPL
Sbjct  19   GGGELPSEDRCSVEEVALVVPETDDPTLPVMTFRSWVLGLASCCLLIFLNTFFTYRSQPL  78

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQI+VLPIG+FMA+TLP R F  F RW F+LNPGPFN+KEHVIIT+ ANCG+S 
Sbjct  79   AISAILMQIAVLPIGRFMASTLPNRDFH-FLRWKFSLNPGPFNMKEHVIITIFANCGISY  137

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSN  625
            GGGDAYSIGAIT+MKAYYKQ+L+F   L+IVLTTQ++GYGWAG+LRRYLVDPV+MWWP+N
Sbjct  138  GGGDAYSIGAITVMKAYYKQSLNFFLALLIVLTTQVLGYGWAGMLRRYLVDPVEMWWPAN  197

Query  626  LAQVSLFXALH  658
            LAQVSLF ALH
Sbjct  198  LAQVSLFRALH  208



>ref|XP_003559475.2| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3, partial 
[Brachypodium distachyon]
Length=494

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 169/207 (82%), Gaps = 7/207 (3%)
 Frame = +2

Query  59   MSGLNPATAGE-----KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIIL  223
            MS L    A E     K    G R PVEEVALVVPETDDP+ PV+TFRAW LG++SC++L
Sbjct  1    MSSLKSPVAAEEAMRGKQQGEGERYPVEEVALVVPETDDPSTPVMTFRAWTLGLSSCVVL  60

Query  224  IFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNI  397
            IFLNTFF YRTQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFN+
Sbjct  61   IFLNTFFTYRTQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNV  120

Query  398  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  577
            KEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+
Sbjct  121  KEHVIITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGM  180

Query  578  LRRYLVDPVDMWWPSNLAQVSLFXALH  658
            LRRYLVDP +MWWPSNLAQVSLF ALH
Sbjct  181  LRRYLVDPAEMWWPSNLAQVSLFRALH  207



>ref|XP_008345787.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=753

 Score =   308 bits (788),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
            C +EEVALVVPETDDPT+PV+TFRAWFLGITSC ILIFLNTFF YRTQPL+ISAILMQI+
Sbjct  37   CKIEEVALVVPETDDPTMPVMTFRAWFLGITSCTILIFLNTFFTYRTQPLAISAILMQIT  96

Query  296  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
             LPIGKFMA+ LP R+ +  G W F+LNPGPFNIKEHVIIT+ ANCG+S GGGDAYSIGA
Sbjct  97   TLPIGKFMASALPRREHSLLG-WRFSLNPGPFNIKEHVIITIFANCGISYGGGDAYSIGA  155

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXAL  655
            ITIMKAYYKQ+LSF+  L+IVLTTQ+IGYGWAG+LRRYLVDPV+MWWPSN+AQVSLF AL
Sbjct  156  ITIMKAYYKQSLSFILSLVIVLTTQVIGYGWAGILRRYLVDPVEMWWPSNVAQVSLFRAL  215

Query  656  H  658
            H
Sbjct  216  H  216



>ref|XP_007211357.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
 gb|EMJ12556.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
Length=733

 Score =   307 bits (786),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 171/192 (89%), Gaps = 1/192 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +P  A   ++    RC +EEVALVVPETDDP++PV+TFRAWFLG+T+CIILIFLNTFF +
Sbjct  8    DPEKAANGSSEDHERCAIEEVALVVPETDDPSMPVMTFRAWFLGLTTCIILIFLNTFFTF  67

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPLSISAILMQI+ LPIGK MA+TLP+R+++  G W F+LNPGPFN+KEHVIIT+ AN
Sbjct  68   RTQPLSISAILMQIAALPIGKLMASTLPKREYSLLG-WRFSLNPGPFNMKEHVIITIFAN  126

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CG+S GGGDAYSIGAITIMKAYYKQ+LSFL  LIIVLT+Q++GYGWAG+LRR+LVDPV+M
Sbjct  127  CGISYGGGDAYSIGAITIMKAYYKQSLSFLLALIIVLTSQILGYGWAGILRRFLVDPVEM  186

Query  611  WWPSNLAQVSLF  646
            WWPSNLAQVSLF
Sbjct  187  WWPSNLAQVSLF  198



>ref|XP_010686627.1| PREDICTED: oligopeptide transporter 3 [Beta vulgaris subsp. vulgaris]
Length=741

 Score =   307 bits (786),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 165/182 (91%), Gaps = 1/182 (1%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
            CPVEEVALVVPETDDPTLPVLTFRAWFLG+ SC++LIFLNTFFI+RTQPL+ISAILMQI+
Sbjct  23   CPVEEVALVVPETDDPTLPVLTFRAWFLGMVSCVLLIFLNTFFIFRTQPLTISAILMQIA  82

Query  296  VLPIGKFMAATLPERKFAPFG-RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            VLP+GKFMA  +P R +  FG RW F+LNPGPFNIKEHVII+++ANCGVS GGGDAYS G
Sbjct  83   VLPMGKFMARVMPTRTYRLFGGRWEFSLNPGPFNIKEHVIISILANCGVSYGGGDAYSTG  142

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AI +MKAYYKQ++ FLC + IVLTTQ++GYGWAG+LRRYLVDPV+MWWP+NLAQVS F A
Sbjct  143  AIVVMKAYYKQSIGFLCAVFIVLTTQILGYGWAGMLRRYLVDPVEMWWPANLAQVSFFRA  202

Query  653  LH  658
            LH
Sbjct  203  LH  204



>ref|XP_009374520.1| PREDICTED: oligopeptide transporter 3 [Pyrus x bretschneideri]
Length=749

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
            C +EEVALVVPETDDPT+PV+TFRAWFLG+TSC ILIFLNTFF YRTQPL+ISAILMQI+
Sbjct  33   CKIEEVALVVPETDDPTMPVMTFRAWFLGLTSCTILIFLNTFFTYRTQPLAISAILMQIT  92

Query  296  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
             LPIGKFMA+ LP  + +  G W F+LNPGPFNIKEHVIIT+ ANCG+S GGGDAYSIGA
Sbjct  93   TLPIGKFMASALPRHEHSLLG-WGFSLNPGPFNIKEHVIITIFANCGISYGGGDAYSIGA  151

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXAL  655
            ITIMKAYYKQ+LSF+  L++VLTTQ+IGYGWAG+LRRYLVDPV+MWWPSNLAQVSLF AL
Sbjct  152  ITIMKAYYKQSLSFILSLVLVLTTQIIGYGWAGILRRYLVDPVEMWWPSNLAQVSLFRAL  211

Query  656  H  658
            H
Sbjct  212  H  212



>ref|XP_010057794.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW75109.1| hypothetical protein EUGRSUZ_E03859 [Eucalyptus grandis]
Length=744

 Score =   305 bits (781),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +2

Query  98   APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISA  277
            APS  RC VEEVALVVPETDDPT+PV+TFR W LG+TSC+ILIFLNTFF YRTQPL ISA
Sbjct  21   APSDERCSVEEVALVVPETDDPTIPVMTFRTWTLGLTSCVILIFLNTFFTYRTQPLVISA  80

Query  278  ILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGD  457
            ILMQI+VLPIG+FMA  LP  +++  GR  F LNPGPFNIKEHV+IT+ ANCGVS GGGD
Sbjct  81   ILMQIAVLPIGRFMARVLPTTEYSLLGR-RFRLNPGPFNIKEHVVITIFANCGVSTGGGD  139

Query  458  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQV  637
            AYSIGA+T+MK YYKQ LSFLC  +IVLTTQ++GYGWAG+LRRYLVDPV+MWWPSN+AQV
Sbjct  140  AYSIGAVTVMKTYYKQNLSFLCAFLIVLTTQILGYGWAGMLRRYLVDPVEMWWPSNVAQV  199

Query  638  SLFXALH  658
            SLF ALH
Sbjct  200  SLFRALH  206



>ref|XP_010542186.1| PREDICTED: oligopeptide transporter 3 [Tarenaya hassleriana]
Length=727

 Score =   304 bits (778),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = +2

Query  131  VALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIG  310
            VALVVPETDDP+LPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQISVLPIG
Sbjct  21   VALVVPETDDPSLPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQISVLPIG  80

Query  311  KFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMK  490
            KFMA TLP   +  FGR  F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIGAIT+MK
Sbjct  81   KFMARTLPTTPYELFGR-KFSLNPGPFNIKEHVIITIFANCGVSFGGGDAYSIGAITVMK  139

Query  491  AYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            AYYKQ LSFLC + IVLTTQ++GYGWAG+LRRYLVDPVDMWWPSNLAQVSLF ALH
Sbjct  140  AYYKQTLSFLCAIFIVLTTQILGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRALH  195



>gb|AAO32313.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
Length=726

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 161/187 (86%), Gaps = 2/187 (1%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
             G RCPVEEVALVVPETDDPT PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL
Sbjct  25   EGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGIL  84

Query  284  MQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGD  457
             QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS GGGD
Sbjct  85   AQILVLPAGQFMAAVLPSREVRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGGGD  144

Query  458  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQV  637
            AYSIGAIT+MKAYYKQ+LSFLC L+IVLTTQ++GYGWAG+LRRYLVDP DMWWPSNLAQV
Sbjct  145  AYSIGAITVMKAYYKQSLSFLCALLIVLTTQILGYGWAGMLRRYLVDPADMWWPSNLAQV  204

Query  638  SLFXALH  658
            SLF ALH
Sbjct  205  SLFRALH  211



>ref|NP_001051290.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|AAR87263.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
 gb|ABF98905.1| oligopeptide transporter 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13204.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|EEC76189.1| hypothetical protein OsI_13528 [Oryza sativa Indica Group]
 gb|EEE59939.1| hypothetical protein OsJ_12589 [Oryza sativa Japonica Group]
Length=757

 Score =   303 bits (775),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 161/187 (86%), Gaps = 2/187 (1%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
             G RCPVEEVALVVPETDDPT PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL
Sbjct  25   EGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGIL  84

Query  284  MQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGD  457
             QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS GGGD
Sbjct  85   AQILVLPAGQFMAAVLPSREVRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGGGD  144

Query  458  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQV  637
            AYSIGAIT+MKAYYKQ+LSFLC L+IVLTTQ++GYGWAG+LRRYLVDP DMWWPSNLAQV
Sbjct  145  AYSIGAITVMKAYYKQSLSFLCALLIVLTTQILGYGWAGMLRRYLVDPADMWWPSNLAQV  204

Query  638  SLFXALH  658
            SLF ALH
Sbjct  205  SLFRALH  211



>ref|XP_009404107.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =   302 bits (774),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEV LVVPETDDP+LPV+TFRAWFLG+TSC +LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVKLVVPETDDPSLPVMTFRAWFLGLTSCSLLIFLNTFFTYRTQPLTISAILMQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIG+ MA+ LP+R+      W F LNPGPFNIKEHVIIT+ A+CGVS GGGDAYSIG
Sbjct  80   AVLPIGRLMASVLPDREVNLLPGWGFNLNPGPFNIKEHVIITIFASCGVSYGGGDAYSIG  139

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MKAYYKQ LSFLC L+IVL+TQ++GYGWAG++RRYLV+P +MWWPSNLAQVSLF A
Sbjct  140  AITVMKAYYKQNLSFLCALLIVLSTQILGYGWAGMMRRYLVEPPEMWWPSNLAQVSLFRA  199

Query  653  LH  658
            LH
Sbjct  200  LH  201



>ref|XP_004295330.1| PREDICTED: oligopeptide transporter 3 [Fragaria vesca subsp. 
vesca]
Length=736

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
            C +EEVALVVPETDDP+LPV+TFR WFLGITSC ILIFLNTFF YRTQPL ISAILMQI+
Sbjct  20   CEIEEVALVVPETDDPSLPVMTFRTWFLGITSCTILIFLNTFFSYRTQPLIISAILMQIA  79

Query  296  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            VLPIGKFMA TLP + F   G + F LNP PFN+KEHV+IT+ ANCGVS GGGDAYS GA
Sbjct  80   VLPIGKFMAKTLPNKDFNLMG-FKFNLNPAPFNMKEHVVITIFANCGVSAGGGDAYSTGA  138

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXAL  655
            IT+MKAYY Q+LSFLCGL IVLT+Q+IGYGWAG+LRRYLVDPV+MWWP+NLAQVSLF AL
Sbjct  139  ITVMKAYYHQSLSFLCGLFIVLTSQMIGYGWAGLLRRYLVDPVEMWWPANLAQVSLFRAL  198

Query  656  H  658
            H
Sbjct  199  H  199



>dbj|BAK07444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=745

 Score =   300 bits (769),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 2/197 (1%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            PA  G+     G R PVEEVALVVPETDDP  PV+TFRAW LG+TSC++LIFLNTFF YR
Sbjct  8    PAAGGKGAQGEGERYPVEEVALVVPETDDPATPVMTFRAWTLGLTSCVVLIFLNTFFTYR  67

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMA  427
            TQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFNIKEHVIIT+ A
Sbjct  68   TQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNIKEHVIITIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+LRR+LVDP +
Sbjct  128  NCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGMLRRFLVDPAE  187

Query  608  MWWPSNLAQVSLFXALH  658
            MWWPSNLAQVSLF ALH
Sbjct  188  MWWPSNLAQVSLFRALH  204



>ref|XP_006651827.1| PREDICTED: oligopeptide transporter 3-like [Oryza brachyantha]
Length=742

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = +2

Query  98   APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISA  277
            A  G RCPVEEVALVVPETDDPT PV+TFRAW LG+TSC++LIFLNTFF YRTQPL+IS 
Sbjct  7    ALQGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLTSCVVLIFLNTFFTYRTQPLTISG  66

Query  278  ILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            IL QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS GG
Sbjct  67   ILAQILVLPAGQFMAAVLPNREGRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGG  126

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            GDAYSIGAIT+MKAYYKQ+L F+C L+IVLTTQ++GYGWAG+LRRYLVDP DMWWPSNLA
Sbjct  127  GDAYSIGAITVMKAYYKQSLGFVCALLIVLTTQILGYGWAGMLRRYLVDPADMWWPSNLA  186

Query  632  QVSLFXALH  658
            QVSLF ALH
Sbjct  187  QVSLFRALH  195



>ref|XP_008349335.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=756

 Score =   299 bits (766),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC +EEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNTFF +RTQPL+ISAILMQI
Sbjct  39   RCKIEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNTFFSFRTQPLAISAILMQI  98

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LPIGKFMA+ LP R+ +  G W F+ N GPFNIKEHVIIT+ ANCG+S GGGDAYSIG
Sbjct  99   ITLPIGKFMASALPRREHSLRG-WRFSXNXGPFNIKEHVIITIFANCGISYGGGDAYSIG  157

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AITIMKAYYKQ+LSF+  L+IVLTTQ+IGYGWAG+LRRYLVDPV+MWWPSN+AQVSLF A
Sbjct  158  AITIMKAYYKQSLSFILSLVIVLTTQIIGYGWAGILRRYLVDPVEMWWPSNVAQVSLFRA  217

Query  653  LH  658
            LH
Sbjct  218  LH  219



>ref|XP_009374859.1| PREDICTED: oligopeptide transporter 3-like [Pyrus x bretschneideri]
Length=753

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 167/195 (86%), Gaps = 7/195 (4%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P + G K      RC +EEVALVVPETDDPT+PV+TFRA FLG+TSC +LIFLNTFF +R
Sbjct  29   PESDGHK------RCKIEEVALVVPETDDPTMPVMTFRALFLGLTSCTLLIFLNTFFSFR  82

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  433
            TQPL+ISAILMQI  LPIGKFMA+ LP R+ +  G W F+LNPGPFNIKEHVI+T+ ANC
Sbjct  83   TQPLAISAILMQIITLPIGKFMASALPSRQHSLRG-WRFSLNPGPFNIKEHVIVTIFANC  141

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
            G+S GGGDAYSIGAITIMKAYYKQ+LSF+  L+IVLTTQ+IGYGWAG+ RRYLVDPV+MW
Sbjct  142  GISYGGGDAYSIGAITIMKAYYKQSLSFILSLVIVLTTQIIGYGWAGIFRRYLVDPVEMW  201

Query  614  WPSNLAQVSLFXALH  658
            WPSN+AQVSLF ALH
Sbjct  202  WPSNVAQVSLFRALH  216



>ref|XP_002463867.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
 gb|EER90865.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
Length=747

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 165/204 (81%), Gaps = 5/204 (2%)
 Frame = +2

Query  62   SGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            S  +P  A E+       G RC VEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFL
Sbjct  4    SRKSPVVAEERAGMEEGKGERCAVEEVALVVPETDDPSLPVMTFRAWTLGLGSCVVLIFL  63

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEH  406
            NTFF YRTQPL+IS IL QI VLP G+FMAA LP R+    G    SF LNPGPFN+KEH
Sbjct  64   NTFFTYRTQPLTISGILAQILVLPAGRFMAAVLPNREVRLLGGRLGSFNLNPGPFNVKEH  123

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            VIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRR
Sbjct  124  VIITIFANCGVSYGGGDAYSIGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGMLRR  183

Query  587  YLVDPVDMWWPSNLAQVSLFXALH  658
            YLVDP +MWWPSNLAQVSLF ALH
Sbjct  184  YLVDPAEMWWPSNLAQVSLFRALH  207



>gb|ACL82964.1| glutathione transporter [Zea mays]
Length=746

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 165/201 (82%), Gaps = 5/201 (2%)
 Frame = +2

Query  71   NPATAGEKTAP---SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            +P  A E+       G RC VEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFLNTF
Sbjct  6    SPVAAEERAGTGEGKGERCAVEEVALVVPETDDPSLPVMTFRAWALGLGSCVVLIFLNTF  65

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVII  415
            F YRTQPL+IS IL QI VLP G+F+AA LP+R+    G    SF LNPGPFN+KEHVII
Sbjct  66   FTYRTQPLTISGILAQILVLPAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVII  125

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  126  TIFANCGVSYGGGDAYSIGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLV  185

Query  596  DPVDMWWPSNLAQVSLFXALH  658
            DP +MWWPSNLAQVSLF ALH
Sbjct  186  DPAEMWWPSNLAQVSLFRALH  206



>gb|EMT33592.1| Oligopeptide transporter 3 [Aegilops tauschii]
Length=750

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 167/203 (82%), Gaps = 5/203 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            + +G   A  GE     G R PVEEVALVVPETDDP  PV+TFRAW LG+ SC++LIFLN
Sbjct  10   DATGGKAAAQGEG---EGERYPVEEVALVVPETDDPATPVMTFRAWTLGLASCVVLIFLN  66

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHV  409
            TFF YRTQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFNIKEHV
Sbjct  67   TFFTYRTQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNIKEHV  126

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+LRR+
Sbjct  127  IITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGMLRRF  186

Query  590  LVDPVDMWWPSNLAQVSLFXALH  658
            LVDP +MWWPSNLAQVSLF ALH
Sbjct  187  LVDPAEMWWPSNLAQVSLFRALH  209



>gb|KCW45990.1| hypothetical protein EUGRSUZ_L00158 [Eucalyptus grandis]
Length=745

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 162/182 (89%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            +C VEEVALVVPETDDP LPV+TFR W LG+TSC++LIFLNTFF++RTQPL+IS+ILMQI
Sbjct  28   KCAVEEVALVVPETDDPLLPVMTFRVWVLGLTSCVVLIFLNTFFMFRTQPLTISSILMQI  87

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            ++LPIGKFMA TLP +++  FG +SFTLNPGPFN+KEHV+IT+ ANCGV+ GG DAYSIG
Sbjct  88   TMLPIGKFMARTLPAKRYQVFG-YSFTLNPGPFNVKEHVLITIFANCGVATGGVDAYSIG  146

