BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF026P24

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010087805.1|  Mitochondrial outer membrane protein porin o...    355   4e-120   Morus notabilis
ref|NP_001275154.1|  mitochondrial outer membrane protein porin o...    353   3e-119   Solanum tuberosum [potatoes]
ref|XP_004233349.1|  PREDICTED: mitochondrial outer membrane prot...    352   3e-119   Solanum lycopersicum
ref|XP_008443436.1|  PREDICTED: mitochondrial outer membrane prot...    351   8e-119   Cucumis melo [Oriental melon]
ref|XP_009587690.1|  PREDICTED: mitochondrial outer membrane prot...    350   4e-118   Nicotiana tomentosiformis
ref|XP_009798894.1|  PREDICTED: mitochondrial outer membrane prot...    349   5e-118   Nicotiana sylvestris
ref|XP_007215668.1|  hypothetical protein PRUPE_ppa008585mg             351   6e-118   
ref|XP_004147460.1|  PREDICTED: mitochondrial outer membrane prot...    349   6e-118   
gb|AAB38498.1|  porin                                                   348   2e-117   Mesembryanthemum crystallinum
ref|XP_010029375.1|  PREDICTED: mitochondrial outer membrane prot...    346   1e-116   Eucalyptus grandis [rose gum]
emb|CDP02196.1|  unnamed protein product                                346   1e-116   Coffea canephora [robusta coffee]
ref|XP_007032450.1|  Voltage dependent anion channel 1                  345   2e-116   
ref|XP_006431074.1|  hypothetical protein CICLE_v10012445mg             344   7e-116   Citrus clementina [clementine]
ref|XP_006482536.1|  PREDICTED: mitochondrial outer membrane prot...    344   7e-116   Citrus sinensis [apfelsine]
gb|KJB33661.1|  hypothetical protein B456_006G024700                    343   2e-115   Gossypium raimondii
ref|XP_006361834.1|  PREDICTED: uncharacterized LOC102577832            343   2e-115   Solanum tuberosum [potatoes]
gb|ABC01904.1|  34 kDa outer mitochondrial membrane protein porin...    343   2e-115   Solanum tuberosum [potatoes]
ref|XP_011098570.1|  PREDICTED: mitochondrial outer membrane prot...    342   3e-115   Sesamum indicum [beniseed]
ref|XP_008379329.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    342   5e-115   Malus domestica [apple tree]
dbj|BAF95070.1|  voltage-dependent anion channel                        342   5e-115   Nicotiana tabacum [American tobacco]
ref|XP_009596455.1|  PREDICTED: mitochondrial outer membrane prot...    342   5e-115   Nicotiana tomentosiformis
ref|XP_009779190.1|  PREDICTED: mitochondrial outer membrane prot...    342   5e-115   Nicotiana sylvestris
emb|CDP00287.1|  unnamed protein product                                342   6e-115   Coffea canephora [robusta coffee]
gb|KHG03636.1|  Mitochondrial outer membrane porin of 34 kDa            342   6e-115   Gossypium arboreum [tree cotton]
ref|XP_010524325.1|  PREDICTED: mitochondrial outer membrane prot...    341   1e-114   Tarenaya hassleriana [spider flower]
gb|AIL25718.1|  voltage-dependent anion channel                         340   2e-114   Nicotiana tabacum [American tobacco]
ref|XP_008230727.1|  PREDICTED: mitochondrial outer membrane prot...    338   1e-113   Prunus mume [ume]
gb|AAQ87020.1|  VDAC1.2                                                 338   1e-113   Lotus japonicus
ref|XP_010550070.1|  PREDICTED: mitochondrial outer membrane prot...    337   3e-113   Tarenaya hassleriana [spider flower]
ref|XP_004234781.2|  PREDICTED: mitochondrial outer membrane prot...    337   3e-113   Solanum lycopersicum
gb|AAY82249.1|  mitochrondrial voltage-dependent anion-selective ...    336   7e-113   Phaseolus coccineus [scarlet runner bean]
ref|XP_003543710.1|  PREDICTED: outer plastidial membrane protein...    336   9e-113   Glycine max [soybeans]
ref|XP_003554316.1|  PREDICTED: mitochondrial outer membrane prot...    335   1e-112   Glycine max [soybeans]
gb|KHN13242.1|  Outer plastidial membrane protein porin                 335   1e-112   Glycine soja [wild soybean]
ref|XP_007139603.1|  hypothetical protein PHAVU_008G043800g             335   2e-112   Phaseolus vulgaris [French bean]
emb|CBI32017.3|  unnamed protein product                                334   2e-112   Vitis vinifera
ref|XP_002276636.1|  PREDICTED: mitochondrial outer membrane prot...    335   2e-112   Vitis vinifera
ref|XP_011010796.1|  PREDICTED: mitochondrial outer membrane prot...    335   2e-112   Populus euphratica
ref|XP_002520135.1|  voltage-dependent anion-selective channel, p...    335   4e-112   Ricinus communis
gb|AFK40985.1|  unknown                                                 334   4e-112   Lotus japonicus
ref|XP_008341536.1|  PREDICTED: outer plastidial membrane protein...    334   4e-112   Malus domestica [apple tree]
ref|XP_010242364.1|  PREDICTED: mitochondrial outer membrane prot...    334   5e-112   Nelumbo nucifera [Indian lotus]
ref|XP_011085779.1|  PREDICTED: mitochondrial outer membrane prot...    334   6e-112   Sesamum indicum [beniseed]
ref|XP_010066951.1|  PREDICTED: mitochondrial outer membrane prot...    333   8e-112   Eucalyptus grandis [rose gum]
ref|XP_010256458.1|  PREDICTED: mitochondrial outer membrane prot...    333   1e-111   Nelumbo nucifera [Indian lotus]
ref|XP_011085778.1|  PREDICTED: mitochondrial outer membrane prot...    333   2e-111   Sesamum indicum [beniseed]
ref|XP_002282471.1|  PREDICTED: mitochondrial outer membrane prot...    332   2e-111   Vitis vinifera
ref|NP_001238377.1|  peroxisomal voltage-dependent anion-selectiv...    332   2e-111   Glycine max [soybeans]
ref|XP_006378154.1|  porin family protein                               332   4e-111   Populus trichocarpa [western balsam poplar]
gb|EYU34113.1|  hypothetical protein MIMGU_mgv1a011597mg                332   5e-111   Erythranthe guttata [common monkey flower]
ref|XP_003552508.1|  PREDICTED: outer plastidial membrane protein...    332   5e-111   Glycine max [soybeans]
ref|XP_002312708.1|  porin family protein                               332   5e-111   Populus trichocarpa [western balsam poplar]
ref|XP_011034213.1|  PREDICTED: mitochondrial outer membrane prot...    332   6e-111   Populus euphratica
gb|KJB11402.1|  hypothetical protein B456_001G256800                    331   7e-111   Gossypium raimondii
gb|KHN11584.1|  Outer plastidial membrane protein porin                 331   7e-111   Glycine soja [wild soybean]
gb|ACU20122.1|  unknown                                                 331   8e-111   Glycine max [soybeans]
emb|CAJ42303.1|  VDAC-like porin                                        330   1e-110   Plantago major [cart-track plant]
gb|EPS57816.1|  hypothetical protein M569_17001                         330   2e-110   Genlisea aurea
gb|ACU24178.1|  unknown                                                 330   3e-110   Glycine max [soybeans]
emb|CDP00288.1|  unnamed protein product                                330   3e-110   Coffea canephora [robusta coffee]
gb|AAQ87019.1|  VDAC1.1                                                 328   1e-109   Lotus japonicus
ref|XP_010096343.1|  Mitochondrial outer membrane protein porin o...    328   2e-109   Morus notabilis
ref|XP_009772199.1|  PREDICTED: mitochondrial outer membrane prot...    327   3e-109   Nicotiana sylvestris
ref|XP_010683253.1|  PREDICTED: mitochondrial outer membrane prot...    327   3e-109   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB11404.1|  hypothetical protein B456_001G256800                    325   2e-108   Gossypium raimondii
gb|AFK39621.1|  unknown                                                 325   2e-108   Lotus japonicus
gb|AAA96275.1|  voltage-dependent anion channel protein                 324   4e-108   Spinacia oleracea
gb|KDP45473.1|  hypothetical protein JCGZ_09722                         324   4e-108   Jatropha curcas
ref|XP_006438620.1|  hypothetical protein CICLE_v10032366mg             324   4e-108   Citrus clementina [clementine]
ref|XP_009627246.1|  PREDICTED: mitochondrial outer membrane prot...    324   5e-108   Nicotiana tomentosiformis
ref|XP_006483230.1|  PREDICTED: mitochondrial outer membrane prot...    323   2e-107   Citrus sinensis [apfelsine]
ref|XP_004228386.1|  PREDICTED: mitochondrial outer membrane prot...    322   2e-107   Solanum lycopersicum
ref|XP_009797869.1|  PREDICTED: mitochondrial outer membrane prot...    322   3e-107   Nicotiana sylvestris
ref|NP_001275134.1|  mitochondrial outer membrane protein porin o...    322   3e-107   Solanum tuberosum [potatoes]
gb|KDP21225.1|  hypothetical protein JCGZ_21696                         322   3e-107   Jatropha curcas
ref|XP_008221678.1|  PREDICTED: mitochondrial outer membrane prot...    322   3e-107   Prunus mume [ume]
gb|KHG10147.1|  Mitochondrial outer membrane porin of 34 kDa            322   4e-107   Gossypium arboreum [tree cotton]
ref|XP_009360395.1|  PREDICTED: mitochondrial outer membrane prot...    322   4e-107   Pyrus x bretschneideri [bai li]
ref|XP_008389525.1|  PREDICTED: mitochondrial outer membrane prot...    322   5e-107   Malus domestica [apple tree]
ref|XP_008339931.1|  PREDICTED: mitochondrial outer membrane prot...    322   5e-107   
ref|XP_008456460.1|  PREDICTED: mitochondrial outer membrane prot...    321   7e-107   Cucumis melo [Oriental melon]
ref|XP_010670319.1|  PREDICTED: mitochondrial outer membrane prot...    321   8e-107   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA56601.1|  36kDa porin I                                          320   1e-106   Solanum tuberosum [potatoes]
sp|P42054.2|VDAC_PEA  RecName: Full=Outer plastidial membrane pro...    320   2e-106   Pisum sativum [garden pea]
gb|AAD38145.1|AF139498_1  porin                                         320   2e-106   Prunus armeniaca
gb|AID59897.1|  voltage-dependent anion channel protein                 320   2e-106   Prunus persica
ref|XP_010033217.1|  PREDICTED: mitochondrial outer membrane prot...    320   2e-106   Eucalyptus grandis [rose gum]
gb|KJB11403.1|  hypothetical protein B456_001G256800                    320   2e-106   Gossypium raimondii
ref|XP_004146750.1|  PREDICTED: mitochondrial outer membrane prot...    319   3e-106   Cucumis sativus [cucumbers]
gb|EYU34669.1|  hypothetical protein MIMGU_mgv1a011608mg                319   4e-106   Erythranthe guttata [common monkey flower]
ref|XP_004302356.1|  PREDICTED: mitochondrial outer membrane prot...    319   5e-106   Fragaria vesca subsp. vesca
gb|KJB50696.1|  hypothetical protein B456_008G182700                    319   5e-106   Gossypium raimondii
ref|XP_007222361.1|  hypothetical protein PRUPE_ppa008111mg             320   1e-105   
ref|XP_009599229.1|  PREDICTED: mitochondrial outer membrane prot...    317   2e-105   Nicotiana tomentosiformis
gb|KGN47800.1|  hypothetical protein Csa_6G404150                       319   4e-105   Cucumis sativus [cucumbers]
ref|XP_007046221.1|  Voltage dependent anion channel 1 isoform 1        317   4e-105   Theobroma cacao [chocolate]
ref|XP_002324035.1|  hypothetical protein POPTR_0017s11430g             317   4e-105   Populus trichocarpa [western balsam poplar]
ref|XP_002517470.1|  voltage-dependent anion-selective channel, p...    316   5e-105   Ricinus communis
gb|KHG13762.1|  Mitochondrial outer membrane porin of 36 kDa            316   6e-105   Gossypium arboreum [tree cotton]
ref|XP_003532049.1|  PREDICTED: mitochondrial outer membrane prot...    315   2e-104   Glycine max [soybeans]
ref|XP_011005064.1|  PREDICTED: mitochondrial outer membrane prot...    314   3e-104   Populus euphratica
gb|AAQ87021.1|  VDAC1.3                                                 314   3e-104   Lotus japonicus
gb|KJB30018.1|  hypothetical protein B456_005G139100                    314   4e-104   Gossypium raimondii
emb|CDY28690.1|  BnaCnng05760D                                          314   5e-104   Brassica napus [oilseed rape]
ref|XP_006408480.1|  hypothetical protein EUTSA_v10021076mg             315   8e-104   
ref|XP_009131920.1|  PREDICTED: mitochondrial outer membrane prot...    313   1e-103   Brassica rapa
ref|NP_001241054.1|  uncharacterized protein LOC100805016               313   1e-103   Glycine max [soybeans]
gb|ACU19720.1|  unknown                                                 311   3e-103   Glycine max [soybeans]
emb|CDY66736.1|  BnaCnng52100D                                          312   3e-103   Brassica napus [oilseed rape]
gb|AAW22621.1|  outer mitochondrial membrane protein porin 1            312   3e-103   Brassica napus [oilseed rape]
ref|XP_007153842.1|  hypothetical protein PHAVU_003G069300g             311   5e-103   Phaseolus vulgaris [French bean]
ref|XP_009125035.1|  PREDICTED: mitochondrial outer membrane prot...    311   5e-103   Brassica rapa
gb|KHG20441.1|  Mitochondrial outer membrane porin of 36 kDa            311   6e-103   Gossypium arboreum [tree cotton]
gb|KFK37589.1|  hypothetical protein AALP_AA3G002700                    311   6e-103   Arabis alpina [alpine rockcress]
gb|EYU22439.1|  hypothetical protein MIMGU_mgv1a011543mg                311   6e-103   Erythranthe guttata [common monkey flower]
ref|XP_006298185.1|  hypothetical protein CARUB_v10014234mg             311   1e-102   
ref|XP_004489166.1|  PREDICTED: outer plastidial membrane protein...    310   1e-102   Cicer arietinum [garbanzo]
ref|XP_011086392.1|  PREDICTED: mitochondrial outer membrane prot...    310   2e-102   Sesamum indicum [beniseed]
gb|KJB60739.1|  hypothetical protein B456_009G323300                    309   3e-102   Gossypium raimondii
emb|CDX91952.1|  BnaC03g32540D                                          309   3e-102   
ref|XP_004297335.1|  PREDICTED: mitochondrial outer membrane prot...    309   3e-102   Fragaria vesca subsp. vesca
ref|XP_002884286.1|  hypothetical protein ARALYDRAFT_477400             309   3e-102   
gb|KJB60742.1|  hypothetical protein B456_009G323300                    306   7e-102   Gossypium raimondii
ref|XP_009147408.1|  PREDICTED: mitochondrial outer membrane prot...    307   2e-101   Brassica rapa
ref|XP_011071026.1|  PREDICTED: mitochondrial outer membrane prot...    307   2e-101   Sesamum indicum [beniseed]
emb|CDY68122.1|  BnaA05g37480D                                          306   3e-101   Brassica napus [oilseed rape]
gb|KHG01383.1|  Mitochondrial outer membrane porin of 36 kDa            306   6e-101   Gossypium arboreum [tree cotton]
ref|XP_004489372.1|  PREDICTED: outer plastidial membrane protein...    306   7e-101   Cicer arietinum [garbanzo]
ref|NP_186777.1|  voltage dependent anion channel 1                     306   7e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65525.1|  putative porin                                          306   8e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDY63765.1|  BnaCnng42590D                                          305   8e-101   Brassica napus [oilseed rape]
emb|CDX85566.1|  BnaA02g02470D                                          305   9e-101   
ref|XP_009134621.1|  PREDICTED: mitochondrial outer membrane prot...    305   9e-101   Brassica rapa
ref|XP_006842115.1|  hypothetical protein AMTR_s00078p00100600          305   9e-101   Amborella trichopoda
ref|NP_001288964.1|  mitochondrial outer membrane protein porin 3       305   1e-100   Brassica rapa
gb|KHN45480.1|  Mitochondrial outer membrane protein porin of 34 kDa    305   1e-100   Glycine soja [wild soybean]
emb|CDY59668.1|  BnaCnng35410D                                          305   2e-100   Brassica napus [oilseed rape]
gb|AAS48868.1|  voltage-dependent anion-selective channel               304   3e-100   Brassica rapa subsp. pekinensis [bai cai]
emb|CDX74294.1|  BnaA03g27530D                                          303   6e-100   
ref|XP_010512938.1|  PREDICTED: mitochondrial outer membrane prot...    303   8e-100   Camelina sativa [gold-of-pleasure]
ref|NP_001288856.1|  mitochondrial outer membrane protein porin 3...    302   2e-99    Brassica rapa
ref|XP_010485517.1|  PREDICTED: mitochondrial outer membrane prot...    302   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_006400027.1|  hypothetical protein EUTSA_v10014354mg             302   2e-99    Eutrema salsugineum [saltwater cress]
gb|AFK34190.1|  unknown                                                 302   2e-99    Medicago truncatula
gb|AFK37646.1|  unknown                                                 298   4e-99    Lotus japonicus
ref|XP_010463547.1|  PREDICTED: mitochondrial outer membrane prot...    300   9e-99    Camelina sativa [gold-of-pleasure]
dbj|BAG09387.1|  peroxisomal voltage-dependent anion-selective ch...    296   2e-98    Glycine max [soybeans]
gb|KHG07129.1|  Mitochondrial outer membrane protein porin of 34 kDa    302   2e-98    Gossypium arboreum [tree cotton]
ref|XP_010492333.1|  PREDICTED: mitochondrial outer membrane prot...    298   1e-97    Camelina sativa [gold-of-pleasure]
gb|EYU28705.1|  hypothetical protein MIMGU_mgv1a011554mg                296   3e-97    Erythranthe guttata [common monkey flower]