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             IT+MK YYKQ LSFLC LIIVLTTQL GYGWAG+ R+YLVDP +MWWP+NLAQVSLF A
Sbjct  147  PITVMKTYYKQNLSFLCALIIVLTTQLAGYGWAGMFRKYLVDPAEMWWPANLAQVSLFRA  206

Query  653  LH  658
            LH
Sbjct  207  LH  208



>ref|XP_004981750.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3-like 
[Setaria italica]
Length=750

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 160/184 (87%), Gaps = 2/184 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI
Sbjct  28   RCPVEEVALVVPETDDPSLPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGILAQI  87

Query  293  SVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
             VLP G+FMAA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYS
Sbjct  88   LVLPAGRFMAAVLPDREVRLLGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYS  147

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            IGAIT+MKAYYKQ LSF+  L+IVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQVSLF
Sbjct  148  IGAITVMKAYYKQTLSFVLALLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQVSLF  207

Query  647  XALH  658
             ALH
Sbjct  208  RALH  211



>ref|XP_006856263.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
 gb|ERN17730.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
Length=738

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            + P+EEVALVVP TDDP LPV+TFRAWFLGIT C+ L+F+NTFF YRTQPL+ISAIL QI
Sbjct  21   QSPIEEVALVVPVTDDPNLPVMTFRAWFLGITFCVFLMFVNTFFTYRTQPLTISAILAQI  80

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            + LP+G+FMAATLP+++    G +SF+LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  81   AALPMGRFMAATLPKKEMRVLG-YSFSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  139

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
            AIT+MK YYKQ+LSFLCGL IVLTTQ++GYGWAG++RRYLV+P +MWWPSNLAQVSLF A
Sbjct  140  AITVMKVYYKQSLSFLCGLFIVLTTQVLGYGWAGMMRRYLVEPANMWWPSNLAQVSLFRA  199

Query  653  LH  658
            LH
Sbjct  200  LH  201



>ref|XP_008665425.1| PREDICTED: oligopeptide transporter 3 [Zea mays]
 tpg|DAA51401.1| TPA: glutathione transporter [Zea mays]
Length=748

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 159/184 (86%), Gaps = 2/184 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC VEEVALVVPETDDP++PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI
Sbjct  25   RCAVEEVALVVPETDDPSMPVMTFRAWALGLGSCVVLIFLNTFFTYRTQPLTISGILAQI  84

Query  293  SVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
             VLP G+F+AA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYS
Sbjct  85   LVLPAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYS  144

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            IGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQVSLF
Sbjct  145  IGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLVDPAEMWWPSNLAQVSLF  204

Query  647  XALH  658
             ALH
Sbjct  205  RALH  208



>ref|XP_010039444.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010039445.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW45991.1| hypothetical protein EUGRSUZ_L00159 [Eucalyptus grandis]
Length=765

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 167/207 (81%), Gaps = 5/207 (2%)
 Frame = +2

Query  38   SEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCI  217
             E   VE   L    AGE       RC VEEVALVV ETDD +LPV+TFR W LG+TSC+
Sbjct  26   EERCAVEEVAL---IAGEDQEQEE-RCAVEEVALVVLETDDRSLPVMTFRVWVLGLTSCV  81

Query  218  ILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNI  397
            +LIFLNTFF+YRTQPL+IS+ILMQI+VLPIGKFMA  LP +++  FG +SFTLNPGPFNI
Sbjct  82   VLIFLNTFFMYRTQPLTISSILMQITVLPIGKFMARALPAKRYRFFG-YSFTLNPGPFNI  140

Query  398  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  577
            KEHV+IT+ ANCGV+ GG DAYSIG IT+MK YYKQ LSFLC LIIVLTTQL GYGWAG+
Sbjct  141  KEHVLITIFANCGVATGGVDAYSIGPITVMKTYYKQNLSFLCALIIVLTTQLAGYGWAGM  200

Query  578  LRRYLVDPVDMWWPSNLAQVSLFXALH  658
             R+YLVDP +MWWP+NLAQVSLF ALH
Sbjct  201  FRKYLVDPAEMWWPANLAQVSLFRALH  227



>gb|EMS48793.1| Oligopeptide transporter 3 [Triticum urartu]
Length=561

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 157/183 (86%), Gaps = 2/183 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            R PVEEVAL VPETDDP  PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI
Sbjct  27   RYPVEEVALGVPETDDPATPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGILAQI  86

Query  293  SVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
             VLP+G+FMA+ LP+RK    G    SF LNPGPFNIKEHVIIT+ ANCGVS GGGDAYS
Sbjct  87   LVLPVGRFMASVLPDRKVRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGGGDAYS  146

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            IGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+LRR+LVDP +MWWPSNLAQVSLF
Sbjct  147  IGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGMLRRFLVDPAEMWWPSNLAQVSLF  206

Query  647  XAL  655
              L
Sbjct  207  SPL  209



>gb|ABB55328.1| small oligopeptide transporter, OPT family [Asparagus officinalis]
Length=755

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 167/239 (70%), Gaps = 49/239 (21%)
 Frame = +2

Query  89   EKTAP-SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            +K  P    RCP+EEVALVVPETDDP LPVLTFRAWFLG+TSC +LIFLNTFF YRTQPL
Sbjct  10   QKPVPVESDRCPIEEVALVVPETDDPNLPVLTFRAWFLGLTSCSVLIFLNTFFTYRTQPL  69

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAIL QI+VLPIG+FMA+ LP+++    G W F LNPGPF+IKEHVIIT+ ANCGVS 
Sbjct  70   TISAILTQIAVLPIGRFMASALPDKEVRVLGGWGFNLNPGPFSIKEHVIITIFANCGVST  129

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQ-------------------------  550
            GGGDAYSIGAIT+MKAYYKQ L FLC LIIVLTTQ                         
Sbjct  130  GGGDAYSIGAITVMKAYYKQGLGFLCALIIVLTTQAVLSHYLLMGFKSSSSSSSSSHRKV  189

Query  551  -----------------------LIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
                                   +IGYGWAGVLRR+LVDPV+MWWP+NLAQVSLF ALH
Sbjct  190  TVGFIAELTVTSTFAAVRAPDFNVIGYGWAGVLRRFLVDPVEMWWPANLAQVSLFRALH  248



>gb|AAQ91200.1| putative glutathione transporter [Zea mays]
Length=721

 Score =   286 bits (731),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 157/181 (87%), Gaps = 2/181 (1%)
 Frame = +2

Query  122  VEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVL  301
            VEEVALVVPETDDP++PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI VL
Sbjct  1    VEEVALVVPETDDPSMPVMTFRAWALGLGSCVVLIFLNTFFTYRTQPLTISGILAQILVL  60

Query  302  PIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            P G+F+AA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYSIGA
Sbjct  61   PAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYSIGA  120

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXAL  655
            IT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQVSLF AL
Sbjct  121  ITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLVDPAEMWWPSNLAQVSLFRAL  180

Query  656  H  658
            H
Sbjct  181  H  181



>gb|ADW66457.1| oligopeptide transporter [Phytolacca americana]
Length=733

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVEEV L VP TDDP+LPVLTFR WFLG+ SCI+L FLN FF YRTQPL+ISAI  QI+V
Sbjct  19   PVEEVRLTVPITDDPSLPVLTFRMWFLGLCSCILLSFLNDFFWYRTQPLTISAI-SQIAV  77

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+G FMA  LP   F P   WS++LNPGPFN+KEHVI+T+ ANCGVS GGGDAYSIGAI
Sbjct  78   LPLGGFMARILPTTPF-PGRGWSYSLNPGPFNLKEHVIVTIFANCGVSQGGGDAYSIGAI  136

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T+MKAYYKQ+L FLC + IVLTTQ +GYGWAG+LRRYLVDPV+MWWP+NLAQVS F ALH
Sbjct  137  TVMKAYYKQSLGFLCAIFIVLTTQALGYGWAGMLRRYLVDPVEMWWPANLAQVSFFRALH  196



>gb|KHN42268.1| Oligopeptide transporter 3 [Glycine soja]
Length=698

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +2

Query  176  LTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPF  355
            +TFRAWFLGI SC++LIFLNTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   
Sbjct  1    MTFRAWFLGIASCVLLIFLNTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFL  60

Query  356  GRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLII  535
            G W FT NPGPFN+KEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L I
Sbjct  61   G-WRFTFNPGPFNMKEHVIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFI  119

Query  536  VLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            VLTTQ++GYGWAG+LRRYLVDPV+MWWP+NLAQVSLF ALH
Sbjct  120  VLTTQMLGYGWAGILRRYLVDPVEMWWPANLAQVSLFRALH  160



>ref|XP_010039443.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
Length=697

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  176  LTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPF  355
            +TFR W LG+TSC++LIFLNTFF++RTQPL+IS+ILMQI++LPIGKFMA TLP +++  F
Sbjct  1    MTFRVWVLGLTSCVVLIFLNTFFMFRTQPLTISSILMQITMLPIGKFMARTLPAKRYQVF  60

Query  356  GRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLII  535
            G +SFTLNPGPFN+KEHV+IT+ ANCGV+ GG DAYSIG IT+MK YYKQ LSFLC LII
Sbjct  61   G-YSFTLNPGPFNVKEHVLITIFANCGVATGGVDAYSIGPITVMKTYYKQNLSFLCALII  119

Query  536  VLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            VLTTQL GYGWAG+ R+YLVDP +MWWP+NLAQVSLF ALH
Sbjct  120  VLTTQLAGYGWAGMFRKYLVDPAEMWWPANLAQVSLFRALH  160



>ref|XP_002522882.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF39482.1| Oligopeptide transporter, putative [Ricinus communis]
Length=734

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = +2

Query  35   LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  214
            ++    ++ +G  P       A    RC VEEVALVVPETDDPTLPV+TFRAWFLG+TSC
Sbjct  1    MASKTQIQDNGFKPNGEHSSAAEEHERCSVEEVALVVPETDDPTLPVMTFRAWFLGLTSC  60

Query  215  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFN  394
            ++LIFLNTFF YRTQPL+ISAILMQI VLPIGKFMA  LP +++  FG W F+LNPGPFN
Sbjct  61   VLLIFLNTFFTYRTQPLTISAILMQIGVLPIGKFMAKALPTKQYKIFG-WGFSLNPGPFN  119

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQ  550
            IKEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLC L+IVLTTQ
Sbjct  120  IKEHVIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLNFLCALLIVLTTQ  171



>emb|CAB10414.1| isp4 like protein [Arabidopsis thaliana]
 emb|CAB78679.1| isp4 like protein [Arabidopsis thaliana]
Length=691

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 148/201 (74%), Gaps = 27/201 (13%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFRA               
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRACH-------------  47

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
                  +QP      LMQI+ LPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  48   ----SPSQP-----SLMQIAGLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  97

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  98   TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  157

Query  596  DPVDMWWPSNLAQVSLFXALH  658
            DPVDMWWPSNLAQVSLF ALH
Sbjct  158  DPVDMWWPSNLAQVSLFRALH  178



>ref|XP_008361590.1| PREDICTED: oligopeptide transporter 2-like, partial [Malus domestica]
Length=564

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 145/197 (74%), Gaps = 5/197 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  7    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  62

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  63   YRTEPLXISXISVQVATLPIGRFMARXLPKRKFQ-IGXKEFSLNPGPFNMKEHVLISIFA  121

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+VDP +
Sbjct  122  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVVDPAE  181

Query  608  MWWPSNLAQVSLFXALH  658
            MWWPS+L QVSLF ALH
Sbjct  182  MWWPSSLVQVSLFRALH  198



>gb|AEJ88342.1| putative oligopeptide transporter [Tamarix hispida]
Length=516

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
            S    PV++VAL VP TDDPTLPVLT R W LG  SCI+L FLN FF YR +PL+I+AI 
Sbjct  51   SEENSPVKQVALTVPTTDDPTLPVLTCRMWILGALSCILLSFLNQFFWYREEPLTITAIS  110

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
             QI+V+PIG++MA+ LP R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y
Sbjct  111  AQIAVVPIGRYMASRLPTRIFFKGTRWEFTLNPGPFNVKEHVLITIFANA----GAGTVY  166

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSL  643
            +I  +T++K +YK+ ++F   LI+VLTTQ++G+GWAG+ RRYLV+P +MWWP+NL QVSL
Sbjct  167  AIHVVTVVKVFYKKQITFFVSLIVVLTTQVLGFGWAGIFRRYLVEPPEMWWPANLVQVSL  226

Query  644  FXALH  658
            F ALH
Sbjct  227  FRALH  231



>ref|XP_008374100.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Malus 
domestica]
Length=307

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  46   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQI  105

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +  R F    RW F LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  106  AVVPLGQLMASKITNRVFFKGSRWEFNLNPGPFNVKEHVLITIFANS----GAGTVYAIH  161

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF  
Sbjct  162  IVTVVKVFYKRHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRX  221

Query  653  LH  658
            +H
Sbjct  222  VH  223



>ref|XP_010090590.1| Oligopeptide transporter 7 [Morus notabilis]
 gb|EXB39949.1| Oligopeptide transporter 7 [Morus notabilis]
Length=707

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 143/194 (74%), Gaps = 8/194 (4%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            A A EK   S    PVE+VAL VP TDDP+LPVLTFR WFLGI SC++L FLN FF YR 
Sbjct  39   AEAAEKEENS----PVEQVALTVPITDDPSLPVLTFRMWFLGILSCVLLSFLNQFFWYRK  94

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
            +PLSI+AI  QI+V+P+G+ MAA +P   F    RW F+LNPGPFN+KEHV+IT+ AN  
Sbjct  95   EPLSITAISAQIAVVPLGQLMAAKIPNHVFFRGTRWEFSLNPGPFNVKEHVLITIFANS-  153

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
               G G  Y+I  +T++K +YKQ ++F   LI+VLTTQ++G+GWAG+ RRYLV+P  MWW
Sbjct  154  ---GAGTVYAIHVVTVVKIFYKQHMTFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAAMWW  210

Query  617  PSNLAQVSLFXALH  658
            P NL QVSLF ALH
Sbjct  211  PENLVQVSLFRALH  224



>gb|KJB32170.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=754

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 147/199 (74%), Gaps = 3/199 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGR-CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            N A  GE  A       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF 
Sbjct  19   NHAIKGENAAADDDELSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFA  78

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITV  421
            YRT+PL I+ I +Q++ LPIG+FMAA LP R+F     G   F+LNPGPFN+KEHV+I++
Sbjct  79   YRTEPLIITQITVQVATLPIGQFMAAVLPRRQFKLPGVGSRKFSLNPGPFNMKEHVLISI  138

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             AN G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+V+P
Sbjct  139  FANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLAGWLLIITTQVLGYGWAGLLRKYVVEP  198

Query  602  VDMWWPSNLAQVSLFXALH  658
              MWWPS L QVSLF ALH
Sbjct  199  AHMWWPSTLVQVSLFRALH  217



>gb|EYU33488.1| hypothetical protein MIMGU_mgv1a0023121mg, partial [Erythranthe 
guttata]
Length=548

 Score =   234 bits (597),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
            +G   P+E+VAL V   DDP+LPVLTFR WFLG  SC++L FLN FF YRT+PLSI+AI 
Sbjct  35   NGENSPIEQVALTVSTADDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLSITAIS  94

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
             QI+V+P+G+ MAA + +R F    R+ FTLNPGPFN+KEHV+IT+ AN     G G  Y
Sbjct  95   AQIAVVPLGQLMAARITDRSFFRGSRFEFTLNPGPFNVKEHVLITIFANS----GAGTVY  150

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSL  643
            +I  +T +K +YKQ +SF   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSL
Sbjct  151  AIHVVTAVKIFYKQHISFFVSLIVVITTQVLGFGWAGIYRRYLVEPAAMWWPANLVQVSL  210

Query  644  FXALH  658
            F ALH
Sbjct  211  FRALH  215



>gb|KJB32172.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=493

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 2/198 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  139  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  198

Query  605  DMWWPSNLAQVSLFXALH  658
             MWWPS L QVSLF ALH
Sbjct  199  HMWWPSTLVQVSLFRALH  216



>ref|XP_011078507.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=754

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 148/198 (75%), Gaps = 7/198 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             PA   E+        PVE+V L VP  DDPTLPV TFR WFLG+ SC++L FLNTFF Y
Sbjct  28   EPAVDDEEEV-----SPVEQVRLTVPNEDDPTLPVWTFRMWFLGLFSCMLLSFLNTFFSY  82

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            R++PL I+ I +Q++ LPIG+FMA  LP  KF    FG   F+LNPGPFN+KEHV+I++ 
Sbjct  83   RSEPLIITMISVQVATLPIGRFMANVLPTTKFRLPGFGSREFSLNPGPFNMKEHVLISIF  142

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + GGG AY++G + I+KA+YK+ +SFL   I+V+TTQ++GYGWAG+LR+Y+V+P 
Sbjct  143  ANAGSAFGGGSAYAVGIVDIIKAFYKRNISFLASWILVITTQVLGYGWAGILRKYVVEPA  202

Query  605  DMWWPSNLAQVSLFXALH  658
            +MWWPS+L QVSLF ALH
Sbjct  203  EMWWPSSLVQVSLFRALH  220



>ref|XP_004136415.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 ref|XP_004164895.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 gb|KGN60282.1| hypothetical protein Csa_3G893320 [Cucumis sativus]
Length=742

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 147/198 (74%), Gaps = 2/198 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  T  +K  P     P+E+V L V   DDP++PV TFR WFLG+ SCIIL FLNTFF Y
Sbjct  11   DSTTTTQKPIPDDEISPIEQVRLTVSNEDDPSIPVWTFRMWFLGLLSCIILSFLNTFFGY  70

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL IS I +Q++ LPIG+FMA  LP + F    FG  +F+LNPGPFNIKEHV+I++ 
Sbjct  71   RTEPLVISMISVQVATLPIGRFMANVLPTKTFRIPGFGDRNFSLNPGPFNIKEHVLISIF  130

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+ A+Y + +SFL G I+V+TTQ++GYGWAG+LR+Y+VDP 
Sbjct  131  ANAGSAFGNGAAYAIGIVDIVMAFYHRKISFLTGWILVITTQVMGYGWAGILRKYVVDPA  190

Query  605  DMWWPSNLAQVSLFXALH  658
            +MWWPS+L QVSLF A+H
Sbjct  191  EMWWPSSLVQVSLFRAMH  208



>ref|XP_011070370.1| PREDICTED: oligopeptide transporter 7 [Sesamum indicum]
Length=753

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 140/184 (76%), Gaps = 4/184 (2%)
 Frame = +2

Query  107  GGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILM  286
            G   P+++VAL VP TDDPTLPVLTFR WFLG  SC++L FLN FF YRT+PLSI+AI  
Sbjct  39   GENSPIKQVALTVPTTDDPTLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLSITAISA  98

Query  287  QISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
            QI+V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+
Sbjct  99   QIAVVPLGQLMAAKITDRVFFRGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYA  154

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            I  +T +K +YKQ +SF   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF
Sbjct  155  IHVVTAVKVFYKQHISFFVSLIVVITTQVLGFGWAGIYRRYLVEPAAMWWPANLVQVSLF  214

Query  647  XALH  658
             ALH
Sbjct  215  RALH  218



>ref|XP_008338986.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=733

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 145/197 (74%), Gaps = 5/197 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  7    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  62

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  63   YRTEPLXISXISVQVATLPIGRFMARXLPKRKFQ-IGXKEFSLNPGPFNMKEHVLISIFA  121

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+VDP +
Sbjct  122  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVVDPAE  181

Query  608  MWWPSNLAQVSLFXALH  658
            MWWPS+L QVSLF ALH
Sbjct  182  MWWPSSLVQVSLFRALH  198



>ref|XP_002981747.1| hypothetical protein SELMODRAFT_179057 [Selaginella moellendorffii]
 gb|EFJ17229.1| hypothetical protein SELMODRAFT_179057 [Selaginella moellendorffii]
Length=771