ref|XP_004514771.1|  PREDICTED: mitochondrial outer membrane prot...    296   4e-97    Cicer arietinum [garbanzo]
ref|XP_010932447.1|  PREDICTED: mitochondrial outer membrane prot...    296   5e-97    Elaeis guineensis
emb|CAN67632.1|  hypothetical protein VITISV_019646                     292   6e-97    Vitis vinifera
pir||B55017  porin, plastid - garden pea                                295   7e-97 
ref|XP_010453637.1|  PREDICTED: mitochondrial outer membrane prot...    295   1e-96    Camelina sativa [gold-of-pleasure]
gb|KFK25745.1|  hypothetical protein AALP_AA8G154100                    295   2e-96    Arabis alpina [alpine rockcress]
ref|XP_009410756.1|  PREDICTED: mitochondrial outer membrane prot...    294   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010420161.1|  PREDICTED: mitochondrial outer membrane prot...    294   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_006286537.1|  hypothetical protein CARUB_v10001678mg             291   3e-95    Capsella rubella
ref|XP_008775594.1|  PREDICTED: mitochondrial outer membrane prot...    291   3e-95    Phoenix dactylifera
ref|XP_010925058.1|  PREDICTED: mitochondrial outer membrane prot...    291   6e-95    Elaeis guineensis
gb|KHG07130.1|  Mitochondrial outer membrane protein porin of 34 kDa    290   9e-95    Gossypium arboreum [tree cotton]
ref|XP_008808420.1|  PREDICTED: mitochondrial outer membrane prot...    289   2e-94    Phoenix dactylifera
ref|XP_003621109.1|  Outer plastidial membrane protein porin            289   2e-94    Medicago truncatula
gb|AFK38338.1|  unknown                                                 289   2e-94    Medicago truncatula
ref|XP_002873707.1|  voltage-dependent anion-selective channel pr...    288   5e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_008786741.1|  PREDICTED: mitochondrial outer membrane prot...    288   5e-94    Phoenix dactylifera
ref|XP_006660565.1|  PREDICTED: mitochondrial outer membrane prot...    288   6e-94    Oryza brachyantha
gb|ACJ85253.1|  unknown                                                 288   9e-94    Medicago truncatula
ref|XP_004956656.1|  PREDICTED: mitochondrial outer membrane prot...    287   1e-93    Setaria italica
ref|XP_003578022.1|  PREDICTED: mitochondrial outer membrane porin      287   2e-93    Brachypodium distachyon [annual false brome]
ref|XP_010925360.1|  PREDICTED: mitochondrial outer membrane prot...    287   2e-93    Elaeis guineensis
gb|ACJ85279.1|  unknown                                                 287   2e-93    Medicago truncatula
gb|KEH19833.1|  porin/voltage-dependent anion-selective channel p...    286   2e-93    Medicago truncatula
ref|XP_007046222.1|  Mitochondrial outer membrane protein porin 1...    284   5e-93    
gb|EPS68383.1|  hypothetical protein M569_06388                         285   1e-92    Genlisea aurea
gb|EAZ08792.1|  hypothetical protein OsI_31052                          283   7e-92    Oryza sativa Indica Group [Indian rice]
ref|NP_001105619.1|  voltage-dependent anion channel protein1a          283   7e-92    Zea mays [maize]
ref|XP_009408682.1|  PREDICTED: mitochondrial outer membrane prot...    282   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001062983.1|  Os09g0361400                                       282   1e-91    
gb|EAZ44453.1|  hypothetical protein OsJ_29066                          282   1e-91    Oryza sativa Japonica Group [Japonica rice]
gb|ABK24200.1|  unknown                                                 282   2e-91    Picea sitchensis
gb|ACF85328.1|  unknown                                                 281   2e-91    Zea mays [maize]
gb|KDO82798.1|  hypothetical protein CISIN_1g0238541mg                  278   3e-91    Citrus sinensis [apfelsine]
ref|XP_002460110.1|  hypothetical protein SORBIDRAFT_02g022910          280   1e-90    Sorghum bicolor [broomcorn]
tpg|DAA61162.1|  TPA: voltage-dependent anion-selective channel p...    278   8e-90    
gb|KJB30017.1|  hypothetical protein B456_005G139100                    276   2e-89    Gossypium raimondii
gb|AAM62480.1|  voltage-dependent anion-selective channel protein...    276   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001104948.1|  voltage-dependent anion channel protein1b          276   4e-89    
ref|XP_009393634.1|  PREDICTED: mitochondrial outer membrane prot...    275   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
sp|P46274.1|VDAC1_WHEAT  RecName: Full=Mitochondrial outer membra...    275   1e-88    Triticum aestivum [Canadian hard winter wheat]
ref|NP_197013.1|  voltage dependent anion channel 3                     274   2e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KJB30016.1|  hypothetical protein B456_005G139100                    270   5e-88    Gossypium raimondii
gb|KCW56275.1|  hypothetical protein EUGRSUZ_I02018                     270   3e-87    Eucalyptus grandis [rose gum]
ref|XP_006298184.1|  hypothetical protein CARUB_v10014234mg             269   1e-86    
ref|XP_009408829.1|  PREDICTED: mitochondrial outer membrane prot...    268   4e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB60740.1|  hypothetical protein B456_009G323300                    264   5e-86    Gossypium raimondii
gb|EMS51310.1|  Mitochondrial outer membrane porin                      276   1e-85    Triticum urartu
gb|EMT02908.1|  Mitochondrial outer membrane porin                      273   9e-84    
ref|XP_009403419.1|  PREDICTED: mitochondrial outer membrane prot...    260   6e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001043433.1|  Os01g0588200                                       256   1e-81    
ref|XP_010231957.1|  PREDICTED: mitochondrial outer membrane prot...    253   4e-80    Brachypodium distachyon [annual false brome]
gb|EMS47295.1|  Outer plastidial membrane protein porin                 251   2e-79    Triticum urartu
emb|CAA57646.1|  Voltage dependent anion channel (VDAC)                 251   3e-79    Triticum aestivum [Canadian hard winter wheat]
emb|CDM83072.1|  unnamed protein product                                250   3e-79    Triticum aestivum [Canadian hard winter wheat]
dbj|BAL41368.1|  porin                                                  246   1e-78    Arum maculatum [cuckoo-pint]
ref|XP_004969385.1|  PREDICTED: mitochondrial outer membrane prot...    248   2e-78    Setaria italica
ref|XP_006646048.1|  PREDICTED: mitochondrial outer membrane prot...    247   8e-78    Oryza brachyantha
gb|ABK23226.1|  unknown                                                 246   1e-77    Picea sitchensis
ref|XP_004969745.1|  PREDICTED: mitochondrial outer membrane prot...    245   4e-77    Setaria italica
dbj|BAJ99489.1|  predicted protein                                      245   4e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002458065.1|  hypothetical protein SORBIDRAFT_03g026350          244   7e-77    Sorghum bicolor [broomcorn]
ref|NP_001278544.1|  outer plastidial membrane protein porin            244   1e-76    Zea mays [maize]
gb|AFW83107.1|  outer plastidial membrane protein porin                 243   2e-76    
gb|ACG25664.1|  outer plastidial membrane protein porin                 243   3e-76    Zea mays [maize]
gb|ACG45954.1|  outer plastidial membrane protein porin                 243   4e-76    Zea mays [maize]
ref|NP_001141587.1|  outer plastidial membrane protein porin            241   1e-75    Zea mays [maize]
sp|P42057.1|VDAC_MAIZE  RecName: Full=Outer plastidial membrane p...    239   7e-75    Zea mays [maize]
gb|KJB30164.1|  hypothetical protein B456_005G132100                    239   5e-74    Gossypium raimondii
ref|XP_004961383.1|  PREDICTED: mitochondrial outer membrane prot...    236   1e-73    Setaria italica
gb|ADE77918.1|  unknown                                                 235   4e-73    Picea sitchensis
ref|XP_002458403.1|  hypothetical protein SORBIDRAFT_03g032840          232   7e-72    Sorghum bicolor [broomcorn]
ref|XP_003568015.1|  PREDICTED: mitochondrial outer membrane prot...    231   8e-72    Brachypodium distachyon [annual false brome]
ref|XP_001779057.1|  predicted protein                                  231   9e-72    
ref|XP_001781995.1|  predicted protein                                  231   1e-71    
ref|NP_001104949.1|  voltage-dependent anion channel protein2           228   2e-70    Zea mays [maize]
ref|NP_001056162.1|  Os05g0536200                                       225   3e-69    
ref|XP_006845625.1|  hypothetical protein AMTR_s00019p00217910          224   6e-69    Amborella trichopoda
ref|XP_002440144.1|  hypothetical protein SORBIDRAFT_09g026790          223   2e-68    Sorghum bicolor [broomcorn]
ref|XP_006655528.1|  PREDICTED: mitochondrial outer membrane prot...    221   8e-68    Oryza brachyantha
ref|XP_008338437.1|  PREDICTED: mitochondrial outer membrane prot...    220   2e-67    
gb|KJB31318.1|  hypothetical protein B456_005G186100                    218   4e-67    Gossypium raimondii
ref|XP_008777255.1|  PREDICTED: mitochondrial outer membrane prot...    219   4e-67    Phoenix dactylifera
emb|CAA57647.1|  Voltage dependent anion channel (VDAC)                 219   5e-67    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99317.1|  predicted protein                                      219   1e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009354614.1|  PREDICTED: mitochondrial outer membrane prot...    218   1e-66    Pyrus x bretschneideri [bai li]
ref|XP_009150694.1|  PREDICTED: mitochondrial outer membrane prot...    217   3e-66    Brassica rapa
ref|XP_008354718.1|  PREDICTED: mitochondrial outer membrane prot...    217   4e-66    Malus domestica [apple tree]
emb|CDY08723.1|  BnaA06g25010D                                          216   6e-66    Brassica napus [oilseed rape]
ref|XP_010550330.1|  PREDICTED: mitochondrial outer membrane prot...    216   9e-66    Tarenaya hassleriana [spider flower]
gb|KDO82799.1|  hypothetical protein CISIN_1g0238541mg                  212   1e-65    Citrus sinensis [apfelsine]
ref|XP_003569678.1|  PREDICTED: mitochondrial outer membrane prot...    217   1e-65    Brachypodium distachyon [annual false brome]
sp|Q0JJV1.3|VDAC4_ORYSJ  RecName: Full=Mitochondrial outer membra...    217   1e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008787191.1|  PREDICTED: mitochondrial outer membrane prot...    215   2e-65    Phoenix dactylifera
ref|XP_007205702.1|  hypothetical protein PRUPE_ppa009821mg             215   2e-65    Prunus persica
ref|XP_002279650.2|  PREDICTED: mitochondrial outer membrane prot...    214   3e-65    Vitis vinifera
ref|XP_010652706.1|  PREDICTED: mitochondrial outer membrane prot...    214   4e-65    Vitis vinifera
ref|XP_004231921.1|  PREDICTED: mitochondrial outer membrane prot...    216   6e-65    
ref|XP_010918626.1|  PREDICTED: mitochondrial outer membrane prot...    214   7e-65    Elaeis guineensis
gb|KJB48714.1|  hypothetical protein B456_008G082900                    214   7e-65    Gossypium raimondii
ref|XP_009112213.1|  PREDICTED: mitochondrial outer membrane prot...    214   8e-65    Brassica rapa
emb|CDY36497.1|  BnaC03g48560D                                          213   1e-64    Brassica napus [oilseed rape]
emb|CDY18662.1|  BnaA09g07330D                                          213   1e-64    Brassica napus [oilseed rape]
ref|XP_008805725.1|  PREDICTED: mitochondrial outer membrane prot...    213   1e-64    Phoenix dactylifera
ref|XP_006841082.1|  hypothetical protein AMTR_s00086p00035910          213   1e-64    Amborella trichopoda
gb|AAW22622.1|  porin-like protein                                      213   2e-64    Brassica napus [oilseed rape]
ref|XP_008238010.1|  PREDICTED: mitochondrial outer membrane prot...    213   2e-64    Prunus mume [ume]
ref|NP_201551.1|  voltage dependent anion channel 2                     213   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008457836.1|  PREDICTED: mitochondrial outer membrane prot...    213   2e-64    Cucumis melo [Oriental melon]
ref|XP_010942794.1|  PREDICTED: mitochondrial outer membrane prot...    212   3e-64    
ref|XP_010484488.1|  PREDICTED: mitochondrial outer membrane prot...    211   5e-64    Camelina sativa [gold-of-pleasure]
emb|CDX81312.1|  BnaC09g07230D                                          211   5e-64    
ref|XP_010463972.1|  PREDICTED: mitochondrial outer membrane prot...    211   5e-64    Camelina sativa [gold-of-pleasure]
ref|XP_006280940.1|  hypothetical protein CARUB_v10026938mg             211   6e-64    Capsella rubella
ref|XP_004148030.1|  PREDICTED: mitochondrial outer membrane prot...    210   1e-63    Cucumis sativus [cucumbers]
ref|XP_007047520.1|  Voltage dependent anion channel 2                  210   2e-63    
ref|XP_002866701.1|  hypothetical protein ARALYDRAFT_496845             210   2e-63    
ref|XP_009413143.1|  PREDICTED: mitochondrial outer membrane prot...    210   2e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002973372.1|  hypothetical protein SELMODRAFT_271012             210   2e-63    Selaginella moellendorffii
ref|XP_002976531.1|  hypothetical protein SELMODRAFT_267998             210   2e-63    Selaginella moellendorffii
ref|XP_010444638.1|  PREDICTED: mitochondrial outer membrane prot...    209   3e-63    Camelina sativa [gold-of-pleasure]
ref|NP_001239899.1|  uncharacterized protein LOC100790578               209   4e-63    Glycine max [soybeans]
ref|XP_010943374.1|  PREDICTED: mitochondrial outer membrane prot...    209   5e-63    Elaeis guineensis
ref|XP_006393957.1|  hypothetical protein EUTSA_v10004631mg             210   5e-63    
emb|CAA63968.1|  pom30                                                  209   5e-63    Solanum tuberosum [potatoes]
ref|XP_006426127.1|  hypothetical protein CICLE_v10026251mg             209   6e-63    Citrus clementina [clementine]
ref|XP_002964960.1|  hypothetical protein SELMODRAFT_143103             209   7e-63    Selaginella moellendorffii
ref|XP_004288248.1|  PREDICTED: mitochondrial outer membrane prot...    208   9e-63    Fragaria vesca subsp. vesca
ref|XP_006381815.1|  VDAC3.1 family protein                             208   1e-62    Populus trichocarpa [western balsam poplar]
ref|NP_001048902.1|  Os03g0137500                                       207   2e-62    
gb|KHG00012.1|  Mitochondrial outer membrane porin 2 -like protein      207   2e-62    
ref|XP_010272561.1|  PREDICTED: mitochondrial outer membrane prot...    207   2e-62    
gb|KFK28435.1|  hypothetical protein AALP_AA8G514300                    207   3e-62    
ref|XP_010247341.1|  PREDICTED: mitochondrial outer membrane prot...    207   4e-62    
ref|NP_001241153.1|  uncharacterized protein LOC100818855               206   5e-62    
gb|KHN36298.1|  Mitochondrial outer membrane protein porin 2            206   5e-62    
ref|XP_011007586.1|  PREDICTED: mitochondrial outer membrane prot...    206   8e-62    
gb|EEC74475.1|  hypothetical protein OsI_09925                          206   8e-62    
gb|KDP32072.1|  hypothetical protein JCGZ_12533                         206   9e-62    
ref|XP_010102769.1|  Mitochondrial outer membrane protein porin 2       206   9e-62    
ref|NP_001152335.1|  outer mitochondrial membrane protein porin         207   9e-62    
ref|XP_002306507.2|  hypothetical protein POPTR_0005s19050g             207   1e-61    
ref|XP_007156717.1|  hypothetical protein PHAVU_002G011300g             205   1e-61    
ref|XP_004511842.1|  PREDICTED: mitochondrial outer membrane prot...    205   1e-61    
gb|KJB58633.1|  hypothetical protein B456_009G219700                    205   1e-61    
ref|XP_011008399.1|  PREDICTED: mitochondrial outer membrane prot...    205   1e-61    
ref|XP_006649363.1|  PREDICTED: mitochondrial outer membrane prot...    205   2e-61    
gb|KJB11405.1|  hypothetical protein B456_001G256800                    202   3e-61    
ref|XP_004146313.1|  PREDICTED: mitochondrial outer membrane prot...    204   3e-61    
ref|XP_008453611.1|  PREDICTED: mitochondrial outer membrane prot...    204   3e-61    
gb|KCW78721.1|  hypothetical protein EUGRSUZ_C00165                     205   6e-61    
ref|XP_010046987.1|  PREDICTED: mitochondrial outer membrane prot...    204   6e-61    
gb|KCW78720.1|  hypothetical protein EUGRSUZ_C00165                     205   8e-61    
ref|XP_002984740.1|  hypothetical protein SELMODRAFT_156847             202   1e-60    
emb|CDP02971.1|  unnamed protein product                                204   1e-60    
ref|XP_010547555.1|  PREDICTED: mitochondrial outer membrane prot...    202   2e-60    
ref|XP_003558860.1|  PREDICTED: mitochondrial outer membrane prot...    202   2e-60    
emb|CDY02103.1|  BnaA03g40640D                                          202   3e-60    
emb|CDP02599.1|  unnamed protein product                                202   3e-60    