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 5/182 (3%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            + P+EEVAL V  +DDP+LPV TFR W LG+ SC++L F N FF YRT+PL I+AI  QI
Sbjct  55   QSPIEEVALTVDTSDDPSLPVYTFRMWTLGVVSCVLLAFFNQFFAYRTEPLIITAISAQI  114

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MAATLP RKF+ FGR  F+LNPG FN KEHV+IT+ AN     G G AY++G
Sbjct  115  VTLPLGKLMAATLPTRKFSIFGR-EFSLNPGAFNKKEHVLITIFANT----GAGSAYAVG  169

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+YK+ + F  GL+I +TTQ+IGYGWAG+ R+YLVDP +MWWPSNL QVS+F  
Sbjct  170  IVTIVKAFYKRRMDFGVGLLITITTQIIGYGWAGIFRKYLVDPAEMWWPSNLVQVSIFRT  229

Query  653  LH  658
            LH
Sbjct  230  LH  231



>ref|XP_002967597.1| hypothetical protein SELMODRAFT_88962 [Selaginella moellendorffii]
 gb|EFJ30944.1| hypothetical protein SELMODRAFT_88962 [Selaginella moellendorffii]
Length=771

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 5/182 (3%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            + P+EEVAL V  +DDP+LPV TFR W LG+ SC++L F N FF YRT+PL I+AI  QI
Sbjct  55   QSPIEEVALTVDTSDDPSLPVYTFRMWTLGVVSCVLLAFFNQFFAYRTEPLIITAISAQI  114

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MAATLP RKF+ FGR  F+LNPG FN KEHV+IT+ AN     G G AY++G
Sbjct  115  VTLPLGKLMAATLPTRKFSIFGR-EFSLNPGAFNKKEHVLITIFANT----GAGSAYAVG  169

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+YK+ + F  GL+I +TTQ+IGYGWAG+ R+YLVDP +MWWPSNL QVS+F  
Sbjct  170  IVTIVKAFYKRRMEFGVGLLITITTQIIGYGWAGIFRKYLVDPAEMWWPSNLVQVSIFRT  229

Query  653  LH  658
            LH
Sbjct  230  LH  231



>ref|XP_010553673.1| PREDICTED: oligopeptide transporter 2 [Tarenaya hassleriana]
Length=734

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 142/190 (75%), Gaps = 1/190 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            ++        PVEEV L VP  DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL 
Sbjct  12   DEEEGDNDESPVEEVRLTVPNHDDPSLPVWTFRMWFLGLFSCVLLSFLNTFFGYRTQPLM  71

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            IS I +Q+  LPIGK MA  LP++KF   G + F+LNPGPFN+KEHV+I++ AN G   G
Sbjct  72   ISMISIQVVTLPIGKMMARVLPDKKFR-VGSFEFSLNPGPFNVKEHVLISMFANAGAGYG  130

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G AY++G + I+KA+YK+ +SFL   ++V+TTQ++GYGWAG++RR LV+P  MWWPS+L
Sbjct  131  SGTAYAVGIVDIIKAFYKRNISFLASWLLVITTQVLGYGWAGIMRRLLVEPAQMWWPSSL  190

Query  629  AQVSLFXALH  658
             QVSLF ALH
Sbjct  191  LQVSLFRALH  200



>ref|XP_009366376.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=734

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 145/197 (74%), Gaps = 5/197 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  8    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  63

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  64   YRTEPLIISMISVQVATLPIGRFMARALPKRKFQ-IGSKEFSLNPGPFNMKEHVLISIFA  122

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+VDP +
Sbjct  123  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVVDPAE  182

Query  608  MWWPSNLAQVSLFXALH  658
            MWWPS+L QVSLF ALH
Sbjct  183  MWWPSSLVQVSLFRALH  199



>dbj|BAJ97716.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   231 bits (590),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +P    +    S    P+E+VAL VP  DDP  PVLTFR W LG+ SC +L FLN FF Y
Sbjct  45   SPEHQNDDGNLSSENSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFLNQFFWY  104

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PL+I+AI  QI+V+P+G+ MAA LPER F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  105  RKEPLTITAISAQIAVVPLGRLMAAALPERVFLRGSRWEFTLNPGPFNVKEHVLITIFAN  164

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  +T ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRYLV+P  M
Sbjct  165  A----GAGTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLVEPATM  220

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNL QVSLF ALH
Sbjct  221  WWPSNLVQVSLFRALH  236



>ref|XP_008466130.1| PREDICTED: oligopeptide transporter 2 [Cucumis melo]
Length=741

 Score =   235 bits (600),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 149/204 (73%), Gaps = 2/204 (1%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            +E+     +T  +K  P     P+E+V L V   DDP++PV TFR WFLG+ SC+IL FL
Sbjct  4    LEIELEQDSTTTQKPIPDDEISPIEQVRLTVSNEDDPSIPVWTFRMWFLGLLSCMILSFL  63

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            NTFF YRT+PL IS I +Q++ LPIG+FMA  LP   F    FG  +F+LNPGPFNIKEH
Sbjct  64   NTFFGYRTEPLVISMISVQVATLPIGRFMANVLPTTTFRIPGFGDRNFSLNPGPFNIKEH  123

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY+IG + I+ A+Y + +SFL G I+V+TTQ++GYGWAG+LR+
Sbjct  124  VLISIFANAGSAFGNGAAYAIGIVDIVMAFYHRKISFLAGWILVITTQVMGYGWAGILRK  183

Query  587  YLVDPVDMWWPSNLAQVSLFXALH  658
            Y+VDP +MWWPS+L QVSLF A+H
Sbjct  184  YVVDPAEMWWPSSLVQVSLFRAMH  207



>ref|XP_010676880.1| PREDICTED: oligopeptide transporter 7-like [Beta vulgaris subsp. 
vulgaris]
Length=763

 Score =   235 bits (600),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 138/182 (76%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV++VA+ VP  DDP LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  49   NSPVKQVAMTVPTIDDPELPVLTFRMWALGTLSCVVLSFLNQFFWYRTEPLSITAISAQI  108

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA LP R F    RW FTLNPGPFNIKEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMAAKLPSRPFLRGTRWEFTLNPGPFNIKEHVLITIFANA----GAGSVYAIH  164

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++K +YK+ ++F   LI+VLTTQ++G+GWAG+ RRYLV+P +MWWP+NL QVSLF A
Sbjct  165  VVTVVKIFYKKQITFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAEMWWPANLVQVSLFRA  224

Query  653  LH  658
            LH
Sbjct  225  LH  226



>ref|XP_006376658.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
 gb|ERP54455.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
Length=381

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+G N   A E        CPV++V L V +TDDPTLPVLTFR W LG+ SC++L F+N 
Sbjct  1    MAGANEVQAME--IEDEEECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQ  58

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQP+ IS+I  QI+V+P+G  MA  L  RKF     W FT+NPGPFNIKEHV+IT
Sbjct  59   FFWYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLIT  118

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   +T +K YYK+ L+F+  L +++TTQ++G+GWAG+ R+YLV+
Sbjct  119  IFANS----GAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRKYLVE  174

Query  599  PVDMWWPSNLAQVSLFXALH  658
            P +MWWPSNL QVSLF ALH
Sbjct  175  PGEMWWPSNLVQVSLFRALH  194



>ref|XP_002963418.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
 gb|EFJ35289.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
Length=743

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 141/197 (72%), Gaps = 1/197 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  A +  A    + PVEEVAL V   DDPTLPV TFR WFLG+ SCI+L FLN FF Y
Sbjct  11   EPLVAPQVEAEGDDQSPVEEVALTVDTRDDPTLPVGTFRMWFLGLLSCILLSFLNQFFSY  70

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVIITVMA  427
            RT+P  I  I +QI  LP G+FMA  LPER F  PF   SF+LNPGPFN+KEHV+IT+ A
Sbjct  71   RTEPFIIGLISVQIVALPFGRFMANVLPERSFRVPFTSSSFSLNPGPFNVKEHVLITIFA  130

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY++G + I +A+YK+++ F  GL++V+TTQ++GYGWAG+++++LV+P  
Sbjct  131  NAGSGFGNGGAYAMGIVNITRAFYKRSMGFTAGLLLVMTTQVLGYGWAGLMKKHLVEPAH  190

Query  608  MWWPSNLAQVSLFXALH  658
            MWWP NL QVSLF  LH
Sbjct  191  MWWPGNLVQVSLFRTLH  207



>ref|XP_002283680.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=757

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 148/206 (72%), Gaps = 4/206 (2%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            VE+      T  ++        P+EEV L VP  DDP+LPV TFR WFLG+ SC +L FL
Sbjct  4    VEIEAPIIKTRTDEDVKEDELSPIEEVRLTVPNDDDPSLPVWTFRMWFLGLISCALLSFL  63

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAP----FGRWSFTLNPGPFNIK  400
            N FF YR +PL IS I +Q++ LPIG+FMA+ LP+ KF      FG+   +LNPGPFN+K
Sbjct  64   NQFFSYRKEPLVISQITVQVATLPIGRFMASVLPDIKFHVHIPFFGKKELSLNPGPFNMK  123

Query  401  EHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVL  580
            EHV+I++ AN G + GGG AY++G +TI+KA+YK+ +S+L G I+++TTQ++GYGWAG+L
Sbjct  124  EHVLISIFANAGSAFGGGSAYAVGIVTIIKAFYKRNISYLAGWILIITTQVLGYGWAGLL  183

Query  581  RRYLVDPVDMWWPSNLAQVSLFXALH  658
            R+Y+V+P  MWWPS L Q+SLF  LH
Sbjct  184  RKYVVEPAHMWWPSTLVQISLFRTLH  209



>ref|XP_009775420.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana sylvestris]
Length=733

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V   DDP+LPV TFR WFLGI SC IL FLNTFF YRTQPLSIS I +QI+ 
Sbjct  26   PIEEVRLTVSNEDDPSLPVWTFRMWFLGILSCGILAFLNTFFSYRTQPLSISMITVQIAA  85

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+GK MA  LP RKF   G W F+ NPGPFN+KEHV+I++ ANC    G G AY++  +
Sbjct  86   LPLGKIMARVLPTRKFK-IGSWEFSFNPGPFNMKEHVLISIFANC----GSGTAYAVSIV  140

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            TI+KA+Y + +SF+ G I+V+TTQ++GYGWAG++R+Y+VDP +MWWP N+  VSLF ALH
Sbjct  141  TIIKAFYLRNISFVAGWILVVTTQVLGYGWAGIMRKYVVDPAEMWWPGNMVLVSLFRALH  200



>emb|CDY06509.1| BnaC06g11350D [Brassica napus]
Length=227

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 133/176 (76%), Gaps = 4/176 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ EVAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSISAI  QI+V
Sbjct  55   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F    +  FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  115  VPLGRLMAAKISDRVFLQGSKCEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  170

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV+P +MWWP+NL QVSLF
Sbjct  171  TVVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLF  226



>gb|KDP41518.1| hypothetical protein JCGZ_15925 [Jatropha curcas]
Length=730

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 142/192 (74%), Gaps = 2/192 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E    S    P+EEV L V   DDPTLPV TFR WFLGI SC++L FLNTFF YRT+PL+
Sbjct  5    EIETISDDVSPIEEVRLTVSNHDDPTLPVWTFRMWFLGIVSCVLLSFLNTFFAYRTEPLT  64

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            IS I +Q++ LPIG+FMA TLP  KFA   FG   F+LNPGPFN+KEHV+I++ AN G +
Sbjct  65   ISMISVQVATLPIGRFMAKTLPTTKFAIPGFGNKKFSLNPGPFNVKEHVLISIFANVGSN  124

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY+I  I I+ A+Y + +SFL   I+V+TTQ++GYGWAG++R+++VDP  MWWP 
Sbjct  125  AGSGAAYAISIIDIIVAFYHRKISFLASWILVITTQVLGYGWAGIMRKFVVDPAHMWWPI  184

Query  623  NLAQVSLFXALH  658
            +L QVSLF A+H
Sbjct  185  SLVQVSLFRAMH  196



>ref|XP_004143945.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
 gb|KGN49990.1| hypothetical protein Csa_5G148610 [Cucumis sativus]
Length=757

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 141/189 (75%), Gaps = 4/189 (2%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            + + S    P+ +VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YR +PLSI
Sbjct  39   EISESDENSPIPQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  98

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            +AI  QI+V+P+G+ MA+ + +R F    RW F+LNPGPFN+KEHV+IT+ AN     G 
Sbjct  99   TAISAQIAVVPLGRLMASKITDRVFFKGKRWEFSLNPGPFNVKEHVLITIFANS----GA  154

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G  Y+I  +T++K +YKQ L+F   LI+V+TTQ++G+GWAG+ R+YLV+P  MWWPSNL 
Sbjct  155  GSVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLVEPAAMWWPSNLV  214

Query  632  QVSLFXALH  658
            QVSLF ALH
Sbjct  215  QVSLFRALH  223



>ref|XP_011087976.1| PREDICTED: oligopeptide transporter 4 [Sesamum indicum]
Length=744

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 141/182 (77%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q+
Sbjct  30   ESPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLLITQITVQV  89

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            + LPIG F+AA LPE KF  FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  90   ATLPIGHFLAAVLPETKFR-FGGRVFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYAVG  148

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+++P  MWWP  L QVSLF A
Sbjct  149  IVTIVKAFYRRNISFLAGWLLIITTQVLGYGWAGLLRKYVIEPAHMWWPGTLVQVSLFRA  208

Query  653  LH  658
            LH
Sbjct  209  LH  210



>gb|KJB24153.1| hypothetical protein B456_004G130200 [Gossypium raimondii]
Length=759

 Score =   234 bits (596),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 138/182 (76%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV +VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  46   NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLTITAISAQI  105

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  106  AVVPLGQLMAAKITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFAN----SGAGSVYAIH  161

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++K +YKQ ++F   LI++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF A
Sbjct  162  VVTVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  221

Query  653  LH  658
            LH
Sbjct  222  LH  223



>ref|XP_011016978.1| PREDICTED: oligopeptide transporter 2 [Populus euphratica]
Length=738

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 147/208 (71%), Gaps = 7/208 (3%)
 Frame = +2

Query  41   EHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCII  220
            + + +E    NP    E      G  P+EEV L VP  DD TLPV TFR WFLGI SCII
Sbjct  2    DSLEIEGKPQNP-NMNENIEEDDGVSPIEEVRLTVPTRDDHTLPVWTFRMWFLGIASCII  60

Query  221  LIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFN  394
            L FLNTFF YRT+PL+IS I +Q+  LP+G+FMA TLP  KF    FG   F+LNPGPFN
Sbjct  61   LSFLNTFFSYRTEPLTISMISVQVVTLPVGRFMAKTLPTTKFRVPGFGGREFSLNPGPFN  120

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  574
            +KEHV+I++ AN G S     AY++G I I+ A+YK+ +SFL   I+VLTTQ++GYGWAG
Sbjct  121  VKEHVLISIFANVGSS----TAYAVGIIDIIMAFYKRKISFLASWILVLTTQMLGYGWAG  176

Query  575  VLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            ++R+Y+VDP +MWWP +L QVSLF ALH
Sbjct  177  IMRKYVVDPAEMWWPLSLMQVSLFRALH  204



>ref|XP_004163578.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
Length=835

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 141/189 (75%), Gaps = 4/189 (2%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            + + S    P+ +VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YR +PLSI
Sbjct  117  EISESDENSPIPQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  176

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            +AI  QI+V+P+G+ MA+ + +R F    RW F+LNPGPFN+KEHV+IT+ AN     G 
Sbjct  177  TAISAQIAVVPLGRLMASKITDRVFFKGKRWEFSLNPGPFNVKEHVLITIFANS----GA  232

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G  Y+I  +T++K +YKQ L+F   LI+V+TTQ++G+GWAG+ R+YLV+P  MWWPSNL 
Sbjct  233  GSVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLVEPAAMWWPSNLV  292

Query  632  QVSLFXALH  658
            QVSLF ALH
Sbjct  293  QVSLFRALH  301



>ref|XP_006851884.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
 gb|ERN13351.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
Length=734

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 142/196 (72%), Gaps = 4/196 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            + +T  E+   S    P+E+VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF Y
Sbjct  6    SSSTTIEEPNTSPENSPIEQVALTVPVTDDPSLPVLTFRMWFLGGLSCVVLSFLNQFFWY  65

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RT+PLSI+++  QI+V+P+G  MAA LP R F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  66   RTEPLSITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  ++ +K +YK+ LSF    ++V+TTQ++G+GWAG+ R+YLV+P  M
Sbjct  126  S----GAGSVYAIHIVSAVKIFYKETLSFFVAFLVVITTQVLGFGWAGIFRKYLVEPAAM  181

Query  611  WWPSNLAQVSLFXALH  658
            WWP NL QVSLF ALH
Sbjct  182  WWPYNLVQVSLFGALH  197



>ref|XP_009790410.1| PREDICTED: oligopeptide transporter 4 [Nicotiana sylvestris]
Length=738

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 145/197 (74%), Gaps = 6/197 (3%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            PA A +    S    P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YR
Sbjct  12   PAGAADDDDES----PIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYR  67

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMA  427
            T+PL I+ I +Q++ LPIG F+A  LP  KF    FG  SF+LNPGPFN+KEHV+I++ A
Sbjct  68   TEPLVITQITVQVATLPIGHFLATVLPTTKFRLPGFGSRSFSLNPGPFNMKEHVLISIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G + G G AY++G +TI+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P  
Sbjct  128  NAGSAFGNGSAYAVGIVTIIKAFYHRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPAH  187

Query  608  MWWPSNLAQVSLFXALH  658
            MWWPS L QVSLF ALH
Sbjct  188  MWWPSTLVQVSLFRALH  204



>ref|XP_002263530.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=744

 Score =   233 bits (594),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            AT G++   S    P+EEV L V  TDDP+LPV TFR WF+G+ SC +L FL+ FF YRT
Sbjct  19   ATDGDEDELS----PIEEVRLTVTNTDDPSLPVWTFRMWFMGLFSCALLSFLDQFFAYRT  74

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  430
            +PL I+ I +Q++ LPIG FMAA LP  +F    FG  SF+LNPGPFN+KEHV+I++ AN
Sbjct  75   EPLIITQITVQVATLPIGHFMAAVLPTTRFRIPGFGSRSFSLNPGPFNMKEHVLISIFAN  134

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+V+P  M
Sbjct  135  AGSAFGSGSAYAVGIVTIIKAFYQRKISFLSGWLLIITTQVLGYGWAGLLRKYVVEPAHM  194

Query  611  WWPSNLAQVSLFXALH  658
            WWPS+L QVSLF ALH
Sbjct  195  WWPSSLVQVSLFRALH  210



>ref|XP_002301110.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
 gb|EEE80383.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
Length=724

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 141/193 (73%), Gaps = 6/193 (3%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             E      G  P+EEV L VP  DD TLPV TFR WFLGI SCIIL FLNTFF YRT+PL
Sbjct  2    NENIEEDDGVSPIEEVRLTVPTRDDHTLPVWTFRMWFLGIASCIILSFLNTFFSYRTEPL  61

Query  266  SISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGV  439
            +IS I +Q+  LPIG+FMA TLP  KF    FG   F+LNPGPFN+KEHV+I++ AN G 
Sbjct  62   TISMISVQVVTLPIGRFMAKTLPTAKFRVPGFGGREFSLNPGPFNVKEHVLISIFANVGS  121

Query  440  SPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWP  619
            S     AY++G I I+ A+YK+ +SFL   I+VLTTQ++GYGWAG++R+Y+VDP +MWWP
Sbjct  122  S----TAYAVGIIDIIMAFYKRKISFLASWILVLTTQMLGYGWAGIMRKYVVDPAEMWWP  177

Query  620  SNLAQVSLFXALH  658
             +L QVSLF ALH
Sbjct  178  LSLMQVSLFRALH  190



>ref|XP_010254620.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=738

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 141/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  23   PIEQVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFAYRTEPLIITQITVQVAT  82

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMA+ LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  83   LPIGRFMASVLPRTKFRLPGFGSTEFSLNPGPFNMKEHVLISIFANAGSAFGSGYAYAVG  142

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+KA+Y++ +SFL G I+V+TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLF A
Sbjct  143  IVNIIKAFYRKNISFLAGWILVITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRA  202

Query  653  LH  658
            LH
Sbjct  203  LH  204



>ref|XP_009619170.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana tomentosiformis]
Length=733

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V   DDP+LPV TFR WFLGI SC IL FLNTFF YRTQPLSIS I +QI+ 
Sbjct  26   PIEQVRLTVSNQDDPSLPVWTFRMWFLGILSCGILAFLNTFFSYRTQPLSISMITVQIAA  85

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+GK MA  LP RKF   G W F+ NPGPFN+KEHV+I++ ANC    G G AY++  +
Sbjct  86   LPLGKIMARVLPTRKFK-IGSWEFSFNPGPFNMKEHVLISIFANC----GSGTAYAVSIV  140

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            TI+KA+Y + +SF+ G I+V+TTQ++GYGWAG++R+Y+VDP +MWWP N+  VSLF ALH
Sbjct  141  TIIKAFYLRNISFVAGWILVVTTQVLGYGWAGIMRKYVVDPAEMWWPGNMVLVSLFRALH  200



>gb|KHG17687.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=759

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 137/180 (76%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PV +VAL VP TDDP+LPVLTFR W LG  SC +L FLN FF YRT+PL+I+AI  QI+V
Sbjct  48   PVRQVALTVPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQIAV  107

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMAAKITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFAN----SGAGSVYAIHVV  163

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++K +YKQ ++F   LI++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF ALH
Sbjct  164  TVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  223



>ref|XP_002313213.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
 gb|EEE87168.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
Length=752

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 141/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL IS I +QI+ 
Sbjct  33   PIEEVRLTVANTDDPTLPVWTFRMWFLGLISCSLLAFLNQFFSYRTEPLIISQITVQIAS  92

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+ MAA LP+ KF    FG  +F+LNPGPFNIKEHV+I++ AN G + G G AY++G
Sbjct  93   LPIGRSMAAVLPKTKFKIPGFGSRTFSLNPGPFNIKEHVLISIFANAGSAFGSGSAYAVG  152

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+Y +++SFL G +++ TTQ++GYGWAG+LR+Y+V+P  MWWP  L QVSLF A
Sbjct  153  IVTIIKAFYGRSISFLAGWLLITTTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQVSLFRA  212

Query  653  LH  658
            LH
Sbjct  213  LH  214



>emb|CAN79818.1| hypothetical protein VITISV_040328 [Vitis vinifera]
Length=701

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 150/215 (70%), Gaps = 15/215 (7%)
 Frame = +2

Query  17   TVPAQ*LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWF  196
            T P     +H+ +E      AT  E+       CP+E+V L VP TDDPT PVLTFR W 
Sbjct  9    TQPKPQEQQHLDIE------ATGDEEV----NDCPIEQVRLTVPITDDPTEPVLTFRTWV  58

Query  197  LGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFT  373
            LG+ SC+IL F+N FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+
Sbjct  59   LGVASCVILSFVNQFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFS  118

Query  374  LNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  553
            LNPGPFNIKEHV+IT+ AN     G G  Y++G +TI+KA+YK++LS   G ++V TTQL
Sbjct  119  LNPGPFNIKEHVLITMFANS----GSGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQL  174

Query  554  IGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            +GYGWAG+ R+YLVD   MWWPSNL QVSLF ALH
Sbjct  175  LGYGWAGLFRKYLVDSPYMWWPSNLVQVSLFRALH  209



>ref|XP_002971556.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
 gb|EFJ27305.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
Length=743

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 139/197 (71%), Gaps = 1/197 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P    E       + PVEEVAL V   DDPTLPV TFR WFLG+ SCI+L FLN FF Y
Sbjct  11   EPLVTREVEPEGDDQSPVEEVALTVDTRDDPTLPVGTFRMWFLGLLSCILLSFLNQFFSY  70

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVIITVMA  427
            RT+P  I  I +QI  LP G+FMA  LPER F  PF   SF+LNPGPFN+KEHV+IT+ A
Sbjct  71   RTEPFIIGLISVQIVALPFGRFMANVLPERSFRVPFTSSSFSLNPGPFNVKEHVLITIFA  130

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY++G + I +A+YK+++ F  GL++V+TTQ++GYGWAG+++++LV+P  
Sbjct  131  NAGSGFGNGGAYAMGIVNITRAFYKRSMGFTAGLLLVMTTQVLGYGWAGLMKKHLVEPAH  190

Query  608  MWWPSNLAQVSLFXALH  658
            MWWP NL QVSLF  LH
Sbjct  191  MWWPGNLVQVSLFRTLH  207



>gb|KHG17686.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=783

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 137/180 (76%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PV +VAL VP TDDP+LPVLTFR W LG  SC +L FLN FF YRT+PL+I+AI  QI+V
Sbjct  72   PVRQVALTVPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQIAV  131

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  132  VPLGQLMAAKITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFAN----SGAGSVYAIHVV  187

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++K +YKQ ++F   LI++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF ALH
Sbjct  188  TVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  247



>ref|XP_002283691.1| PREDICTED: oligopeptide transporter 2 [Vitis vinifera]
Length=740

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 142/182 (78%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDP+LPV TFR WFLG+ SC++L FLNTFF YRT+PL I+ I +Q++ 
Sbjct  25   PIEEVRLTVPTTDDPSLPVWTFRMWFLGLISCVLLSFLNTFFGYRTEPLVITMISVQVAT  84

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LP+G+FMA  LP+ KF    FG   ++LNPGPFN+KEHV+I++ AN G + G G AY+I 
Sbjct  85   LPVGRFMAKVLPKTKFRVPGFGSREYSLNPGPFNVKEHVLISIFANAGAAFGSGTAYAIS  144

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+KA+Y + +SF    I+V+TTQ++GYGWAG+LR+++VDP +MWWPS+L QVSLF A
Sbjct  145  IVDIIKAFYHREISFSACWILVITTQVLGYGWAGILRKFVVDPAEMWWPSSLTQVSLFSA  204

Query  653  LH  658
            LH
Sbjct  205  LH  206



>ref|XP_006343795.1| PREDICTED: oligopeptide transporter 7-like [Solanum tuberosum]
Length=749

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 139/182 (76%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  36   NSPIEQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  95

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  96   AVVPLGQLMAAKITKRVFLQGSKWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  151

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T +K +YK+ ++F   LI+++TTQ++G+GWAG+ R+YLV+P  MWWPSNL QVSLF A
Sbjct  152  VVTAVKVFYKKDITFFVSLIVIITTQVLGFGWAGIFRKYLVEPAAMWWPSNLVQVSLFRA  211

Query  653  LH  658
            LH
Sbjct  212  LH  213



>ref|XP_002272972.2| PREDICTED: oligopeptide transporter 7 [Vitis vinifera]
Length=749

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 140/189 (74%), Gaps = 4/189 (2%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            K  P     P+++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I
Sbjct  29   KPDPDEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTVSCVLLSFLNQFFWYRTEPLTI  88

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            +AI  QI+V+P+G+ MAA + +R F     W FTLNPGPFN+KEHV+IT+ AN     G 
Sbjct  89   TAISAQIAVVPLGRLMAAKITDRVFFKGTPWEFTLNPGPFNVKEHVLITIFANS----GA  144

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G  Y+I  +T++K +YK+ +SF   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL 
Sbjct  145  GTVYAIHVVTVVKVFYKKHISFFVSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLV  204

Query  632  QVSLFXALH  658
            QVSLF ALH
Sbjct  205  QVSLFRALH  213



>ref|XP_004245468.1| PREDICTED: oligopeptide transporter 7-like [Solanum lycopersicum]
Length=749

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 139/182 (76%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  36   NSPVEQVALTVPTTDDPSLPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLTITAISAQI  95

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    +W F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  96   AVVPLGQLMAAKITKRVFLQGSKWEFSLNPGPFNVKEHVLITIFAN----SGAGTVYAIH  151

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T +K +YK+ ++F   LI+++TTQ++G+GWAG+ R+YLV+P  MWWPSNL QVSLF A
Sbjct  152  VVTAVKVFYKKDITFFVSLIVIITTQVLGFGWAGIFRKYLVEPAAMWWPSNLVQVSLFRA  211

Query  653  LH  658
            LH
Sbjct  212  LH  213



>emb|CDP12213.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 139/182 (76%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+I+AI  Q+
Sbjct  50   NSPIPQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTITAISAQV  109

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA LP+  F    RW F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  110  AVVPLGQLMAAKLPKGAFFKGSRWEFSLNPGPFNVKEHVLITIFANS----GAGTVYAIH  165

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++KA+YK+ ++F   LI+VLTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF A
Sbjct  166  IVTVVKAFYKRHITFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  225

Query  653  LH  658
            LH
Sbjct  226  LH  227



>ref|XP_004238028.1| PREDICTED: oligopeptide transporter 4-like [Solanum lycopersicum]
Length=755

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 141/192 (73%), Gaps = 2/192 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+        P+EEV L VP TDDPTLPV TFR W LG+ SC++L FLN FF YR +PL 
Sbjct  17   EEEINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVLLSFLNQFFSYRKEPLI  76

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  77   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSREFSLNPGPFNMKEHVLITIFANAGFA  136

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y++ +SF    ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS
Sbjct  137  FGNGSAYAVGIVNIIKAFYRRNISFAASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  196

Query  623  NLAQVSLFXALH  658
             L Q+SLF ALH
Sbjct  197  TLVQISLFRALH  208



>ref|XP_006364985.1| PREDICTED: oligopeptide transporter 2-like isoform X2 [Solanum 
tuberosum]
Length=726

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 140/190 (74%), Gaps = 1/190 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            +         P+E+V L V   DDP+LPV TFR WFLG+ SC +L FLNTFF YR +PL 
Sbjct  3    QNLKEEDDESPIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLV  62

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            IS I +Q++ LPIG+ MA  LP+RKF     W F+LNPGPFN+KEHV+I++ AN G + G
Sbjct  63   ISMITVQVATLPIGRLMAKVLPKRKFT-IKSWEFSLNPGPFNVKEHVLISIFANAGSAFG  121

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G AY++G + I+KA+Y + ++FL G I+V+ TQ++GYGWAG++R+Y+VDP +MWWPS+L
Sbjct  122  NGPAYAVGIVDIIKAFYFRNITFLAGWILVVATQVLGYGWAGIMRKYVVDPAEMWWPSSL  181

Query  629  AQVSLFXALH  658
             QVSLF ALH
Sbjct  182  VQVSLFRALH  191



>ref|XP_009359568.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=757

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 138/180 (77%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI+V
Sbjct  48   PVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  163

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF ALH
Sbjct  164  TVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  223



>ref|XP_006364982.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=755

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 141/192 (73%), Gaps = 2/192 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+        P+EEV L VP TDDPTLPV TFR W LG+ SC++L FLN FF YR +PL 
Sbjct  17   EEEINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVLLSFLNQFFSYRKEPLI  76

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  77   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSREFSLNPGPFNMKEHVLITIFANAGFA  136

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS
Sbjct  137  FGNGSAYAVGIVNIIKAFYHRNISFVASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  196

Query  623  NLAQVSLFXALH  658
             L Q+SLF ALH
Sbjct  197  TLVQISLFRALH  208



>emb|CDO97358.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 146/208 (70%), Gaps = 6/208 (3%)
 Frame = +2

Query  53   VEMSGLNPATAG----EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCII  220
            +E+  LN  T       +        P+EEV L V   DDPTLPV TFR W LG+ SC +
Sbjct  4    LEVESLNTTTTATNDHHQKYEDEDDSPIEEVRLTVSNYDDPTLPVWTFRMWLLGLLSCAL  63

Query  221  LIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFN  394
            L FLN FF YRT+PL IS I +Q++ LPIG FMAA LPE+KF    FG+  F+ NPGPFN
Sbjct  64   LSFLNQFFSYRTEPLIISQITVQVASLPIGHFMAAVLPEKKFRLPGFGQRLFSFNPGPFN  123

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  574
            +KEHV+IT+ AN G + G G AY++G I I+ A+YK+ +SFL G ++++TTQ++GYGWAG
Sbjct  124  MKEHVLITIFANAGAAFGNGSAYAVGIINIIIAFYKRKISFLAGWLLIITTQVLGYGWAG  183

Query  575  VLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            +LR+Y+V+P  MWWP+ L QVSLF ALH
Sbjct  184  LLRKYVVEPAHMWWPNTLVQVSLFRALH  211



>gb|KDP25233.1| hypothetical protein JCGZ_20389 [Jatropha curcas]
Length=756

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 141/190 (74%), Gaps = 4/190 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
             K   +    PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLS
Sbjct  35   NKLQETEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLS  94

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  95   ITAISAQIAVVPLGQLMAAKITDRVFLKGTRWEFTLNPGPFNVKEHVLITIFANS----G  150

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T++K +YK+ ++F   LI+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL
Sbjct  151  AGSVYAIHIVTVVKMFYKKHITFFVSLIVIITTQVLGFGWAGIFRKYLVEPAAMWWPANL  210

Query  629  AQVSLFXALH  658
             QVSLF ALH
Sbjct  211  VQVSLFRALH  220



>ref|XP_010267481.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=734

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 146/200 (73%), Gaps = 4/200 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+G   ++  E  +P  G   +++VAL VP TDD ++PVLTFR W LG+ SC++L FLN 
Sbjct  1    MTGNPLSSEMEMESPESGNSTIKQVALTVPTTDDSSIPVLTFRMWVLGLVSCVLLSFLNQ  60

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRT+P+SI+A+  QI+V+P+G  MA+T+ +R F    RW FT+NPGPFN+KEHV+IT
Sbjct  61   FFWYRTEPISITALSAQIAVVPLGHLMASTITKRVFFKGSRWEFTMNPGPFNVKEHVLIT  120

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   ++ +K YYK+ L+F   L+I+LTTQ++G+GWAG+ RRYLV+
Sbjct  121  IFANA----GAGTVYATHILSAIKLYYKRKLTFFPALLIILTTQILGFGWAGMFRRYLVE  176

Query  599  PVDMWWPSNLAQVSLFXALH  658
            P +MWWPSNL QVSLF ALH
Sbjct  177  PAEMWWPSNLVQVSLFRALH  196



>emb|CDP19589.1| unnamed protein product [Coffea canephora]
Length=750

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 149/212 (70%), Gaps = 6/212 (3%)
 Frame = +2

Query  38   SEHIVVEMSGLN-PATAGEKTAPSG----GRCPVEEVALVVPETDDPTLPVLTFRAWFLG  202
            S  I V+ S +N P T G      G       P+E+V L V   DDP+LPV TFR WFLG
Sbjct  3    SFEINVDDSTMNAPKTKGHGYEAEGIDPEEESPIEQVRLTVLNHDDPSLPVWTFRMWFLG  62

Query  203  ITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNP  382
            + SC +L FLNTFF YR++PL I+ I  Q++ LP+G FMA  LP +KF   G W F+LNP
Sbjct  63   LLSCGVLSFLNTFFSYRSEPLVITMISAQVATLPMGHFMAKVLPTKKFQ-IGSWEFSLNP  121

Query  383  GPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGY  562
            GPFNIKEH +I++ AN G + GGG AY+I  + I+KA+Y + +SFL   I+V+TTQ++GY
Sbjct  122  GPFNIKEHALISIFANTGSAFGGGTAYAISIVDIVKAFYHRKISFLASWILVVTTQVLGY  181

Query  563  GWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            GWAG++R+Y+++P +MWWPS+L QVSLF ALH
Sbjct  182  GWAGIMRKYVIEPAEMWWPSSLVQVSLFRALH  213



>ref|XP_002267184.1| PREDICTED: oligopeptide transporter 1-like [Vitis vinifera]
Length=753

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 150/215 (70%), Gaps = 15/215 (7%)
 Frame = +2

Query  17   TVPAQ*LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWF  196
            T P     +H+ +E      AT  E+       CP+E+V L VP TDDPT PVLTFR W 
Sbjct  9    TQPKPQEQQHLDIE------ATGDEEV----NDCPIEQVRLTVPITDDPTEPVLTFRTWV  58

Query  197  LGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFT  373
            LG+ SC+IL F+N FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+
Sbjct  59   LGVASCVILSFVNQFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFS  118

Query  374  LNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  553
            LNPGPFNIKEHV+IT+ AN     G G  Y++G +TI+KA+YK++LS   G ++V TTQL
Sbjct  119  LNPGPFNIKEHVLITMFANS----GSGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQL  174

Query  554  IGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            +GYGWAG+ R+YLVD   MWWPSNL QVSLF ALH
Sbjct  175  LGYGWAGLFRKYLVDSPYMWWPSNLVQVSLFRALH  209



>emb|CBI19303.3| unnamed protein product [Vitis vinifera]
Length=859

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 142/182 (78%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDP+LPV TFR WFLG+ SC++L FLNTFF YRT+PL I+ I +Q++ 
Sbjct  144  PIEEVRLTVPTTDDPSLPVWTFRMWFLGLISCVLLSFLNTFFGYRTEPLVITMISVQVAT  203

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LP+G+FMA  LP+ KF    FG   ++LNPGPFN+KEHV+I++ AN G + G G AY+I 
Sbjct  204  LPVGRFMAKVLPKTKFRVPGFGSREYSLNPGPFNVKEHVLISIFANAGAAFGSGTAYAIS  263

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+KA+Y + +SF    I+V+TTQ++GYGWAG+LR+++VDP +MWWPS+L QVSLF A
Sbjct  264  IVDIIKAFYHREISFSACWILVITTQVLGYGWAGILRKFVVDPAEMWWPSSLTQVSLFSA  323

Query  653  LH  658
            LH
Sbjct  324  LH  325



>ref|XP_006364984.1| PREDICTED: oligopeptide transporter 2-like isoform X1 [Solanum 
tuberosum]
Length=737

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V   DDP+LPV TFR WFLG+ SC +L FLNTFF YR +PL IS I +Q++ 
Sbjct  24   PIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVISMITVQVAT  83

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LPIG+ MA  LP+RKF     W F+LNPGPFN+KEHV+I++ AN G + G G AY++G +
Sbjct  84   LPIGRLMAKVLPKRKFT-IKSWEFSLNPGPFNVKEHVLISIFANAGSAFGNGPAYAVGIV  142

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
             I+KA+Y + ++FL G I+V+ TQ++GYGWAG++R+Y+VDP +MWWPS+L QVSLF ALH
Sbjct  143  DIIKAFYFRNITFLAGWILVVATQVLGYGWAGIMRKYVVDPAEMWWPSSLVQVSLFRALH  202



>ref|XP_011003045.1| PREDICTED: oligopeptide transporter 4 [Populus euphratica]
Length=749

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLP+ TFR WFLG+ SC +L FLN FF YRT+PL IS I +Q++ 
Sbjct  33   PIEEVRLTVANTDDPTLPIWTFRMWFLGLISCSLLAFLNQFFSYRTEPLIISQITVQVAS  92

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+ MAA LP+ KF    FG  +F+LNPGPFNIKEHV+I++ AN G + G G AY++G
Sbjct  93   LPIGRSMAAVLPKTKFKIPGFGSRTFSLNPGPFNIKEHVLISIFANAGSAFGSGSAYAVG  152

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+Y + +SFL G +++ TTQ++GYGWAG+LR+Y+V+P  MWWP  L QVSLF A
Sbjct  153  IVTIIKAFYGRRISFLAGWLLITTTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQVSLFRA  212

Query  653  LH  658
            LH
Sbjct  213  LH  214



>ref|XP_008390300.1| PREDICTED: oligopeptide transporter 7 isoform X2 [Malus domestica]
Length=706

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 138/180 (77%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI+V
Sbjct  48   PVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  163

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF ALH
Sbjct  164  TVVKVFYKRHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  223



>gb|EMT01286.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=730

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 147/192 (77%), Gaps = 5/192 (3%)
 Frame = +2

Query  83   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  262
            AG++   S    PVE+V L VP TDDP+LPV TFR W +G  SC +L FLN FF YR +P
Sbjct  9    AGDEDDAS----PVEQVRLTVPVTDDPSLPVWTFRMWTMGFLSCALLSFLNQFFAYRAEP  64

Query  263  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            + IS I +Q++ LPIG F+A  LPE+KF  FGR   ++NPGPFN+KEHV+I++ AN G S
Sbjct  65   IIISQITIQVAALPIGHFLARVLPEKKFRVFGR-ECSVNPGPFNVKEHVLISIFANAGAS  123

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             GGG+AY+IG +TI+KA+YK+ +SF+  L++V+TTQ++GYGWAG++R+Y+V+P  MWWP+
Sbjct  124  FGGGNAYAIGIVTIIKAFYKRNISFVTSLLLVITTQVLGYGWAGLMRKYVVEPAHMWWPT  183

Query  623  NLAQVSLFXALH  658
            +L QVSL  A+H
Sbjct  184  SLVQVSLMRAMH  195



>ref|XP_006376659.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
 gb|ERP54456.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
Length=532

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+G N   A E        CPV++V L V +TDDPTLPVLTFR W LG+ SC++L F+N 
Sbjct  1    MAGANEVQAME--IEDEEECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQ  58

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQP+ IS+I  QI+V+P+G  MA  L  RKF     W FT+NPGPFNIKEHV+IT
Sbjct  59   FFWYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLIT  118

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   +T +K YYK+ L+F+  L +++TTQ++G+GWAG+ R+YLV+
Sbjct  119  IFANS----GAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRKYLVE  174

Query  599  PVDMWWPSNLAQVSLFXALH  658
            P +MWWPSNL QVSLF ALH
Sbjct  175  PGEMWWPSNLVQVSLFRALH  194



>gb|KJB32169.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=753

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 2/198 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  139  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  198

Query  605  DMWWPSNLAQVSLFXALH  658
             MWWPS L QVSLF ALH
Sbjct  199  HMWWPSTLVQVSLFRALH  216



>gb|EMS65129.1| Oligopeptide transporter 7 [Triticum urartu]
Length=798

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +P    +    S    P+E+VAL VP  DDP  PVLTFR W LG+ SC +L FLN FF Y
Sbjct  103  SPERHDDGHGRSSENSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFLNQFFWY  162

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PL+I+AI  QI+V+P+G+ MAA LPER F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  163  RKEPLTITAISAQIAVVPLGRLMAAALPERAFLRGSRWEFTLNPGPFNVKEHVLITIFAN  222

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  +T ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRYLV+P  M
Sbjct  223  A----GAGTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAM  278

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNL QVSLF ALH
Sbjct  279  WWPSNLVQVSLFRALH  294



>ref|XP_007200086.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
 gb|EMJ01285.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
Length=743

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 140/192 (73%), Gaps = 2/192 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            +  A      P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL 
Sbjct  19   DSDAEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFSYRTEPLI  78

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q+S LPIG FMA  LP  KF    FG  SF+LNPGPFNIKEHV+IT+ AN G +
Sbjct  79   ITQITVQVSTLPIGNFMAKVLPTNKFHIPGFGSRSFSLNPGPFNIKEHVLITIFANAGSA  138

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y++ +S L   ++++TTQ++GYGWAG+LR+Y+V+P  MWWP+
Sbjct  139  FGLGSAYAVGIVNIIKAFYRRKISLLASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPN  198

Query  623  NLAQVSLFXALH  658
             L QVSLF ALH
Sbjct  199  TLVQVSLFRALH  210



>ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta vulgaris subsp. vulgaris]
Length=746

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 144/195 (74%), Gaps = 5/195 (3%)
 Frame = +2

Query  89   EKTAPSGGR---CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQ  259
            EK+ P        P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+
Sbjct  15   EKSKPDIDEDDISPIEEVRLTVTNTDDPTLPVWTFRMWFLGLVSCGMLSFLNQFFSYRTE  74

Query  260  PLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANC  433
            PL I+ I +Q++ LP+G F+A  LPE KF    FG  +F+LNPGPFN+KEHV+IT+ AN 
Sbjct  75   PLIITQITVQVATLPLGHFLARILPETKFRIPGFGPRTFSLNPGPFNVKEHVLITIFANA  134

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
            G + G G AY++G + I+KA+YK+ +SFL   I+++TTQ++GYGWAG++R+Y+V+P  MW
Sbjct  135  GSAFGNGSAYAVGIVNIIKAFYKRNISFLAAWILIITTQVLGYGWAGLMRKYVVEPAHMW  194

Query  614  WPSNLAQVSLFXALH  658
            WP+ L QVSLF ALH
Sbjct  195  WPNTLVQVSLFRALH  209



>ref|XP_006417516.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
 gb|ESQ35869.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
Length=731

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL IS I +Q+
Sbjct  16   ESPVEEVRLTVSNDDDPSLPVWTFRMWFLGLISCVMLSFLNTFFGYRTQPLMISMISVQV  75

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LPIGK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  76   VTLPIGKLMARVLPETKYR-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  134

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++ QVSLF A
Sbjct  135  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRA  194

Query  653  LH  658
            LH
Sbjct  195  LH  196



>ref|XP_008239235.1| PREDICTED: oligopeptide transporter 7-like [Prunus mume]
Length=759

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  48   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQI  107

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  108  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  163

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF A
Sbjct  164  VVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  223

Query  653  LH  658
            LH
Sbjct  224  LH  225



>gb|EPS60835.1| hypothetical protein M569_13965 [Genlisea aurea]
Length=743

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 140/196 (71%), Gaps = 6/196 (3%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P +A +   P     P+EEV L VP TDDP+LP LTFR WFLGI SC  L +LN FF YR
Sbjct  12   PESAAKNDEPLND-SPIEEVRLTVPTTDDPSLPCLTFRTWFLGIISCAALSYLNQFFSYR  70

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMAN  430
              PLSI+++  QI VLP+GKFMAATLPER+F  P   WSF+LNPGPFN+KEH +IT+ AN
Sbjct  71   RNPLSITSVSAQILVLPVGKFMAATLPERRFRFPGTNWSFSLNPGPFNMKEHCLITIFAN  130

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G S      Y+IG +TI+KA+Y + L  L  +I+  +TQL+GYGWAG+ R++LVD   M
Sbjct  131  AGAS----GVYAIGIVTIVKAFYHRKLHPLAAMILTHSTQLLGYGWAGIFRKFLVDSPYM  186

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNL QVSLF ALH
Sbjct  187  WWPSNLVQVSLFRALH  202



>ref|XP_010538850.1| PREDICTED: oligopeptide transporter 7 [Tarenaya hassleriana]
Length=757

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 138/180 (77%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ +VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+ISAI  QI+V
Sbjct  46   PIRQVALTVPTTDDPSLPVLTFRMWVLGTVSCVVLSFLNQFFWYRTEPLTISAISAQIAV  105

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA L ++ F    +W F+LNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  106  VPLGRLMAAKLSDKVFLRGSKWEFSLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  161

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++KA+Y + ++F   LI+++TTQ++G+GWAG+ RRYLV+P  MWWPSNL QVSLF ALH
Sbjct  162  TVVKAFYMKNITFFVSLIVIITTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALH  221



>ref|XP_004288878.1| PREDICTED: oligopeptide transporter 2-like [Fragaria vesca subsp. 
vesca]
Length=746

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V   DDP+LPV TFR W +G+ SC++L F+NTFF YRT+PL IS I +Q++ 
Sbjct  34   PIEQVRLTVSNDDDPSLPVWTFRMWSIGLLSCVLLSFVNTFFSYRTEPLVISMITIQVAS  93

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LPIGKFMA TLP RKF   G   F+LNPG FNIKEHV+I++ AN G   G G AY+IG +
Sbjct  94   LPIGKFMARTLPTRKFR-IGSKEFSLNPGEFNIKEHVLISIFANTGAGFGSGPAYAIGIV  152

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            TI+KA+Y + +SFL   I+V+TTQ++GYGWAG+LR+Y+VDP  MWWPS+L QVSLF ALH
Sbjct  153  TIVKAFYGRRISFLASWILVITTQVLGYGWAGILRKYVVDPATMWWPSSLVQVSLFRALH  212



>gb|KHG09371.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=753

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (72%), Gaps = 2/198 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++G + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  139  ANAGSAFGNGSAYAVGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  198

Query  605  DMWWPSNLAQVSLFXALH  658
             MWWPS L QVSLF ALH
Sbjct  199  HMWWPSTLVQVSLFRALH  216



>ref|XP_010676881.1| PREDICTED: oligopeptide transporter 7 [Beta vulgaris subsp. vulgaris]
Length=754

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 143/207 (69%), Gaps = 4/207 (2%)
 Frame = +2

Query  38   SEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCI  217
             EH   E +  +       +  S    PV++VAL VP TDDP LPVLTFR W LG+ SCI
Sbjct  16   DEHHQDEKNEESQRLISSSSTKSTENSPVKQVALTVPITDDPELPVLTFRTWVLGMVSCI  75

Query  218  ILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNI  397
            +L FLN FF YRT+PLS++ I  QI+V+P+G +MA+ LP        RW F++NPGPFN+
Sbjct  76   VLSFLNQFFWYRTEPLSVTGIAAQIAVVPLGHWMASNLPNGSLFRGTRWEFSMNPGPFNV  135

Query  398  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  577
            KEHV+IT+ AN     G G  Y+I  +T +K +YK+ ++F   L++VLTTQ++G+GWAGV
Sbjct  136  KEHVLITIFANA----GAGTVYAIHVVTAVKIFYKKNITFFVSLLVVLTTQVLGFGWAGV  191

Query  578  LRRYLVDPVDMWWPSNLAQVSLFXALH  658
             RRYLV+P +MWWP+NL QVSLF ALH
Sbjct  192  FRRYLVEPAEMWWPANLVQVSLFRALH  218



>ref|XP_010475851.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=735

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+
Sbjct  20   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQV  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+LNPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  80   VTLPLGKLMARVLPETKYK-IGSWEFSLNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++ QVSLF A
Sbjct  139  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRA  198

Query  653  LH  658
            LH
Sbjct  199  LH  200



>ref|XP_009132469.1| PREDICTED: oligopeptide transporter 9-like [Brassica rapa]
Length=746

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 144/205 (70%), Gaps = 7/205 (3%)
 Frame = +2

Query  53   VEMSGLNPATAG---EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIIL  223
            V+ S + P+TA    E+      RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL
Sbjct  5    VKGSTVKPSTAAMEIEEGVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLGACIIL  64

Query  224  IFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKE  403
             F+N FF YR  PLSI+ I  QI+V+P+G  MA  LP +K+    RW F +NPGPFN+KE
Sbjct  65   SFINQFFWYRRMPLSITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNVKE  124

Query  404  HVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLR  583
            HV+IT+ AN     G G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG+ R
Sbjct  125  HVMITIFANS----GAGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFR  180

Query  584  RYLVDPVDMWWPSNLAQVSLFXALH  658
            ++LV+P +MWWPSNL QVSLF ALH
Sbjct  181  KHLVEPGEMWWPSNLVQVSLFSALH  205



>ref|XP_007039426.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOY23927.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
Length=762

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 138/182 (76%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV +VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  49   NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLTITAISAQI  108

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    RW F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMAAKITDRVFFKGTRWEFSLNPGPFNVKEHVLITIFANS----GAGSVYAIH  164

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++K +YK+ ++F   LI+++TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF A
Sbjct  165  VVTVVKVFYKKHITFFVSLIVIITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  224

Query  653  LH  658
            LH
Sbjct  225  LH  226



>ref|XP_008390299.1| PREDICTED: oligopeptide transporter 7 isoform X1 [Malus domestica]
Length=757

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 138/180 (77%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI+V
Sbjct  48   PVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  163

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF ALH
Sbjct  164  TVVKVFYKRHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  223



>ref|XP_002437735.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
 gb|EER89102.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
Length=785

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 139/192 (72%), Gaps = 4/192 (2%)
 Frame = +2

Query  83   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  262
            + + ++  G   P+E+VAL VP  DDPT PVLTFR W LG  SC +L FLN FF YR +P
Sbjct  60   SDDLSSSEGENSPIEQVALTVPVGDDPTTPVLTFRMWVLGTASCALLSFLNQFFWYRKEP  119

Query  263  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            L+I+AI  QI+V+P+G+ MAA LPER F    RW F+LNPGPFN+KEHV+IT+ AN    
Sbjct  120  LTITAISAQIAVVPLGRLMAAALPERAFLRGTRWEFSLNPGPFNVKEHVLITIFANS---  176

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G  Y+I  IT ++ +Y + ++F   L++VLTTQ++G+GWAG+ RRYLV+P  MWWPS
Sbjct  177  -GAGTVYAIHVITAVRVFYGKNITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPS  235

Query  623  NLAQVSLFXALH  658
            NL QVSLF ALH
Sbjct  236  NLVQVSLFRALH  247



>gb|EMS68344.1| Oligopeptide transporter 4 [Triticum urartu]
Length=727

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 144/190 (76%), Gaps = 1/190 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+        PVE+V L VP TDD +LPV TFR W +G  SC +L FLN FF YR +P+ 
Sbjct  4    ERAGDEDDASPVEQVRLTVPVTDDHSLPVWTFRMWTMGFLSCALLSFLNQFFAYRAEPII  63

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            IS I +Q++ LPIG+F++  LPE+KF  FGR   ++NPGPFN+KEHV+I++ AN G S G
Sbjct  64   ISQITIQVAALPIGRFLSRVLPEKKFRVFGR-ECSVNPGPFNVKEHVLISIFANAGASFG  122

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
            GG+AY+IG +TI+KA+YK+ +SF+  L++V+TTQ++GYGWAG++R+Y+V+P  MWWP++L
Sbjct  123  GGNAYAIGIVTIIKAFYKRNISFVTSLLLVITTQVLGYGWAGLMRKYVVEPAHMWWPTSL  182

Query  629  AQVSLFXALH  658
             QVSL  A+H
Sbjct  183  VQVSLMRAMH  192



>ref|XP_009358688.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=749

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  38   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  97

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  153

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T +K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF A
Sbjct  154  IVTAVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  213

Query  653  LH  658
            LH
Sbjct  214  LH  215



>ref|XP_010501399.1| PREDICTED: oligopeptide transporter 2 [Camelina sativa]
Length=735

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+
Sbjct  20   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQV  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+LNPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  80   VTLPLGKLMARVLPETKYK-IGSWEFSLNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++ QVSLF A
Sbjct  139  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRA  198

Query  653  LH  658
            LH
Sbjct  199  LH  200



>ref|XP_004309550.1| PREDICTED: oligopeptide transporter 7 [Fragaria vesca subsp. 
vesca]
Length=749

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV++VAL VP  DDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  38   NSPVKQVALTVPTGDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQI  97

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMAANITTRVFFKGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  153

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++K +YKQ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF A
Sbjct  154  IVTVVKVFYKQHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  213

Query  653  LH  658
            LH
Sbjct  214  LH  215



>ref|XP_006394156.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
 gb|ESQ31442.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
Length=729

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLGI SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGIISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGLGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLF A
Sbjct  134  IVTIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRA  193

Query  653  LH  658
            LH
Sbjct  194  LH  195



>ref|XP_009765351.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana sylvestris]
Length=757

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 139/182 (76%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+++VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  44   NSPIKQVALTVPITDDPSLPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLTITAISAQI  103

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  104  AVVPLGQLMAAKITKRVFFQGSKWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  159

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T +K +Y++ ++F   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF A
Sbjct  160  VVTAVKVFYQKNITFFVSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  219

Query  653  LH  658
            LH
Sbjct  220  LH  221



>gb|KDO67986.1| hypothetical protein CISIN_1g029091mg [Citrus sinensis]
Length=199

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 140/198 (71%), Gaps = 2/198 (1%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+  N  +A           PVEEV L V  +DDP+LPV TFR WFLG+ SC +L FLN 
Sbjct  1    MAPTNVTSATAADIDGDELSPVEEVRLTVLNSDDPSLPVWTFRMWFLGLLSCALLSFLNQ  60

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWS--FTLNPGPFNIKEHVI  412
            FF YRT+PL I+ I +Q++ LPIG+F+AATLPE +F   G  S  F+LN GPFN+KEHV+
Sbjct  61   FFAYRTEPLIITQITVQVATLPIGRFLAATLPETRFRIPGCGSRLFSLNSGPFNVKEHVL  120

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            I++ AN G + G G  +++  + I+KA+Y + +SFL   ++++TTQ++GYGWAG+LR+Y+
Sbjct  121  ISIFANAGSAFGAGSTFAVSIVNIIKAFYHRKISFLASWLLIITTQVLGYGWAGLLRKYV  180

Query  593  VDPVDMWWPSNLAQVSLF  646
            V+P  MWWPS L QVSLF
Sbjct  181  VEPAHMWWPSTLVQVSLF  198



>ref|XP_004309115.1| PREDICTED: oligopeptide transporter 6-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011470202.1| PREDICTED: oligopeptide transporter 6-like [Fragaria vesca subsp. 
vesca]
Length=728

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC +E+V L VP+TDDPTLPVLTFR W LG+ SCI+L F+N FF YRTQPL+ISAI  QI
Sbjct  17   RCLIEQVELTVPKTDDPTLPVLTFRMWVLGLVSCILLSFVNQFFWYRTQPLTISAISAQI  76

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G FMA  LP R F    +  FT+NPGPFN+KEHV+IT+ ANC    G G  Y+  
Sbjct  77   AVVPLGHFMARVLPTRSFFQGTQLEFTMNPGPFNVKEHVLITIFANC----GAGTVYASH  132

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T +K  YK+ L+FL   I++LTTQ++G+GWAG+ R+YLV+P  MWWP NL QVSLF A
Sbjct  133  ILTAVKLLYKRKLTFLPAFIVMLTTQVLGFGWAGIFRKYLVEPEKMWWPGNLVQVSLFSA  192

Query  653  LH  658
            LH
Sbjct  193  LH  194



>emb|CDX86844.1| BnaA09g22340D [Brassica napus]
Length=765

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 137/180 (76%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ EVAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSISAI  QI+V
Sbjct  55   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  115  VPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  170

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV+P +MWWP+NL QVSLF ALH
Sbjct  171  TVVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLFRALH  230



>ref|XP_010644607.1| PREDICTED: oligopeptide transporter 1-like [Vitis vinifera]
Length=745

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 146/202 (72%), Gaps = 8/202 (4%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            E++  N    G++       CP+E+V L VP TDDPT PVLTFR W LG+ +C+IL F+N
Sbjct  7    EVTQKNFKVDGDEEE---NDCPIEQVRLTVPITDDPTEPVLTFRTWVLGVAACVILSFVN  63

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVI  412
             FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+LNPGPFNIKEHV+
Sbjct  64   QFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFSLNPGPFNIKEHVL  123

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            IT+ AN     G G  Y++G +TI+KA+YK++LS   G ++V TTQL+GYGWAG+ R+YL
Sbjct  124  ITMFANS----GSGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYL  179

Query  593  VDPVDMWWPSNLAQVSLFXALH  658
            VD   MWWPSNL QVSLF ALH
Sbjct  180  VDSPYMWWPSNLVQVSLFRALH  201



>ref|XP_009612437.1| PREDICTED: oligopeptide transporter 4 [Nicotiana tomentosiformis]
Length=737

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 139/184 (76%), Gaps = 2/184 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q+
Sbjct  20   ESPIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYRTEPLVITQITVQV  79

Query  293  SVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
            + LPIG F+A  LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY+
Sbjct  80   ATLPIGHFLATVLPTTKFRLPGFGSRLFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYA  139

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            +G +TI+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLF
Sbjct  140  VGIVTIIKAFYHRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLF  199

Query  647  XALH  658
             ALH
Sbjct  200  RALH  203



>ref|XP_009801973.1| PREDICTED: oligopeptide transporter 6-like [Nicotiana sylvestris]
Length=732

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 139/195 (71%), Gaps = 4/195 (2%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P             CP++EV + VP+TDDPT PVLTFR WFLGITSC++L F+N FF YR
Sbjct  5    PVNMAAANEADEDLCPIKEVDMTVPKTDDPTTPVLTFRMWFLGITSCVLLSFVNQFFWYR  64

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  433
            T+PL+IS+  +QI+V+PIG  MA T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN 
Sbjct  65   TEPLTISSTAVQIAVVPIGHLMAKTITKRLFFEGTRWEFTLNPGPFNIKEHVLITIFANA  124

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
                G G  Y+   ++ +K YYK+ LSF   L+I+ TTQ++G+GWAG+ R++LV+P +MW
Sbjct  125  ----GAGSVYATHILSAVKLYYKRPLSFFPALLIMATTQMLGFGWAGIFRKHLVEPAEMW  180

Query  614  WPSNLAQVSLFXALH  658
            WP +L QVSLF ALH
Sbjct  181  WPGSLVQVSLFRALH  195



>ref|XP_006351838.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=738

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  23   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYRTEPLVITQITVQVAT  82

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  83   LPIGHFLATILPKTKFRLPGFGPRLFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYAVG  142

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+Y++ +SFL G I+++TTQ++GYGWAG+LR+Y+V+P  MWWP  L QVSLF A
Sbjct  143  IVTIIKAFYRRNISFLAGWILIITTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQVSLFRA  202

Query  653  LH  658
            LH
Sbjct  203  LH  204



>emb|CBI39770.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 146/202 (72%), Gaps = 8/202 (4%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            E++  N    G++       CP+E+V L VP TDDPT PVLTFR W LG+ +C+IL F+N
Sbjct  7    EVTQKNFKVDGDEEE---NDCPIEQVRLTVPITDDPTEPVLTFRTWVLGVAACVILSFVN  63

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVI  412
             FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+LNPGPFNIKEHV+
Sbjct  64   QFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFSLNPGPFNIKEHVL  123

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            IT+ AN     G G  Y++G +TI+KA+YK++LS   G ++V TTQL+GYGWAG+ R+YL
Sbjct  124  ITMFANS----GSGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYL  179

Query  593  VDPVDMWWPSNLAQVSLFXALH  658
            VD   MWWPSNL QVSLF ALH
Sbjct  180  VDSPYMWWPSNLVQVSLFRALH  201



>ref|XP_010065750.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW63397.1| hypothetical protein EUGRSUZ_G01043 [Eucalyptus grandis]
Length=752

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (72%), Gaps = 2/198 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             PA   +         P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  21   KPAAPNDVDDAEDDLSPIEEVRLTVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAY  80

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q++ LPIG+FMAA LP  KF     G  +F+LNPGPFN+KEHV+I++ 
Sbjct  81   RTEPLVITQITVQVATLPIGRFMAAVLPTAKFRIPGLGPRTFSLNPGPFNMKEHVLISIF  140

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++  + I+KA+Y +++SF  G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  141  ANAGSAFGSGSAYAVSIVNIIKAFYVRSISFFAGWLLIITTQVLGYGWAGLLRKYVVEPA  200

Query  605  DMWWPSNLAQVSLFXALH  658
             MWWPS L QVSLF ALH
Sbjct  201  HMWWPSTLVQVSLFRALH  218



>ref|XP_004231372.1| PREDICTED: oligopeptide transporter 4 [Solanum lycopersicum]
Length=735

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  20   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYRTEPLVITQITVQVAT  79

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  80   LPIGHFLATILPATKFRLPGFGPRLFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYAVG  139

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+Y++ +SFL G I+++TTQ++GYGWAG+LR+Y+V+P  MWWP+ L QVSLF A
Sbjct  140  IVTIIKAFYRRNISFLAGWILIITTQVLGYGWAGLLRKYVVEPAHMWWPATLVQVSLFRA  199

Query  653  LH  658
            LH
Sbjct  200  LH  201



>ref|XP_009616769.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana tomentosiformis]
Length=738

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+V L V   DDP+LPV TFR WFLG+ SC +L FLNTFF YR +PL I+ I +Q+
Sbjct  26   ESPIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVITMITVQV  85

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            + LP+G+ MA  LP RKF     W FTLNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  86   ATLPLGRIMARVLPTRKFK-IRSWEFTLNPGPFNMKEHVLISIFANAGSAFGNGPAYAVG  144

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I KA+Y + +SFL G I+V+ TQ++GYGWAG++R+Y+VDP +MWWPS+L QVSLF A
Sbjct  145  IVDITKAFYFRNISFLAGWILVIATQVLGYGWAGIMRKYVVDPAEMWWPSSLVQVSLFRA  204

Query  653  LH  658
            LH
Sbjct  205  LH  206



>ref|XP_009108224.1| PREDICTED: oligopeptide transporter 7 [Brassica rapa]
Length=765

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 137/180 (76%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ EVAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSISAI  QI+V
Sbjct  55   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  115  VPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  170

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV+P +MWWP+NL QVSLF ALH
Sbjct  171  TVVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLFRALH  230



>emb|CBI19304.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 140/180 (78%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP  DDP+LPV TFR WFLG+ SC +L FLN FF YR +PL IS I +Q++ 
Sbjct  28   PIEEVRLTVPNDDDPSLPVWTFRMWFLGLISCALLSFLNQFFSYRKEPLVISQITVQVAT  87

Query  299  LPIGKFMAATLPERKFAP----FGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
            LPIG+FMA+ LP+ KF      FG+   +LNPGPFN+KEHV+I++ AN G + GGG AY+
Sbjct  88   LPIGRFMASVLPDIKFHVHIPFFGKKELSLNPGPFNMKEHVLISIFANAGSAFGGGSAYA  147

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            +G +TI+KA+YK+ +S+L G I+++TTQ++GYGWAG+LR+Y+V+P  MWWPS L Q+SLF
Sbjct  148  VGIVTIIKAFYKRNISYLAGWILIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQISLF  207



>ref|XP_008437437.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7 [Cucumis 
melo]
Length=752

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 141/189 (75%), Gaps = 5/189 (3%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            + + S    P+ +VAL VP +DDP+LPVLTFR WFLG  SC++L FLN FF YR +PLSI
Sbjct  35   EISESDENSPIPQVALTVPTSDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  94

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            +AI  QI+V+P+G+ MA+ + +R F    RW F+LNPGPFN+KEHV+IT+ AN G     
Sbjct  95   TAISAQIAVVPLGRLMASKITDRVFKG-KRWEFSLNPGPFNVKEHVLITIFANSG----A  149

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G  Y+I  +T++K +YKQ L+F   LI+V+TTQ++G+GWAG+ R+YLV+P  MWWP+NL 
Sbjct  150  GSVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLVEPAAMWWPANLV  209

Query  632  QVSLFXALH  658
            QVSLF ALH
Sbjct  210  QVSLFRALH  218



>ref|XP_009368318.1| PREDICTED: oligopeptide transporter 4 [Pyrus x bretschneideri]
Length=750

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 140/198 (71%), Gaps = 2/198 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  + E         P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  20   KPTHSLEPDTEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLVSCALLSFLNQFFSY  79

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA  LP + F    FG  +F+LNPGPFNIKEHV+IT+ 
Sbjct  80   RTEPLIITQITVQVSTLPIGYFMAKVLPTKTFHIPGFGSRTFSLNPGPFNIKEHVLITIF  139

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++G + I+KA+Y + +S L   ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  140  ANAGSAFGAGSAYAVGIVNIIKAFYHRKISLLASWLLIITTQVLGYGWAGLLRKYVVEPA  199

Query  605  DMWWPSNLAQVSLFXALH  658
             MWWP+ L QVSLF ALH
Sbjct  200  HMWWPNTLVQVSLFRALH  217



>ref|XP_010458316.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=736

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+  
Sbjct  23   PVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQVVT  82

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+GK MA  LPE K+   G W F+LNPGPFN+KEHV+I++ AN G   G G AY++G +
Sbjct  83   LPLGKLMARVLPETKYK-IGSWEFSLNPGPFNVKEHVLISMFANAGAGFGSGTAYAVGIV  141

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
             I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++ QVSLF ALH
Sbjct  142  DIIVAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRALH  201



>gb|KJB32171.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=951

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 2/198 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  217  DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  276

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  277  RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  336

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  337  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  396

Query  605  DMWWPSNLAQVSLFXALH  658
             MWWPS L QVSLF ALH
Sbjct  397  HMWWPSTLVQVSLFRALH  414


 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGR-CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            N A  GE  A       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF 
Sbjct  19   NHAIKGENAAADDDELSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFA  78

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITV  421
            YRT+PL I+ I +Q++ LPIG+FMAA LP R+F     G   F+LNPGPFN+KEHV+I++
Sbjct  79   YRTEPLIITQITVQVATLPIGQFMAAVLPRRQFKLPGVGSRKFSLNPGPFNMKEHVLISI  138

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  553
             AN G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQL
Sbjct  139  FANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLAGWLLIITTQL  182



>ref|XP_002892535.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68794.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
Length=734

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVEEV L V   DDP+LPV TFR WFLG+ SCI+L FLNTFF YRTQPL I+ I +Q+
Sbjct  19   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMISVQV  78

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  79   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  137

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++ QVSLF A
Sbjct  138  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRA  197

Query  653  LH  658
            LH
Sbjct  198  LH  199



>ref|XP_008349603.1| PREDICTED: oligopeptide transporter 5-like [Malus domestica]
Length=400

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 132/182 (73%), Gaps = 5/182 (3%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
             P+EEV L VP TDDP+ P LTFR W LGI SC+IL F+N FF +RT  LS+S++  QI 
Sbjct  35   SPIEEVWLTVPITDDPSQPTLTFRTWVLGILSCVILSFVNEFFGFRTNQLSVSSVSAQIV  94

Query  296  VLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            VLP+GK MAATLP RKF  PF +WSFT+NPGPFN+KEHV+IT+ AN     G G  Y++ 
Sbjct  95   VLPLGKLMAATLPTRKFRVPFTKWSFTMNPGPFNLKEHVLITIFANS----GAGGVYAVH  150

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             ITI+KA+Y +        ++  TTQ++GYGWAG+ R+YLVD   MWWP+NL QVSLF A
Sbjct  151  IITIVKAFYHRKQHPAAAFLLAQTTQMLGYGWAGLFRKYLVDSPYMWWPANLVQVSLFRA  210

Query  653  LH  658
            LH
Sbjct  211  LH  212



>ref|XP_009608843.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=757

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 141/190 (74%), Gaps = 4/190 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            ++        P+++VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+
Sbjct  36   KQEEDEEENSPIKQVALTVPITDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLT  95

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  96   ITAISAQIAVVPLGQLMAAKITKRVFFQGSKWEFTLNPGPFNVKEHVLITIFANS----G  151

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T +K +Y++ ++F   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  152  AGTVYAIHVVTAVKVFYQKNITFFVSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANL  211

Query  629  AQVSLFXALH  658
             QVSLF ALH
Sbjct  212  VQVSLFRALH  221



>ref|XP_007210345.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
 gb|EMJ11544.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
Length=760

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSI+AI  QI
Sbjct  49   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRKEPLSITAISAQI  108

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  164

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF A
Sbjct  165  IVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  224

Query  653  LH  658
            LH
Sbjct  225  LH  226



>ref|XP_009130453.1| PREDICTED: oligopeptide transporter 4 [Brassica rapa]
Length=729

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDD TLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLF A
Sbjct  134  IVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRA  193

Query  653  LH  658
            LH
Sbjct  194  LH  195



>emb|CDY31321.1| BnaA02g34200D [Brassica napus]
Length=729

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDD TLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLF A
Sbjct  134  IVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRA  193

Query  653  LH  658
            LH
Sbjct  194  LH  195



>emb|CDY46800.1| BnaC02g43080D [Brassica napus]
Length=729

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDD TLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLF A
Sbjct  134  IVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRA  193

Query  653  LH  658
            LH
Sbjct  194  LH  195



>ref|XP_008803572.1| PREDICTED: oligopeptide transporter 4-like isoform X2 [Phoenix 
dactylifera]
Length=606

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGR--CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            M+    A   EKTA        P+E+V L VP TD+PTLPV TFR WF+GI SC ++ FL
Sbjct  26   MTATVSAMDVEKTAGGDEEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMSFL  85

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            N FF YRT+PL I+ I +Q++ LP+G F+A  LP  KF    FG   F+LNPGPFN+KEH
Sbjct  86   NQFFSYRTEPLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMKEH  145

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY +G + I++A+YK+ +SF  G I+++TTQ++GYGWAG++R+
Sbjct  146  VLISIFANAGYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLMRK  205

Query  587  YLVDPVDMWWPSNLAQVSLFXALH  658
            Y+V+P  MWWP+ L QVSLF ALH
Sbjct  206  YVVEPAHMWWPTTLVQVSLFRALH  229



>ref|XP_006397011.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
 gb|ESQ38464.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
Length=764

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 144/201 (72%), Gaps = 5/201 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            E  GL    +G+ +       P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN
Sbjct  34   ETEGLCLPISGD-SGEDEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLN  92

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
             FF YRT+PL+ISAI  QI+V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+I
Sbjct  93   QFFWYRTEPLTISAISAQIAVVPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLI  152

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ AN     G G  Y+I  +T+++A+Y + L+F    I+++TTQ++G+GWAG+ R+YLV
Sbjct  153  TIFANA----GAGSVYAIHIVTVVRAFYMKNLTFFVSFIVIVTTQVLGFGWAGIFRKYLV  208

Query  596  DPVDMWWPSNLAQVSLFXALH  658
            +P  MWWP+NL QVSLF ALH
Sbjct  209  EPAAMWWPANLVQVSLFRALH  229



>gb|AAM64614.1| Isp4-like protein [Arabidopsis thaliana]
Length=729

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            ATA E +       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT
Sbjct  2    ATADEFSDED--TSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRT  59

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  430
            +PL I+ I +Q++ LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN
Sbjct  60   EPLVITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFAN  119

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + G G AY++G ITI+KA+Y +++SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  M
Sbjct  120  AGSAFGSGSAYAVGIITIIKAFYGRSISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHM  179

Query  611  WWPSNLAQVSLFXALH  658
            WWPS L QVSLF ALH
Sbjct  180  WWPSTLVQVSLFRALH  195



>emb|CDP00949.1| unnamed protein product [Coffea canephora]
Length=752

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 141/185 (76%), Gaps = 3/185 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+V L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YR+QPL+I+ I  Q+
Sbjct  33   ESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRSQPLTITMISAQV  92

Query  293  SVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
            + LP+G+FMA  LP++KF    FG   F+LNPGPFN+KEH +I+V AN G S GGG AY+
Sbjct  93   ATLPLGRFMAKVLPKKKFRIPGFGSRQFSLNPGPFNMKEHALISVFANAGSSFGGGTAYA  152

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTT-QLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSL  643
            I  +TI++A+Y + +SFL   I+V TT Q++GYGWAG++RRY+V+P  MWWPS+L QVSL
Sbjct  153  IDIVTIVRAFYHRRISFLASWILVTTTQQVLGYGWAGIMRRYVVEPAHMWWPSSLVQVSL  212

Query  644  FXALH  658
            F ALH
Sbjct  213  FRALH  217



>ref|XP_006304646.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
 gb|EOA37544.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
Length=735

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+
Sbjct  20   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQV  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  80   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++ QVSLF A
Sbjct  139  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRA  198

Query  653  LH  658
            LH
Sbjct  199  LH  200



>ref|XP_010484229.1| PREDICTED: oligopeptide transporter 4 [Camelina sativa]
Length=729

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLF A
Sbjct  134  IITIIKAFYRRDISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRA  193

Query  653  LH  658
            LH
Sbjct  194  LH  195



>ref|XP_010444374.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLF A
Sbjct  134  IITIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRA  193

Query  653  LH  658
            LH
Sbjct  194  LH  195



>ref|XP_008803573.1| PREDICTED: oligopeptide transporter 4-like isoform X3 [Phoenix 
dactylifera]
Length=600

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGR--CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            M+    A   EKTA        P+E+V L VP TD+PTLPV TFR WF+GI SC ++ FL
Sbjct  26   MTATVSAMDVEKTAGGDEEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMSFL  85

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            N FF YRT+PL I+ I +Q++ LP+G F+A  LP  KF    FG   F+LNPGPFN+KEH
Sbjct  86   NQFFSYRTEPLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMKEH  145

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY +G + I++A+YK+ +SF  G I+++TTQ++GYGWAG++R+
Sbjct  146  VLISIFANAGYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLMRK  205

Query  587  YLVDPVDMWWPSNLAQVSLFXALH  658
            Y+V+P  MWWP+ L QVSLF ALH
Sbjct  206  YVVEPAHMWWPTTLVQVSLFRALH  229



>ref|XP_010461766.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLF A
Sbjct  134  IITIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRA  193

Query  653  LH  658
            LH
Sbjct  194  LH  195



>ref|NP_201246.1| oligopeptide transporter 4 [Arabidopsis thaliana]
 sp|Q9FME8.1|OPT4_ARATH RecName: Full=Oligopeptide transporter 4; Short=AtOPT4 [Arabidopsis 
thaliana]
 dbj|BAB09872.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAM20694.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAN15658.1| Isp4-like protein [Arabidopsis thaliana]
 dbj|BAE99084.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AED97890.1| oligopeptide transporter 4 [Arabidopsis thaliana]
Length=729

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            ATA E +       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT
Sbjct  2    ATADEFSDED--TSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRT  59

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  430
            +PL I+ I +Q++ LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN
Sbjct  60   EPLVITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFAN  119

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + G G AY++G ITI+KA+Y +++SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  M
Sbjct  120  AGSAFGSGSAYAVGIITIIKAFYGRSISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHM  179

Query  611  WWPSNLAQVSLFXALH  658
            WWPS L QVSLF ALH
Sbjct  180  WWPSTLVQVSLFRALH  195



>ref|XP_009615073.1| PREDICTED: oligopeptide transporter 4-like [Nicotiana tomentosiformis]
Length=753

 Score =   228 bits (581),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 140/192 (73%), Gaps = 2/192 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+         +EEV L VP TDDPTLPV TFR W LG+ SCI+L FLN FF YR +PL 
Sbjct  15   EEDVNEDELSSIEEVRLTVPNTDDPTLPVWTFRMWILGLLSCILLSFLNQFFSYRKEPLI  74

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  75   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSKEFSLNPGPFNMKEHVLITIFANAGSA  134

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y +++SF    ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS
Sbjct  135  FGNGSAYAVGIVNIIKAFYGRSISFGASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  194

Query  623  NLAQVSLFXALH  658
             L Q+SLF ALH
Sbjct  195  TLVQISLFRALH  206



>ref|XP_004252726.1| PREDICTED: oligopeptide transporter 2-like [Solanum lycopersicum]
Length=731

 Score =   228 bits (580),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 137/180 (76%), Gaps = 5/180 (3%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V   DD +LPV TFR WFLG+ SC IL FLNTFF YRTQPLSIS I +QI+ 
Sbjct  22   PIEQVRLTVSNQDDTSLPVWTFRMWFLGLLSCSILAFLNTFFSYRTQPLSISMITVQIAA  81

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+GK MA  LP RKF   G W F+LNPGPFN+KEHV+I++ ANC    G G AY++  +
Sbjct  82   LPVGKLMAKVLPTRKFK-IGSWEFSLNPGPFNMKEHVLISIFANC----GAGTAYAVSIV  136