gb|EEC71387.1|  hypothetical protein OsI_03508                          202   3e-60    
ref|XP_010259833.1|  PREDICTED: mitochondrial outer membrane prot...    201   4e-60    
ref|XP_009770519.1|  PREDICTED: mitochondrial outer membrane prot...    201   4e-60    
ref|XP_009338032.1|  PREDICTED: mitochondrial outer membrane prot...    201   4e-60    
ref|XP_009136524.1|  PREDICTED: mitochondrial outer membrane prot...    201   5e-60    
ref|XP_008805677.1|  PREDICTED: mitochondrial outer membrane prot...    200   1e-59    
ref|XP_002866208.1|  hypothetical protein ARALYDRAFT_495848             200   1e-59    
ref|XP_009615970.1|  PREDICTED: mitochondrial outer membrane prot...    200   1e-59    
ref|XP_002525270.1|  voltage-dependent anion-selective channel, p...    200   1e-59    
ref|XP_009801997.1|  PREDICTED: mitochondrial outer membrane prot...    200   2e-59    
ref|XP_009386273.1|  PREDICTED: mitochondrial outer membrane prot...    199   2e-59    
emb|CAN64922.1|  hypothetical protein VITISV_017201                     199   2e-59    
ref|XP_007018499.1|  Voltage dependent anion channel 2                  199   2e-59    
ref|XP_002272180.1|  PREDICTED: mitochondrial outer membrane prot...    199   2e-59    
gb|ABB16970.1|  POM30-like protein                                      199   2e-59    
ref|XP_010938962.1|  PREDICTED: mitochondrial outer membrane prot...    199   3e-59    
ref|XP_006280944.1|  hypothetical protein CARUB_v10026945mg             199   3e-59    
ref|XP_010539443.1|  PREDICTED: mitochondrial outer membrane prot...    199   3e-59    
ref|XP_008351971.1|  PREDICTED: mitochondrial outer membrane prot...    199   3e-59    
ref|XP_003611587.1|  Mitochondrial outer membrane protein porin         199   3e-59    
gb|KJB50697.1|  hypothetical protein B456_008G182700                    197   3e-59    
ref|XP_009411051.1|  PREDICTED: mitochondrial outer membrane prot...    199   4e-59    
ref|XP_008223703.1|  PREDICTED: mitochondrial outer membrane prot...    199   4e-59    
ref|XP_009604076.1|  PREDICTED: mitochondrial outer membrane prot...    199   5e-59    
gb|AAQ87023.1|  VDAC3.1                                                 199   6e-59    
emb|CDY11866.1|  BnaC03g12920D                                          198   6e-59    
emb|CDX88625.1|  BnaA03g10240D                                          198   6e-59    
ref|XP_008363546.1|  PREDICTED: mitochondrial outer membrane prot...    198   7e-59    
ref|XP_010551867.1|  PREDICTED: mitochondrial outer membrane prot...    195   8e-59    
ref|XP_009132124.1|  PREDICTED: mitochondrial outer membrane prot...    198   1e-58    
gb|KDP41624.1|  hypothetical protein JCGZ_16031                         197   1e-58    
ref|XP_008777257.1|  PREDICTED: mitochondrial outer membrane prot...    197   1e-58    
gb|KHG14881.1|  Mitochondrial outer membrane porin 2 -like protein      197   1e-58    
ref|XP_007222510.1|  hypothetical protein PRUPE_ppa009817mg             197   2e-58    
ref|NP_001190641.1|  voltage dependent anion channel 2                  198   2e-58    
ref|NP_200557.1|  voltage dependent anion channel 4                     197   2e-58    
ref|XP_011043983.1|  PREDICTED: mitochondrial outer membrane prot...    197   2e-58    
ref|NP_001044063.2|  Os01g0715500                                       198   2e-58    
gb|KJB34748.1|  hypothetical protein B456_006G081500                    195   3e-58    
gb|KJB43907.1|  hypothetical protein B456_007G223000                    196   3e-58    
gb|KJB23473.1|  hypothetical protein B456_004G100400                    196   3e-58    
ref|XP_002877711.1|  hypothetical protein ARALYDRAFT_323570             196   4e-58    
ref|XP_003558558.1|  PREDICTED: mitochondrial outer membrane prot...    196   5e-58    
gb|KHG05706.1|  Mitochondrial outer membrane porin 4 -like protein      196   6e-58    
gb|AAQ87022.1|  VDAC2.1                                                 196   7e-58    
gb|AFK33448.1|  unknown                                                 196   8e-58    
ref|NP_001149108.1|  outer mitochondrial membrane protein porin         196   8e-58    
ref|XP_009614284.1|  PREDICTED: mitochondrial outer membrane prot...    196   8e-58    
gb|EMT32910.1|  Mitochondrial outer membrane protein porin              196   8e-58    
ref|XP_007014286.1|  Voltage dependent anion channel 4                  197   9e-58    
gb|EYU20913.1|  hypothetical protein MIMGU_mgv1a011651mg                195   1e-57    
ref|XP_002325061.1|  VDAC3.1 family protein                             195   2e-57    
tpg|DAA43264.1|  TPA: outer membrane protein porin                      195   2e-57    
ref|XP_006600196.1|  PREDICTED: uncharacterized protein LOC100797...    194   2e-57    
ref|XP_004296415.1|  PREDICTED: mitochondrial outer membrane prot...    194   2e-57    
ref|XP_010536913.1|  PREDICTED: mitochondrial outer membrane prot...    194   2e-57    
ref|XP_011079306.1|  PREDICTED: mitochondrial outer membrane prot...    194   3e-57    
ref|XP_004507844.1|  PREDICTED: mitochondrial outer membrane prot...    193   6e-57    
ref|XP_006350613.1|  PREDICTED: mitochondrial outer membrane prot...    193   6e-57    
ref|XP_010028100.1|  PREDICTED: mitochondrial outer membrane prot...    193   7e-57    
ref|XP_009400023.1|  PREDICTED: mitochondrial outer membrane prot...    193   7e-57    
gb|EMT20213.1|  Mitochondrial outer membrane porin                      203   7e-57    
ref|XP_009798280.1|  PREDICTED: mitochondrial outer membrane prot...    193   1e-56    
ref|XP_006644617.1|  PREDICTED: mitochondrial outer membrane prot...    194   1e-56    
ref|XP_004234649.1|  PREDICTED: mitochondrial outer membrane prot...    192   1e-56    
ref|XP_007154773.1|  hypothetical protein PHAVU_003G146600g             192   1e-56    
ref|NP_001147762.1|  outer mitochondrial membrane protein porin         192   2e-56    
ref|XP_011099371.1|  PREDICTED: mitochondrial outer membrane prot...    192   2e-56    
ref|XP_006453392.1|  hypothetical protein CICLE_v10009163mg             192   3e-56    
ref|XP_004507845.1|  PREDICTED: mitochondrial outer membrane prot...    191   3e-56    
ref|XP_006649583.1|  PREDICTED: mitochondrial outer membrane prot...    191   4e-56    
ref|XP_010918628.1|  PREDICTED: mitochondrial outer membrane prot...    191   5e-56    
ref|NP_001242630.1|  uncharacterized protein LOC100797369               191   5e-56    
ref|XP_006366956.1|  PREDICTED: mitochondrial outer membrane prot...    191   6e-56    
ref|XP_004290968.1|  PREDICTED: mitochondrial outer membrane prot...    191   6e-56    
ref|XP_003557011.2|  PREDICTED: mitochondrial outer membrane prot...    191   6e-56    
ref|XP_006380609.1|  VDAC2.1 family protein                             190   8e-56    
ref|XP_006404089.1|  hypothetical protein EUTSA_v10010622mg             190   8e-56    
ref|XP_009360705.1|  PREDICTED: mitochondrial outer membrane prot...    190   9e-56    
ref|XP_003610136.1|  Mitochondrial outer membrane protein porin         190   1e-55    
ref|XP_010688492.1|  PREDICTED: mitochondrial outer membrane prot...    189   1e-55    
ref|XP_010452150.1|  PREDICTED: mitochondrial outer membrane prot...    190   1e-55    
ref|XP_010483270.1|  PREDICTED: mitochondrial outer membrane prot...    189   2e-55    
ref|XP_006401200.1|  hypothetical protein EUTSA_v10014362mg             189   2e-55    
ref|XP_011011237.1|  PREDICTED: mitochondrial outer membrane prot...    189   2e-55    
ref|XP_010679633.1|  PREDICTED: mitochondrial outer membrane prot...    189   2e-55    
ref|NP_001242891.1|  uncharacterized protein LOC100790270               189   4e-55    
ref|XP_006593432.1|  PREDICTED: uncharacterized protein LOC100790...    188   5e-55    
ref|XP_004498999.1|  PREDICTED: mitochondrial outer membrane prot...    188   5e-55    
ref|XP_007227465.1|  hypothetical protein PRUPE_ppa009796mg             188   6e-55    
ref|XP_008220333.1|  PREDICTED: mitochondrial outer membrane prot...    188   7e-55    
ref|XP_010443435.1|  PREDICTED: mitochondrial outer membrane prot...    188   8e-55    
ref|XP_010259832.1|  PREDICTED: mitochondrial outer membrane prot...    189   8e-55    
ref|XP_010323316.1|  PREDICTED: mitochondrial outer membrane prot...    187   1e-54    
gb|EMS62963.1|  Mitochondrial outer membrane protein porin              198   1e-54    