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            TI+KA+Y + +SF+ G ++V+TTQ++GYGWAG++R+Y+VDP +MWWP  +  VSLF ALH
Sbjct  137  TIIKAFYLRNISFVAGWVLVVTTQVLGYGWAGIMRKYVVDPAEMWWPGCMVIVSLFRALH  196



>ref|XP_007220230.1| hypothetical protein PRUPE_ppa002014mg [Prunus persica]
 gb|EMJ21429.1| hypothetical protein PRUPE_ppa002014mg [Prunus persica]
Length=729

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+ ++  T G  +      CP+++V L VP+TDDP +PVLTFR W LG+ SCI+L F+N 
Sbjct  1    MAEIHSGTMGA-SEEENDDCPIKQVELTVPKTDDPNMPVLTFRMWVLGLASCILLSFVNQ  59

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQPLSI++I  QI+VLPIG  MA TLP R      R+ FT+NPGPFNIKEHV+IT
Sbjct  60   FFWYRTQPLSITSISAQIAVLPIGHLMARTLPTRLIFKGTRFEFTMNPGPFNIKEHVLIT  119

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   ++ +K +YK+ L+F+  L+++ TTQ++G+GWAG+ RR LVD
Sbjct  120  IFANS----GAGSVYATHILSAVKLFYKRKLTFIPALLVLFTTQVLGFGWAGIFRRILVD  175

Query  599  PVDMWWPSNLAQVSLFXALH  658
            PV MWWPSNL QVSLF ALH
Sbjct  176  PVQMWWPSNLVQVSLFRALH  195



>gb|KHN03544.1| Oligopeptide transporter 3 [Glycine soja]
Length=725

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +2

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G   FT NPGPFN+KEHVIIT+ A
Sbjct  52   FRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLGS-RFTFNPGPFNMKEHVIITIFA  110

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYLVDPV+
Sbjct  111  NCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMMGYGWAGILRRYLVDPVE  170

Query  608  MWWPSNLAQVSLFXALH  658
            MWWP+NLAQVSLF ALH
Sbjct  171  MWWPANLAQVSLFRALH  187



>ref|XP_006289826.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
 gb|EOA22724.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
Length=766

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI
Sbjct  54   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  113

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  114  AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  169

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++KA+Y + ++F    I+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLF A
Sbjct  170  VVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRA  229

Query  653  LH  658
            LH
Sbjct  230  LH  231



>ref|XP_006280078.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
 gb|EOA12976.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
Length=729

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+++P  MWWPS L QVSLF A
Sbjct  134  IITIIKAFYRRNISFIAGWLLIITTQVLGYGWAGLLRKYVIEPAHMWWPSTLVQVSLFRA  193

Query  653  LH  658
            LH
Sbjct  194  LH  195



>ref|XP_006851891.1| hypothetical protein AMTR_s00041p00133990 [Amborella trichopoda]
 gb|ERN13358.1| hypothetical protein AMTR_s00041p00133990 [Amborella trichopoda]
Length=800

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 143/200 (72%), Gaps = 4/200 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M   + +T  E+   S    P+E+VAL VP TDDP+LPV+TFR WFLG  SC+I+ FLN 
Sbjct  68   MDKPSSSTTTEEPNTSPENSPIEQVALTVPVTDDPSLPVITFRMWFLGCLSCVIISFLNQ  127

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF +RT+PL+I+++  QI+V+P+G  MAA LP R F    RW FTLNPGPFN+KEHV+IT
Sbjct  128  FFWFRTEPLTITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLIT  187

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  ++I  ++ +K +YK+ LSF    ++V+TTQ++G+GWAG+ R+YLV+
Sbjct  188  IFANS----GAGSVFAIHIVSSVKVFYKETLSFFVAFLVVITTQVMGFGWAGMFRKYLVE  243

Query  599  PVDMWWPSNLAQVSLFXALH  658
            P  MWWP NL QVS+F ALH
Sbjct  244  PAAMWWPYNLVQVSIFGALH  263



>ref|XP_008234693.1| PREDICTED: oligopeptide transporter 6-like [Prunus mume]
Length=729

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+ ++  T G  +      CP+++V L VP+TDDP +PVLTFR W LG+ SCI+L F+N 
Sbjct  1    MAEIHSGTMGA-SDEENDDCPIKQVELTVPKTDDPNMPVLTFRMWVLGLASCILLSFVNQ  59

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQPLSI++I  QI+VLPIG  MA TLP R      R+ FT+NPGPFNIKEHV+IT
Sbjct  60   FFWYRTQPLSITSISAQIAVLPIGHLMARTLPTRLIFKGTRFEFTMNPGPFNIKEHVLIT  119

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   ++ +K +YK+ L+F+  L+++ TTQ++G+GWAG+ RR LVD
Sbjct  120  IFANS----GAGSVYATHILSAVKLFYKRKLTFIPALLVLFTTQVLGFGWAGIFRRILVD  175

Query  599  PVDMWWPSNLAQVSLFXALH  658
            PV MWWPSNL QVSLF ALH
Sbjct  176  PVQMWWPSNLVQVSLFRALH  195



>ref|XP_008239237.1| PREDICTED: oligopeptide transporter 7 [Prunus mume]
Length=760

 Score =   228 bits (580),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YR +PLSI+AI  QI
Sbjct  49   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRKEPLSITAISAQI  108

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  164

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF A
Sbjct  165  IVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  224

Query  653  LH  658
            LH
Sbjct  225  LH  226



>gb|KCW63396.1| hypothetical protein EUGRSUZ_G01042, partial [Eucalyptus grandis]
Length=720

 Score =   227 bits (579),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 141/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L+V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  5    PIEQVRLIVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAYRTEPLVITQITVQVAT  64

Query  299  LPIGKFMAATLPERKFAPFG--RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMAA LP  +F   G  R +F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  65   LPIGRFMAAVLPTAEFRIPGLRRRTFSLNPGPFNMKEHVLISIFANAGSAFGSGPAYAVG  124

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+KA+Y +++SF  G ++++TTQ++GYGWAG+LR+Y V+P  MWWPS L QVSLF A
Sbjct  125  IVNIIKAFYLRSISFFAGWLLIITTQVLGYGWAGLLRKYAVEPAHMWWPSTLVQVSLFRA  184

Query  653  LH  658
            LH
Sbjct  185  LH  186



>ref|NP_172464.1| oligopeptide transporter 2 [Arabidopsis thaliana]
 sp|O04514.2|OPT2_ARATH RecName: Full=Oligopeptide transporter 2; Short=AtOPT2 [Arabidopsis 
thaliana]
 gb|AEE28515.1| oligopeptide transporter 2 [Arabidopsis thaliana]
Length=734

 Score =   227 bits (579),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+V L V   DDP+LPV TFR WFLG+ SCI+L FLNTFF YRTQPL I+ I +Q+
Sbjct  19   ESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMISVQV  78

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  79   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  137

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++ QVSLF A
Sbjct  138  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRA  197

Query  653  LH  658
            LH
Sbjct  198  LH  199



>gb|ABE65610.1| oligopeptide transporter OPT family protein [Arabidopsis thaliana]
Length=734

 Score =   227 bits (579),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+V L V   DDP+LPV TFR WFLG+ SCI+L FLNTFF YRTQPL I+ I +Q+
Sbjct  19   ESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMISVQV  78

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  79   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  137

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++ QVSLF A
Sbjct  138  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRA  197

Query  653  LH  658
            LH
Sbjct  198  LH  199



>gb|EEE68909.1| hypothetical protein OsJ_27765 [Oryza sativa Japonica Group]
Length=702

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 139/202 (69%), Gaps = 5/202 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
              S  NP +  EKT      CP+EEV L VP TDDP LP LTFR W LG+ SC +L F N
Sbjct  14   HRSSENPESRDEKTEEEVDDCPIEEVRLTVPITDDPALPALTFRTWLLGLISCAMLAFSN  73

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGR-WSFTLNPGPFNIKEHVI  412
             FF YR  PL IS++ +QI VLP+GK MAA LP++ F   G  WSF+LNPGPFN+KEHV+
Sbjct  74   QFFGYRQNPLYISSLSVQIVVLPLGKLMAACLPKKVFRVKGTAWSFSLNPGPFNLKEHVL  133

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            IT+ AN     G    Y++G ITI+KA+Y++ +  L  +++  TTQL+GYGWAG+ R++L
Sbjct  134  ITIFANT----GSNSVYAVGIITIVKAFYRREIHPLAAMLLTQTTQLMGYGWAGLFRKFL  189

Query  593  VDPVDMWWPSNLAQVSLFXALH  658
            VD   MWWPSNL QVSLF ALH
Sbjct  190  VDSPYMWWPSNLVQVSLFRALH  211



>ref|XP_002303684.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
 gb|EEE78663.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
Length=800

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = +2

Query  62   SGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            S     T+    A      PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN F
Sbjct  70   SSSKSQTSEINQAHDEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  129

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  421
            F YRT+PLSI+AI  QI+V+P+G+ MAA + +R F    R  FTLNPGPFN+KEHV+IT+
Sbjct  130  FWYRTEPLSITAISAQIAVVPLGQLMAAKITDRVFFKGTRCEFTLNPGPFNVKEHVLITI  189

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             AN     G G  Y+I  +T++KA+YK+ ++F    I+++TTQ++G+GWAG+ RRYLV+P
Sbjct  190  FANS----GAGSVYAIHIVTVVKAFYKKNITFFVSFIVIITTQVLGFGWAGIFRRYLVEP  245

Query  602  VDMWWPSNLAQVSLFXALH  658
              MWWP+NL QVSLF ALH
Sbjct  246  AAMWWPANLVQVSLFRALH  264



>ref|XP_010065749.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=756

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 143/198 (72%), Gaps = 2/198 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P    +         P+E+V L+V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  25   KPVAPNDVDDAEDDLSPIEQVRLIVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAY  84

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFG--RWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q++ LPIG+FMAA LP  +F   G  R +F+LNPGPFN+KEHV+I++ 
Sbjct  85   RTEPLVITQITVQVATLPIGRFMAAVLPTAEFRIPGLRRRTFSLNPGPFNMKEHVLISIF  144

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++G + I+KA+Y +++SF  G ++++TTQ++GYGWAG+LR+Y V+P 
Sbjct  145  ANAGSAFGSGPAYAVGIVNIIKAFYLRSISFFAGWLLIITTQVLGYGWAGLLRKYAVEPA  204

Query  605  DMWWPSNLAQVSLFXALH  658
             MWWPS L QVSLF ALH
Sbjct  205  HMWWPSTLVQVSLFRALH  222



>ref|XP_010455470.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=767

 Score =   228 bits (580),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI
Sbjct  55   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  114

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  115  AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  170

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T++KA+Y + ++F    I+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLF A
Sbjct  171  VVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRA  230

Query  653  LH  658
            LH
Sbjct  231  LH  232



>ref|XP_003555686.1| PREDICTED: oligopeptide transporter 7 [Glycine max]
Length=749

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YR QPL+I+AI  QI
Sbjct  38   NSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRIQPLTITAISAQI  97

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAAT+ +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMAATITKRVFFRGTRWEFTLNPGPFNVKEHVLITIFAN----SGAGTVYAIH  153

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T +K +Y + +SF   L++V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF A
Sbjct  154  VVTAVKIFYHKHISFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  213

Query  653  LH  658
            LH
Sbjct  214  LH  215



>ref|XP_010520948.1| PREDICTED: oligopeptide transporter 6 [Tarenaya hassleriana]
Length=739

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC VE+V L VP+TDDPTLPVLTFR W LGI +CI+L F+N FF YRT PLSI+ I  QI
Sbjct  20   RCVVEQVELTVPKTDDPTLPVLTFRMWVLGIGACIVLSFVNQFFWYRTMPLSITGISAQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP RK+    RW F++NPGPFN+KEHV+IT+ AN     G G  Y+  
Sbjct  80   AVVPLGHLMARILPTRKYFEGTRWEFSMNPGPFNVKEHVLITIFANS----GAGSVYATH  135

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             ++ +K YYK+AL FL   ++++TTQ++G+GWAG+ R++LV+P +MWWPSNL QVSLF A
Sbjct  136  ILSAIKLYYKRALPFLPAFLVMITTQVLGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFSA  195

Query  653  LH  658
            LH
Sbjct  196  LH  197



>gb|KFK31865.1| hypothetical protein AALP_AA6G168500 [Arabis alpina]
Length=755

 Score =   227 bits (579),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 137/180 (76%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI+V
Sbjct  45   PIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIAV  104

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F     W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  105  VPLGRLMAAKISDRVFLQGSYWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  160

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++KA+Y + ++F   LI+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLF ALH
Sbjct  161  TVVKAFYMKNITFFVSLIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALH  220



>emb|CDY14374.1| BnaA10g06810D [Brassica napus]
Length=709

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 136/190 (72%), Gaps = 4/190 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+      RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL F+N FF YR  PL+
Sbjct  15   EEAVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLAACIILSFVNQFFWYRQMPLT  74

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+ I  QI+V+P+G  MA  LP +K+    RW F +NPGPFNIKEHV+IT+ AN     G
Sbjct  75   ITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNIKEHVMITIFANS----G  130

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG+ R++LV+P +MWWPSNL
Sbjct  131  AGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLVEPGEMWWPSNL  190

Query  629  AQVSLFXALH  658
             QVSLF ALH
Sbjct  191  VQVSLFSALH  200



>ref|XP_002866614.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42873.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
Length=729

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 144/196 (73%), Gaps = 4/196 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            ATA E +       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT
Sbjct  2    ATADEFSDED--TSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRT  59

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  430
            +PL I+ I +Q++ LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN
Sbjct  60   EPLVITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFAN  119

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + G G AY++G ITI+KA+Y + +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  M
Sbjct  120  AGSAFGSGSAYAVGIITIIKAFYGRNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHM  179

Query  611  WWPSNLAQVSLFXALH  658
            WWPS L QVSLF ALH
Sbjct  180  WWPSTLVQVSLFRALH  195



>ref|XP_008237085.1| PREDICTED: oligopeptide transporter 4-like [Prunus mume]
Length=747

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 138/189 (73%), Gaps = 2/189 (1%)
 Frame = +2

Query  98   APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISA  277
            A      P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ 
Sbjct  26   AEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFSYRTEPLIITQ  85

Query  278  ILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            I +Q+S LPIG FMA  LP  KF    FG  SF+LNPGPFNIKEHV++T+ AN G + G 
Sbjct  86   ITVQVSALPIGHFMAKVLPTNKFHIPGFGSRSFSLNPGPFNIKEHVLVTIFANAGSAFGV  145

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G AY++G +TI+K +Y + +S L   ++++TTQ++GYGWAG+LR+Y+V+P  MWWP+ L 
Sbjct  146  GSAYAVGIVTIIKVFYGRKISLLASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPNTLV  205

Query  632  QVSLFXALH  658
            QVSLF ALH
Sbjct  206  QVSLFRALH  214



>gb|EPS60258.1| hypothetical protein M569_14546, partial [Genlisea aurea]
Length=705

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P++EVAL V  +DD ++PVLTFR WFLG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  6    NSPIKEVALTVSTSDDASIPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLSITAISAQI  65

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA LP R F     W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  66   AVVPLGRLMAARLPARVFFRNTGWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  121

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T +K +Y++ ++F   L++V+TTQ++G+GWAG+ RRYLV+P +MWWP+NL QVSLF A
Sbjct  122  VVTAVKVFYRKHINFFVSLVVVITTQVLGFGWAGIFRRYLVEPAEMWWPANLVQVSLFRA  181

Query  653  LH  658
            LH
Sbjct  182  LH  183



>ref|XP_004147543.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
 ref|XP_004170983.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
Length=738

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P +  +  A      P+E+V L V  +DDPTLPV TFR W LG+ SC +L FLN FF YR
Sbjct  8    PLSGSDPAADDDDISPIEQVRLTVTNSDDPTLPVWTFRMWTLGLLSCALLSFLNQFFYYR  67

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMA  427
            T+PL I+ I +Q++ LPIG+FMAA LP  +F    FG   F+LNPGPFN+KEHV+I++ A
Sbjct  68   TEPLIITQITVQVATLPIGQFMAAVLPASRFRLPGFGSRRFSLNPGPFNMKEHVLISIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G + GGG AY++G + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V+P  
Sbjct  128  NAGTAFGGGSAYAVGIVNIIKAFYGRNISFVAAWLLIVTTQVLGYGWAGLLRKYVVEPAH  187

Query  608  MWWPSNLAQVSLFXALH  658
            MWWPS L QVSLF ALH
Sbjct  188  MWWPSTLVQVSLFRALH  204



>gb|KDO76687.1| hypothetical protein CISIN_1g010747mg [Citrus sinensis]
Length=417

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 132/190 (69%), Gaps = 4/190 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E         PV++VAL V   DD  LPVLTFR W LG  SC++L FLN FF YRT+PLS
Sbjct  43   EAVVEEEENSPVKQVALTVSTEDDTCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLS  102

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA L +R F       FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  103  ITAISAQIAVVPLGQLMAAKLTDRVFFKSTPLEFTLNPGPFNVKEHVLITIFANS----G  158

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T++K +YKQ  +F   L++V TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  159  AGSVYAIHIVTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPANL  218

Query  629  AQVSLFXALH  658
             QVSLF ALH
Sbjct  219  VQVSLFRALH  228



>ref|XP_010422002.1| PREDICTED: oligopeptide transporter 7 [Camelina sativa]
Length=769

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 137/180 (76%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI+V
Sbjct  59   PIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIAV  118

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  119  VPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  174

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLF ALH
Sbjct  175  TVVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALH  234



>dbj|BAJ87692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=735

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 141/196 (72%), Gaps = 7/196 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +P   G++ A +     VE+VAL VP  DDP+ PVLTFR W LG  SC+ L FLNTFF Y
Sbjct  43   SPEEVGDREAENSA---VEQVALTVPVGDDPSTPVLTFRMWVLGAASCVALSFLNTFFWY  99

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PL I+AI  Q++V+P+G+ MAA LPER F    RW FTLNPGPF++KEHV+IT+ AN
Sbjct  100  RKEPLEITAISAQVAVVPLGRLMAAALPERAFFRGRRWEFTLNPGPFSVKEHVLITIFAN  159

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  ++I  +T ++ +Y + +SFL  L++VLT+Q++G+GWAG+ RRYLV+P  M
Sbjct  160  A----GAGSVFAINLVTAVRVFYGKPISFLVSLLVVLTSQVVGFGWAGIFRRYLVEPAAM  215

Query  611  WWPSNLAQVSLFXALH  658
            WWPSNL QVSLF ALH
Sbjct  216  WWPSNLVQVSLFRALH  231



>ref|XP_010436760.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=766

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 142/192 (74%), Gaps = 7/192 (4%)
 Frame = +2

Query  83   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  262
            +GE+   +    P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+P
Sbjct  47   SGEEEEENS---PIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEP  103

Query  263  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            L+ISAI  QI+V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN    
Sbjct  104  LTISAISAQIAVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA---  160

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G  Y+I  +T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV+P  MWWP+
Sbjct  161  -GAGSVYAIHVVTVVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLVEPAAMWWPA  219

Query  623  NLAQVSLFXALH  658
            NL QVSLF ALH
Sbjct  220  NLVQVSLFRALH  231



>ref|XP_009601745.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
 ref|XP_009601746.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=732

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P             CP++EV + VP+TDDPT PV+TFR WFLGITSC++L F+N FF YR
Sbjct  5    PVNMAAANEADEDLCPIKEVDMTVPKTDDPTTPVVTFRMWFLGITSCVLLSFVNQFFWYR  64

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  433
            T+PL+IS+  +QI+V+PIG  MA T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN 
Sbjct  65   TEPLTISSTAVQIAVVPIGHLMAKTITKRVFFEGTRWEFTLNPGPFNIKEHVLITIFANA  124