gb|ACG30926.1|  outer mitochondrial membrane protein porin              187   1e-54    
ref|NP_001149101.1|  outer mitochondrial membrane protein porin         187   1e-54    
ref|NP_001049301.1|  Os03g0202200                                       187   2e-54    
ref|XP_007160908.1|  hypothetical protein PHAVU_001G027200g             187   2e-54    
gb|ACJ85119.1|  unknown                                                 186   5e-54    
ref|XP_002468550.1|  hypothetical protein SORBIDRAFT_01g047800          186   7e-54    
gb|KFK34258.1|  hypothetical protein AALP_AA5G121500                    185   7e-54    
ref|XP_010545418.1|  PREDICTED: mitochondrial outer membrane prot...    185   9e-54    
ref|XP_010943375.1|  PREDICTED: mitochondrial outer membrane prot...    184   1e-53    
gb|AAP46186.1|  PgPOR29                                                 184   2e-53    
ref|XP_011073688.1|  PREDICTED: mitochondrial outer membrane prot...    184   2e-53    
ref|XP_004985298.1|  PREDICTED: mitochondrial outer membrane prot...    184   4e-53    
ref|NP_001147486.1|  outer mitochondrial membrane protein porin         183   4e-53    
ref|XP_002465683.1|  hypothetical protein SORBIDRAFT_01g043700          183   5e-53    
ref|XP_008452645.1|  PREDICTED: mitochondrial outer membrane prot...    183   7e-53    
ref|XP_002510098.1|  voltage-dependent anion-selective channel, p...    182   9e-53    
gb|ACU23163.1|  unknown                                                 181   3e-52    
tpg|DAA43927.1|  TPA: outer membrane protein porin                      181   4e-52    
ref|XP_010999872.1|  PREDICTED: mitochondrial outer membrane prot...    181   5e-52    
ref|NP_001288497.1|  mitochondrial outer membrane protein porin 5       181   5e-52    
ref|XP_004985785.1|  PREDICTED: mitochondrial outer membrane prot...    182   9e-52    
ref|XP_002320689.2|  hypothetical protein POPTR_0014s01660g             179   2e-51    
ref|XP_003589068.1|  Mitochondrial outer membrane protein porin         179   3e-51    
gb|KEH40016.1|  porin/voltage-dependent anion-selective channel p...    179   3e-51    
ref|XP_010061677.1|  PREDICTED: mitochondrial outer membrane prot...    178   3e-51    
tpg|DAA43267.1|  TPA: hypothetical protein ZEAMMB73_938356              178   4e-51    
ref|XP_004141289.1|  PREDICTED: mitochondrial outer membrane prot...    178   5e-51    
ref|XP_006607011.1|  PREDICTED: mitochondrial outer membrane prot...    179   6e-51    
ref|XP_006607010.1|  PREDICTED: mitochondrial outer membrane prot...    179   8e-51    
gb|EMT12164.1|  Mitochondrial outer membrane protein porin of 34 kDa    177   8e-51    
dbj|BAJ91367.1|  predicted protein                                      177   1e-50    
ref|XP_006607009.1|  PREDICTED: mitochondrial outer membrane prot...    178   2e-50    
gb|KHN17590.1|  Mitochondrial outer membrane protein porin 6            176   4e-50    
tpg|DAA43266.1|  TPA: hypothetical protein ZEAMMB73_938356              174   4e-50    
ref|XP_006662285.1|  PREDICTED: mitochondrial outer membrane prot...    175   5e-50    
dbj|BAD87377.1|  putative 36kDA porin II                                177   2e-49    
ref|XP_010061676.1|  PREDICTED: mitochondrial outer membrane prot...    174   2e-49    
tpg|DAA43265.1|  TPA: hypothetical protein ZEAMMB73_938356              174   2e-49    
gb|EPS70241.1|  hypothetical protein M569_04517                         173   4e-49    
gb|KJB23472.1|  hypothetical protein B456_004G100400                    170   5e-49    
gb|KJB23474.1|  hypothetical protein B456_004G100400                    169   5e-49    
gb|EYU29628.1|  hypothetical protein MIMGU_mgv1a011618mg                172   1e-48    
emb|CDP01200.1|  unnamed protein product                                171   2e-48    
gb|AFK40966.1|  unknown                                                 166   1e-47    
gb|KHN07668.1|  Mitochondrial outer membrane protein porin 2            170   2e-47    
ref|XP_010101100.1|  Mitochondrial outer membrane protein porin 4       169   6e-47    
gb|EPS73591.1|  pom30 protein                                           167   6e-47    
gb|ABB02635.1|  unknown                                                 162   6e-46    
ref|XP_010691575.1|  PREDICTED: mitochondrial outer membrane prot...    164   8e-46    
gb|KHG11726.1|  Mitochondrial outer membrane porin of 34 kDa            161   2e-45    
gb|ABE77194.1|  putative voltage-dependent ion channel                  164   2e-45    
ref|XP_004172904.1|  PREDICTED: mitochondrial outer membrane prot...    162   2e-45    
ref|XP_006291699.1|  hypothetical protein CARUB_v10017863mg             161   8e-45    
gb|AAL04449.1|  voltage-dependent anion channel                         155   1e-44    
gb|EEE58291.1|  hypothetical protein OsJ_09329                          169   4e-44    
emb|CDY70638.1|  BnaCnng69120D                                          159   4e-44    
ref|XP_010550772.1|  PREDICTED: mitochondrial outer membrane prot...    157   2e-43    
ref|XP_010551869.1|  PREDICTED: mitochondrial outer membrane prot...    152   5e-43    
gb|KJB29688.1|  hypothetical protein B456_005G114000                    153   3e-42    
ref|XP_010551868.1|  PREDICTED: mitochondrial outer membrane prot...    149   3e-41    
gb|AFW82970.1|  outer membrane protein porin                            150   4e-41    
emb|CBI33688.3|  unnamed protein product                                147   2e-40    
ref|XP_006383551.1|  hypothetical protein POPTR_0005s19050g             149   2e-40    
gb|AFW82971.1|  hypothetical protein ZEAMMB73_507543                    149   3e-40    
gb|AAC64164.1|  voltage-dependent anion-selective channel protein       144   4e-40    
dbj|BAG92834.1|  unnamed protein product                                140   1e-38    
gb|EMS46046.1|  Mitochondrial outer membrane protein porin of 34 kDa    143   6e-38    
ref|XP_008665842.1|  PREDICTED: mitochondrial outer membrane prot...    139   2e-37    
gb|ABF94514.1|  Eukaryotic porin family protein, expressed              141   5e-37    
ref|XP_003634314.2|  PREDICTED: mitochondrial outer membrane prot...    139   2e-36    
ref|XP_004983259.1|  PREDICTED: mitochondrial outer membrane prot...    136   8e-35    
ref|XP_006826371.1|  hypothetical protein AMTR_s00004p00132290          130   1e-34    
ref|XP_002318608.2|  hypothetical protein POPTR_0012s07210g             134   2e-34    
emb|CDY23028.1|  BnaC07g31590D                                          133   2e-34    
ref|XP_003634315.2|  PREDICTED: mitochondrial outer membrane prot...    134   2e-34    
ref|XP_003550309.2|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    134   6e-34    
ref|XP_004164031.1|  PREDICTED: mitochondrial outer membrane prot...    133   8e-34    
ref|XP_011044010.1|  PREDICTED: mitochondrial outer membrane prot...    132   8e-34    
ref|XP_010426523.1|  PREDICTED: mitochondrial outer membrane prot...    131   1e-33    
gb|ADE76112.1|  unknown                                                 127   1e-32    
gb|AFK40114.1|  unknown                                                 129   2e-32    
gb|KHN36963.1|  Mitochondrial outer membrane protein porin 5            129   4e-32    
ref|XP_006439652.1|  hypothetical protein CICLE_v10021785mg             127   1e-31    
ref|XP_007037222.1|  Porin/voltage-dependent anion-selective chan...    126   2e-31    
gb|KDP31208.1|  hypothetical protein JCGZ_11584                         125   4e-31    
ref|XP_004508774.1|  PREDICTED: mitochondrial outer membrane prot...    125   5e-31    
ref|XP_010029017.1|  PREDICTED: mitochondrial outer membrane prot...    125   6e-31    
ref|XP_006476654.1|  PREDICTED: mitochondrial outer membrane prot...    124   9e-31    
ref|XP_002511521.1|  voltage-dependent anion-selective channel, p...    124   1e-30    
emb|CDY25906.1|  BnaC09g32780D                                          125   1e-30    
ref|XP_010086579.1|  Mitochondrial outer membrane protein porin o...    123   2e-30    
ref|XP_007201143.1|  hypothetical protein PRUPE_ppa016048mg             124   2e-30    
ref|XP_003524958.1|  PREDICTED: mitochondrial outer membrane prot...    122   3e-30    
gb|KJB50870.1|  hypothetical protein B456_008G190600                    122   6e-30    
ref|XP_011030342.1|  PREDICTED: mitochondrial outer membrane prot...    122   2e-29    
ref|XP_007155337.1|  hypothetical protein PHAVU_003G192600g             119   6e-29    



>ref|XP_010087805.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
 gb|EXB30112.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
Length=276

 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKARDLLY+DYQ+DHKFTITTYSPTGV ITSTG+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSTGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+FTT+TVDE APGLK I SFR+PDQRSGKVELQYLHD+AGI+TS
Sbjct  61   KNKNITTDIKVDTNSNLFTTVTVDEPAPGLKTILSFRLPDQRSGKVELQYLHDYAGITTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANP+VNFSGV GTN +ALGTDVSFD+K+G FTK NAGLSF+N+DLIASLTLNDKGD
Sbjct  121  VGLTANPVVNFSGVFGTNVVALGTDVSFDSKTGQFTKLNAGLSFSNADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH VN L+NTAVGAE
Sbjct  181  TLSASYYHTVNLLTNTAVGAE  201



>ref|NP_001275154.1| mitochondrial outer membrane protein porin of 34 kDa [Solanum 
tuberosum]
 sp|P42055.2|VDAC1_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 34 
kDa; AltName: Full=POM 34; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56599.1| 34 kDA porin [Solanum tuberosum]
Length=276

 Score =   353 bits (905),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQ+DHKF+ITTYSPTGVVITS+GSKKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+FTTITVDEAAPGLK I SFRVPDQRSGK+E+QYLHD+AGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVGTN +ALGTDVSFDTK+G FTK NAGLSFTN+DL+ASL LN+KGD
Sbjct  121  VGLTANPIVNFSGVVGTNIIALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL++TAVGAE
Sbjct  181  NLTASYYHTVSPLTSTAVGAE  201



>ref|XP_004233349.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQ+DHKF+ITTYSPTGVVITS+GSKKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+FTTITVDEAAPGLK I SFRVPDQRSGK+E+QYLHD+AGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVGTN +ALGTDVSFDTK+G FTK NAGLSFTN+DL+ASL LN+KGD
Sbjct  121  VGLTANPIVNFSGVVGTNIVALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL++TAVGAE
Sbjct  181  NLTASYYHTVSPLTSTAVGAE  201



>ref|XP_008443436.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Cucumis melo]
Length=276

 Score =   351 bits (901),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+ TTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTSSNLVTTITVDEPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG+N LALGTD+SFDTK+G FTK NAGLSF N+DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGSNLLALGTDLSFDTKTGNFTKVNAGLSFANADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH VNPL++TAVGAE
Sbjct  181  TLSASYYHTVNPLTSTAVGAE  201



>ref|XP_009587690.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana tomentosiformis]
 dbj|BAF95072.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   350 bits (897),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKK RDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKTRDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+FTTITVD+AAPGLK I SFRVPDQRSGK+E+QYLH++AGISTS
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVDDAAPGLKTILSFRVPDQRSGKLEVQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVGTN LALGTDVSFD+K+G FTK NAGLSFTN+DL+ASL LNDKGD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGTDVSFDSKTGDFTKCNAGLSFTNADLVASLNLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+P ++TAVGAE
Sbjct  181  NLSASYYHSVSPFTSTAVGAE  201



>ref|XP_009798894.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana sylvestris]
Length=276

 Score =   349 bits (896),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKK RDLLY+DY +DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKTRDLLYKDYHSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+FTTITVDEAAPGLK I SFRVPDQRSGK+E+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVGTN LALGTDVSFDTK+G FTK NAGLSFTN+DL+ASL LNDKGD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+P ++T VGAE
Sbjct  181  NLSASYYHTVSPFTSTVVGAE  201



>ref|XP_007215668.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
 gb|EMJ16867.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
Length=326

 Score =   351 bits (901),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 197/218 (90%), Gaps = 2/218 (1%)
 Frame = +3

Query  21   LSPSR-LCFRFSALAAEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITS  197
            L PSR LC  F +L  +M  GPGLYTDIGKKARDLLY+DYQ+DHKFT+TTYSPTGV ITS
Sbjct  35   LIPSRFLCLLFQSLLGKM-VGPGLYTDIGKKARDLLYKDYQSDHKFTVTTYSPTGVAITS  93

Query  198  TGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRS  377
            +G+KKG+LFL DVNTQLKNKN+TTD KVDT+SN+ TT+TVD+ APGLK I SF+VPDQRS
Sbjct  94   SGTKKGELFLADVNTQLKNKNVTTDIKVDTDSNLSTTVTVDQPAPGLKAIFSFKVPDQRS  153

Query  378  GKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLS  557
            GKVELQYLHD+AGISTS+GLTANPIVNFSGV+GTN LALGTD+SFDTK+G  TK NAG+S
Sbjct  154  GKVELQYLHDYAGISTSIGLTANPIVNFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGVS  213

Query  558  FTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAE  671
            F+N+DLIA+LTLNDKGD LSASYYH+VNPL+NTAVGAE
Sbjct  214  FSNADLIAALTLNDKGDILSASYYHNVNPLANTAVGAE  251



>ref|XP_004147460.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 ref|XP_004168625.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 gb|KGN59595.1| Porin [Cucumis sativus]
Length=276

 Score =   349 bits (896),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+ TTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTSSNLVTTITVDEPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG+N LALGTD+SFDTK+G FTK N GLSF N+DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGSNLLALGTDLSFDTKTGNFTKVNTGLSFANADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH VNPL++TAVGAE
Sbjct  181  TLSASYYHTVNPLTSTAVGAE  201