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
                G G  Y+   ++ +K YYK+ LSF   L+I+ TTQ++G+GWAG+ R+ LV+P +MW
Sbjct  125  ----GAGSVYATHILSAVKLYYKRPLSFFPALLIMATTQMLGFGWAGIFRKQLVEPAEMW  180

Query  614  WPSNLAQVSLFXALH  658
            WP +L QVSLF ALH
Sbjct  181  WPGSLVQVSLFRALH  195



>gb|KDO76688.1| hypothetical protein CISIN_1g010747mg [Citrus sinensis]
Length=424

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 132/190 (69%), Gaps = 4/190 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E         PV++VAL V   DD  LPVLTFR W LG  SC++L FLN FF YRT+PLS
Sbjct  43   EAVVEEEENSPVKQVALTVSTEDDTCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLS  102

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA L +R F       FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  103  ITAISAQIAVVPLGQLMAAKLTDRVFFKSTPLEFTLNPGPFNVKEHVLITIFANS----G  158

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T++K +YKQ  +F   L++V TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  159  AGSVYAIHIVTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPANL  218

Query  629  AQVSLFXALH  658
             QVSLF ALH
Sbjct  219  VQVSLFRALH  228



>ref|NP_192815.1| oligopeptide transporter 7 [Arabidopsis thaliana]
 sp|O82485.1|OPT7_ARATH RecName: Full=Oligopeptide transporter 7; Short=AtOPT7 [Arabidopsis 
thaliana]
 gb|AAC35527.1| similar to Schizosaccharomyces pombe isp4 protein (GB:D14061) 
[Arabidopsis thaliana]
 emb|CAB81178.1| putative oligopeptide transporter [Arabidopsis thaliana]
 gb|AAK74026.1| AT4g10770/T12H20_7 [Arabidopsis thaliana]
 gb|AAO42765.1| At4g10770/T12H20_7 [Arabidopsis thaliana]
 gb|AEE82927.1| oligopeptide transporter 7 [Arabidopsis thaliana]
Length=766

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 137/180 (76%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI+V
Sbjct  56   PIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIAV  115

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  116  VPLGRLMAAKITDRVFFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  171

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++KA+Y + ++F    I+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLF ALH
Sbjct  172  TVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALH  231



>ref|XP_009119900.1| PREDICTED: oligopeptide transporter 9 [Brassica rapa]
Length=741

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 136/190 (72%), Gaps = 4/190 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+      RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL F+N FF YR  PL+
Sbjct  15   EEAVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLAACIILSFVNQFFWYRQMPLT  74

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+ I  QI+V+P+G  MA  LP +K+    RW F +NPGPFNIKEHV+IT+ AN     G
Sbjct  75   ITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNIKEHVMITIFANS----G  130

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG+ R++LV+P +MWWPSNL
Sbjct  131  AGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLVEPGEMWWPSNL  190

Query  629  AQVSLFXALH  658
             QVSLF ALH
Sbjct  191  VQVSLFSALH  200



>ref|XP_006655737.1| PREDICTED: oligopeptide transporter 7-like [Oryza brachyantha]
Length=762

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 141/197 (72%), Gaps = 5/197 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            L P+T G +    G   PVE+VAL VP  D+P+ PVLT R W LG  SC++L FLNTFF 
Sbjct  32   LRPST-GPEEVEEGENSPVEQVALTVPVGDEPSAPVLTARTWVLGTASCVVLSFLNTFFW  90

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YR +PL+++AI  QI+V+P+G+ MAA LPER F     W FTLNPGPFN+KEHV+IT+ A
Sbjct  91   YRKEPLTVTAISAQIAVVPLGRLMAAVLPERAFFRGRPWEFTLNPGPFNVKEHVLITIFA  150

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N     G G  ++I  IT ++ +Y + +SF   L++VLT+Q++G+GWAG+ RRYLV+P  
Sbjct  151  NA----GAGSVFAINVITAVRVFYGKRISFFVSLLVVLTSQVLGFGWAGIFRRYLVEPAA  206

Query  608  MWWPSNLAQVSLFXALH  658
            MWWPSNL QVSLF ALH
Sbjct  207  MWWPSNLVQVSLFRALH  223



>gb|EMT31419.1| Oligopeptide transporter 7 [Aegilops tauschii]
Length=218

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 137/199 (69%), Gaps = 7/199 (4%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGG---RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+ ++P      T+P        P+E+VAL VP  DDP  P+LTFR W LG+ S  +L F
Sbjct  1    MATVSPRRTLPSTSPDEEEEENSPIEQVALTVPVGDDPDTPLLTFRMWVLGMASRAVLSF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LN FF YR +PL+I+AI  QI+V+P+G+ MAA LPER F     + FTLNPGPFN+KEHV
Sbjct  61   LNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGRPYEFTLNPGPFNVKEHV  120

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            +IT+ AN     G G  Y+I  +T ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRY
Sbjct  121  LITIFANA----GAGTVYAIHVVTAVRVFYGKNLTFFASLLVVLTTQVLGFGWAGIFRRY  176

Query  590  LVDPVDMWWPSNLAQVSLF  646
            LV+P  MWWPSNL QVSLF
Sbjct  177  LVEPAAMWWPSNLVQVSLF  195



>ref|XP_009128701.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Brassica rapa]
Length=760

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 135/180 (75%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ EVAL VP TDD +LPVLTFR WFLG  SCI+L FLN FF YR +PL ISAI  QI+V
Sbjct  52   PIREVALTVPTTDDHSLPVLTFRMWFLGSISCILLSFLNQFFWYRREPLVISAISAQIAV  111

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  I
Sbjct  112  VPLGRLMAAKITDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHII  167

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T++KAYY + ++F    I+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLF ALH
Sbjct  168  TVVKAYYMKNMTFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALH  227



>gb|KJB58808.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = +2

Query  35   LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  214
            L+E +V E   ++ +             P+E+V L VP+TDDP+LPV TFR WFLG+ SC
Sbjct  12   LAEEVVKEEGEMDESEVS----------PIEQVRLTVPDTDDPSLPVWTFRMWFLGLFSC  61

Query  215  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGP  388
             +L FLN FF YRT+PL I+ I +Q++ LPIG+FMA+ LP  KF    FG   F+LNPGP
Sbjct  62   ALLSFLNQFFGYRTEPLVITQITVQVATLPIGRFMASALPATKFRIPGFGSKEFSLNPGP  121

Query  389  FNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGW  568
            FN+KEHV+IT+ AN G   G G  Y++  +TI+KA+Y +++SF    ++++TTQ++GYGW
Sbjct  122  FNMKEHVLITIFANAGSGFGNGTVYAVSIVTIIKAFYGRSISFFSSWLLIMTTQVMGYGW  181

Query  569  AGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            AG+LR+Y+V+P  MWWPS L Q+SLF  LH
Sbjct  182  AGILRKYVVEPAHMWWPSTLVQISLFTTLH  211



>gb|KJB58807.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = +2

Query  35   LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  214
            L+E +V E   ++ +             P+E+V L VP+TDDP+LPV TFR WFLG+ SC
Sbjct  12   LAEEVVKEEGEMDESEVS----------PIEQVRLTVPDTDDPSLPVWTFRMWFLGLFSC  61

Query  215  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGP  388
             +L FLN FF YRT+PL I+ I +Q++ LPIG+FMA+ LP  KF    FG   F+LNPGP
Sbjct  62   ALLSFLNQFFGYRTEPLVITQITVQVATLPIGRFMASALPATKFRIPGFGSKEFSLNPGP  121

Query  389  FNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGW  568
            FN+KEHV+IT+ AN G   G G  Y++  +TI+KA+Y +++SF    ++++TTQ++GYGW
Sbjct  122  FNMKEHVLITIFANAGSGFGNGTVYAVSIVTIIKAFYGRSISFFSSWLLIMTTQVMGYGW  181

Query  569  AGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            AG+LR+Y+V+P  MWWPS L Q+SLF  LH
Sbjct  182  AGILRKYVVEPAHMWWPSTLVQISLFTTLH  211



>gb|KFK26970.1| hypothetical protein AALP_AA8G317000 [Arabis alpina]
Length=742

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 143/208 (69%), Gaps = 7/208 (3%)
 Frame = +2

Query  35   LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  214
            ++  IV E +G   A   E       +C VEEV L VP+TDDPTLPVLTFR W LG+ +C
Sbjct  1    MAHEIVEESTG---AMNIEGVVEELDQCVVEEVELTVPKTDDPTLPVLTFRMWVLGLGAC  57

Query  215  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFN  394
            IIL F+N FF YR  PL+I+ I  QI+V+P+G  MA  LP RKF    RW F LNPGPFN
Sbjct  58   IILSFVNQFFWYRQMPLTITGISAQIAVVPLGHLMARLLPTRKFLEGSRWEFCLNPGPFN  117

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  574
            IKEHV+IT+ AN     G G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG
Sbjct  118  IKEHVMITIFANS----GAGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAG  173

Query  575  VLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            + R++LV+P +MWWPSNL QVSLF ALH
Sbjct  174  LFRKHLVEPGEMWWPSNLVQVSLFSALH  201



>ref|XP_002283674.1| PREDICTED: oligopeptide transporter 4-like [Vitis vinifera]
Length=754

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 141/204 (69%), Gaps = 2/204 (1%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            VE+      T            P+EEV L VP  DD +L V TFR WFLG+ SC +L FL
Sbjct  4    VEIEAPRVNTLENGNINEDEESPIEEVRLTVPNDDDSSLSVWTFRMWFLGVLSCTLLSFL  63

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            N FF YR +PL I+ I +Q++ LPIG+FMAA LPE KF    FG+  F+ NPGPFN+KEH
Sbjct  64   NQFFSYRREPLVITQITVQVATLPIGRFMAAVLPETKFHIPGFGKREFSFNPGPFNMKEH  123

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY++G +TI+KA+Y  ++SFL G ++++TTQ++GYGWAG+LR+
Sbjct  124  VLISIFANAGSAFGNGSAYAVGIVTIIKAFYNSSISFLAGWLLIVTTQVLGYGWAGLLRK  183

Query  587  YLVDPVDMWWPSNLAQVSLFXALH  658
            Y+V+P  MWWP  L Q++LF  LH
Sbjct  184  YVVEPAHMWWPGTLVQIALFRTLH  207



>gb|KHG27446.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=755

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 150/220 (68%), Gaps = 14/220 (6%)
 Frame = +2

Query  5    KLSQTVPAQ*LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTF  184
            ++  TVP   L+E +V E   ++               P+E+V L VP TDDP+LPV TF
Sbjct  5    EIEATVPK--LAEEVVKEEGEMDEIEV----------SPIEQVRLTVPNTDDPSLPVWTF  52

Query  185  RAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFG  358
            R WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ LPIG+FMA+ LP  KF    FG
Sbjct  53   RMWFLGLFSCALLSFLNQFFGYRTEPLVITQITVQVATLPIGRFMASALPATKFRIPGFG  112

Query  359  RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIV  538
               F+LNPGPFN+KEHV+IT+ AN G   G G  Y++  +TI+KA+Y +++SF    +++
Sbjct  113  SKEFSLNPGPFNMKEHVLITIFANAGSGFGNGTVYAVSIVTIIKAFYGRSISFFSSWLLI  172

Query  539  LTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            +TTQ++GYGWAG+LR+Y+V+P  MWWPS L Q+SLF  LH
Sbjct  173  MTTQVMGYGWAGILRKYVVEPAHMWWPSTLVQISLFTTLH  212



>ref|XP_010267482.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=766

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 136/180 (76%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+++VAL VP TDD TLPVLTFR W LG  SCI+L FLN FF YRT+PL+I+AI  QI+V
Sbjct  53   PIKQVALTVPTTDDHTLPVLTFRMWVLGTVSCILLSFLNQFFWYRTEPLTITAISAQIAV  112

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  113  VPLGRLMASMITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  168

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXALH  658
            T +K +YK+ ++F   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF ALH
Sbjct  169  TAVKIFYKKNITFFVSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  228



>ref|XP_010029951.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56909.1| hypothetical protein EUGRSUZ_I02585 [Eucalyptus grandis]
Length=746

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 138/192 (72%), Gaps = 2/192 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            + T       P+EEV L V   DDP+LPV TFR WFLG+ SC +L FLN FF YRT+PL 
Sbjct  21   DGTVDKDDLSPIEEVRLTVSNADDPSLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLV  80

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q++ LPIG+FMAA LPE KF     G   F+LNPGPFN+KEHV+I++ AN G +
Sbjct  81   ITQITVQVATLPIGRFMAAALPEAKFQIPGLGPRLFSLNPGPFNMKEHVLISIFANAGSA  140

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY +G + I+KA+Y + +SF  G ++++TTQ++GYGWAG+LR+Y+V+P  MWWP 
Sbjct  141  FGSGSAYGVGIVNIIKAFYHRGISFFAGWLLIITTQVLGYGWAGLLRKYVVEPSHMWWPG  200

Query  623  NLAQVSLFXALH  658
             L QVSLF ALH
Sbjct  201  TLVQVSLFRALH  212



>gb|KJB40152.1| hypothetical protein B456_007G049100 [Gossypium raimondii]
Length=623

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 135/182 (74%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
             CP+E+VAL VP  DDP+LP LTFR W LG  +C++L FLN FF YR +PLSIS+I  QI
Sbjct  39   NCPIEQVALTVPTADDPSLPTLTFRTWILGTLACLLLSFLNQFFWYRREPLSISSISAQI  98

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  +AAT+ +R F    ++ FTLNPGPFN+KEHV++T+  N     G G+ Y+I 
Sbjct  99   AVVPLGHLLAATVTDRVFFKDRKFEFTLNPGPFNVKEHVLVTIFGNS----GAGNVYAIH  154

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T +K +YK+ +SFL  L++V TTQ++G+GWAG+ RRYLV+P  MWWP NL QVSLF A
Sbjct  155  LVTAVKIFYKKRMSFLVALLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRA  214

Query  653  LH  658
            LH
Sbjct  215  LH  216



>ref|XP_006376657.1| hypothetical protein POPTR_0012s02650g [Populus trichocarpa]
 gb|ERP54454.1| hypothetical protein POPTR_0012s02650g [Populus trichocarpa]
Length=732

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
             C +++V L VP+TDDPT+PVLTFR W LG+ SCIIL F+N FF YR+QPL++++I  QI
Sbjct  18   ECSIKQVDLTVPKTDDPTMPVLTFRMWVLGLGSCIILSFVNQFFWYRSQPLTVTSISAQI  77

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  L  RKF    RW FTLNPGPFNIKEHV+IT+ AN     G G  Y+  
Sbjct  78   AVVPLGHLMAKKLSTRKFFEGTRWEFTLNPGPFNIKEHVLITIFANS----GAGTVYAAH  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFXA  652
             +T +K YY++ L+F+  L I++TTQ++G+GWAG+ R+YLV+P +MWWPSNL QVSLF A
Sbjct  134  ILTSVKIYYQRKLTFIPALFIMITTQMLGFGWAGIFRKYLVEPGEMWWPSNLVQVSLFRA  193

Query  653  LH  658
            LH
Sbjct  194  LH  195



>ref|NP_001062118.1| Os08g0492000 [Oryza sativa Japonica Group]
 dbj|BAD09683.1| putative glutathione transporter [Oryza sativa Japonica Group]
 dbj|BAD10005.1| putative glutathione transporter [Oryza sativa Japonica Group]
 dbj|BAF24032.1| Os08g0492000 [Oryza sativa Japonica Group]
 gb|EEC83792.1| hypothetical protein OsI_29707 [Oryza sativa Indica Group]
Length=752

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 139/202 (69%), Gaps = 5/202 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
              S  NP +  EKT      CP+EEV L VP TDDP LP LTFR W LG+ SC +L F N
Sbjct  14   HRSSENPESRDEKTEEEVDDCPIEEVRLTVPITDDPALPALTFRTWLLGLISCAMLAFSN  73

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGR-WSFTLNPGPFNIKEHVI  412
             FF YR  PL IS++ +QI VLP+GK MAA LP++ F   G  WSF+LNPGPFN+KEHV+
Sbjct  74   QFFGYRQNPLYISSLSVQIVVLPLGKLMAACLPKKVFRVKGTAWSFSLNPGPFNLKEHVL  133

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            IT+ AN     G    Y++G ITI+KA+Y++ +  L  +++  TTQL+GYGWAG+ R++L
Sbjct  134  ITIFANT----GSNSVYAVGIITIVKAFYRREIHPLAAMLLTQTTQLMGYGWAGLFRKFL  189

Query  593  VDPVDMWWPSNLAQVSLFXALH  658
            VD   MWWPSNL QVSLF ALH
Sbjct  190  VDSPYMWWPSNLVQVSLFRALH  211



>ref|XP_011043664.1| PREDICTED: oligopeptide transporter 9-like [Populus euphratica]
Length=731

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+G N   A E        CPV++V L V +TDDPTLPVLTFR W LG+ SC++L F+N 
Sbjct  1    MAGANEVQAMEIEDEE--ECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQ  58

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQP+ IS+I  QI+V+P+G  MA  L  RKF     W FT+NPGPFNIKEHV+IT
Sbjct  59   FFWYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLIT  118

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   +T +K YYK+ L+F+  L +++TTQ++G+GWAG+ RRYLV+
Sbjct  119  IFANS----GAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRRYLVE  174

Query  599  PVDMWWPSNLAQVSLFXALH  658
            P +MWWPSNL QVSLF ALH
Sbjct  175  PGEMWWPSNLVQVSLFRALH  194



>ref|XP_011022429.1| PREDICTED: oligopeptide transporter 7-like [Populus euphratica]
Length=760

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = +2

Query  62   SGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            S     T+    A      PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN F
Sbjct  30   SSSKSQTSEINQAHDEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQF  89

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  421
            F YRT+PLSI+AI  QI+V+P+G+ MAA + +R F    R  FTLNPGPFN+KEHV+IT+
Sbjct  90   FWYRTEPLSITAISAQIAVVPLGQLMAAKITDRVFFKGTRCEFTLNPGPFNVKEHVLITI  149

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             AN     G G  Y+I  +T++KA+YK+ ++     I+++TTQ++G+GWAG+ RRYLV+P
Sbjct  150  FAN----SGAGSVYAIHIVTVVKAFYKKNITLFVSFIVIITTQVLGFGWAGIFRRYLVEP  205

Query  602  VDMWWPSNLAQVSLFXALH  658
              MWWP+NL QVSLF ALH
Sbjct  206  AAMWWPANLVQVSLFRALH  224



>gb|EEC79904.1| hypothetical protein OsI_21444 [Oryza sativa Indica Group]
 gb|EEE65007.1| hypothetical protein OsJ_19952 [Oryza sativa Japonica Group]
Length=758

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 139/198 (70%), Gaps = 5/198 (3%)
 Frame = +2

Query  68   LNPATA-GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFF  244
            L P+T+ G          P+E+VAL VP +D+P  PVLTFR W LG  SC +L FLN FF
Sbjct  27   LRPSTSRGSPELEEEENSPIEQVALTVPVSDEPETPVLTFRMWVLGTASCAVLSFLNQFF  86

Query  245  IYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVM  424
             YR +PL+I+AI  QI+V+P+G+ MAA LPER F     W FTLNPGPFN+KEHV+IT+ 
Sbjct  87   WYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGRPWEFTLNPGPFNVKEHVLITIF  146

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN     G G  Y+I  IT ++ +Y + +SF   L++VLTTQ++G+GWAG+ RRYLV+P 
Sbjct  147  ANS----GAGTVYAIHVITAVRVFYGKHISFFVSLLVVLTTQVLGFGWAGIFRRYLVEPA  202

Query  605  DMWWPSNLAQVSLFXALH  658
             MWWPSNL QVSLF ALH
Sbjct  203  AMWWPSNLVQVSLFRALH  220



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500