>gb|AAB38498.1| porin [Mesembryanthemum crystallinum]
Length=276

 Score =   348 bits (892),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKKARDLLYRDYQTD KF+ITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLYRDYQTDQKFSITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+ TTITVDEAAPGLK I SFRVPDQRSGK+ELQYLHD+AGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLLTTITVDEAAPGLKTILSFRVPDQRSGKLELQYLHDYAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+GTN LA GTDVSFD+K+G FTK NAGLSF N+DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVLGTNLLAFGTDVSFDSKTGNFTKCNAGLSFANADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH ++PL+++AVGAE
Sbjct  181  TLNASYYHTISPLTSSAVGAE  201



>ref|XP_010029375.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW56274.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=276

 Score =   346 bits (888),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFTITT+SPTGV +TSTG+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTITTFSPTGVTLTSTGTKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTITVDE APGLK I SF+VPDQRSGK+ELQYLH+HAGIS+S
Sbjct  61   KNKNITTDIKVDTSSNLFTTITVDEPAPGLKSIFSFKVPDQRSGKIELQYLHEHAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIV FSGV+GT+ALALGTDVSFDTKSG F K NAGLSF+N+DLIASLT+NDKGD
Sbjct  121  IGLTANPIVTFSGVIGTSALALGTDVSFDTKSGDFAKCNAGLSFSNADLIASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH VN L+NTAVGAE
Sbjct  181  TLAASYYHLVNGLTNTAVGAE  201



>emb|CDP02196.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   346 bits (887),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKK RDLLY+D+Q+DHKF+ITT SPTGV +TS+G+KKGDLF  DVN QL
Sbjct  1    MAKGPGLYTEIGKKVRDLLYKDFQSDHKFSITTCSPTGVAVTSSGTKKGDLFWADVNAQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTDFKVDTNSN+FT +T+DE  PGLK I SFRVPDQRSGK+ELQYLHD+AGISTS
Sbjct  61   KNKNITTDFKVDTNSNLFTAVTIDEPVPGLKTIFSFRVPDQRSGKLELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPI+NFSGVVGTNALALGTDVSFDTK+G  TK NAGLSFTNSDLIASLTLNDKGD
Sbjct  121  VGLTANPIINFSGVVGTNALALGTDVSFDTKTGTLTKCNAGLSFTNSDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+PL++TAVGAE
Sbjct  181  ALSASYYHTVSPLTSTAVGAE  201



>ref|XP_007032450.1| Voltage dependent anion channel 1 [Theobroma cacao]
 gb|EOY03376.1| Voltage dependent anion channel 1 [Theobroma cacao]
Length=276

 Score =   345 bits (886),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKARDLLY+DYQTD KFT+TT+SPTGV ITS G+KKGDLF+ DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQTDQKFTLTTFSPTGVAITSAGTKKGDLFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KN+N+TTD KVDT+SN+FTTITVDE APGLK I SFRVPDQRSGKVELQYLHD+AGIS+S
Sbjct  61   KNRNVTTDIKVDTSSNLFTTITVDEPAPGLKTIFSFRVPDQRSGKVELQYLHDYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV GTN LALGTD+SFDTK+G FTK NAGLSF+N DLIAS+ LN+KGD
Sbjct  121  IGLTANPIVNFSGVFGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASVALNEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH VNPL+NTAVGAE
Sbjct  181  SLNASYYHIVNPLTNTAVGAE  201



>ref|XP_006431074.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|ESR44314.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|KDO72482.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
 gb|KDO72483.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
Length=274

 Score =   344 bits (882),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 185/201 (92%), Gaps = 2/201 (1%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT SN+FTTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDLKVDTASNLFTTITVDEPAPGLKTILSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFS V+GTN L+LGTD+SFD+KSG FTK NAGLSF N+DLIASL LN+KGD
Sbjct  121  VGLTANPIVNFSAVIGTNVLSLGTDLSFDSKSGNFTKCNAGLSFNNADLIASLNLNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH VNPL  TAVGAE
Sbjct  181  SLAASYYHFVNPL--TAVGAE  199



>ref|XP_006482536.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Citrus sinensis]
Length=274

 Score =   344 bits (882),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 185/201 (92%), Gaps = 2/201 (1%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT SN+FTTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDLKVDTASNLFTTITVDEPAPGLKTILSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFS V+GTN L+LGTD+SFD+KSG FTK NAGLSF N+DLIASL LN+KGD
Sbjct  121  VGLTANPIVNFSAVIGTNVLSLGTDLSFDSKSGNFTKCNAGLSFNNADLIASLNLNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH VNPL  TAVGAE
Sbjct  181  SLAASYYHFVNPL--TAVGAE  199



>gb|KJB33661.1| hypothetical protein B456_006G024700 [Gossypium raimondii]
Length=276

 Score =   343 bits (879),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQTDHKFT+TT SPTGV ITS G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDHKFTLTTSSPTGVAITSAGTKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDT SN++TTITVD+ APGLK I SFRVPDQRSGKVELQYLH++AGIS+S
Sbjct  61   KNKNVTTDIKVDTYSNLYTTITVDQPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVN SGV+GTN LALGTD+SFDTK+G FTK NAGLSF+N DLIASLTLN+KGD
Sbjct  121  IGLTANPIVNLSGVIGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASLTLNEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH VNP++NTAVGAE
Sbjct  181  SLNASYYHIVNPMTNTAVGAE  201



>ref|XP_006361834.1| PREDICTED: uncharacterized LOC102577832 [Solanum tuberosum]
Length=276

 Score =   343 bits (879),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKK RDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+  T+TVDEAAPGLK I S R+PDQ S K+ELQYLHD+AGI TS
Sbjct  61   KNKNITTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+GTN LALGTDVSFDTK+GA TK NAGLSFTN+DLI SL LN+KGD
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFTNADLITSLNLNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SLSASYYH V PL++TAVGAE
Sbjct  181  SLSASYYHIVTPLTSTAVGAE  201



>gb|ABC01904.1| 34 kDa outer mitochondrial membrane protein porin-like protein 
[Solanum tuberosum]
Length=276

 Score =   343 bits (879),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKK RDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+  T+TVDEAAPGLK I S R+PDQ S K+ELQYLHD+AGI TS
Sbjct  61   KNKNITTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+GTN LALGTDVSFDTK+GA TK NAGLSFTN+DLI SL LN+KGD
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFTNADLITSLNLNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SLSASYYH V PL++TAVGAE
Sbjct  181  SLSASYYHIVTPLTSTAVGAE  201



>ref|XP_011098570.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   342 bits (877),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLLYRDYQ+DHKFTITTYSPTGV +TSTG KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQSDHKFTITTYSPTGVTLTSTGIKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K+KN+TTD KVDT+SN+ TT+TVDE APGLK I SFRVPDQRSGK+ELQYLHD+AGIS+S
Sbjct  61   KHKNVTTDIKVDTSSNLLTTVTVDEPAPGLKTILSFRVPDQRSGKLELQYLHDYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFS V+G+N LA+G+DVSFD+K GA TK N G SFTNSDLIA+LTLNDKGD
Sbjct  121  VGLTANPIVNFSAVLGSNKLAVGSDVSFDSKEGAITKCNFGASFTNSDLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH VNPL+NTAVGAE
Sbjct  181  TLSASYYHTVNPLTNTAVGAE  201



>ref|XP_008379329.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial outer membrane 
protein porin of 34 kDa-like [Malus domestica]
 ref|XP_009342873.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Pyrus x bretschneideri]
Length=275

 Score =   342 bits (877),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYTDIGKKARDLLYRDYQ+DHKFTITT+SPTGV ITS+G+KKG+LFL DVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYRDYQSDHKFTITTFSPTGVAITSSGTKKGELFLADVNTQLKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  437
            N+TTD KVDT+SN+ TTITVD+ APGLK I SF+VPDQRSGKVELQYLHD+AGIS+SVGL
Sbjct  63   NVTTDVKVDTDSNLSTTITVDQPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSSVGL  122

Query  438  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  617
            TANPIVNFSGV+GTN LALGTD+SFDTK+G  TK NAGLSF+N+DL+A+LTLNDKGD LS
Sbjct  123  TANPIVNFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGLSFSNADLVAALTLNDKGDILS  182

Query  618  ASYYHHVNPLSNTAVGAE  671
            ASYYH VNPLSNTAVGAE
Sbjct  183  ASYYHSVNPLSNTAVGAE  200



>dbj|BAF95070.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   342 bits (877),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PDQ S K+E+QYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAKLEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVGTN L+LGTD+SFDTK GA TK NAGLSFTN+DLIASL LNDKGD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+PL+ TAV AE
Sbjct  181  ALSASYYHIVSPLTMTAVSAE  201



>ref|XP_009596455.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   342 bits (877),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKF ITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFAITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PD  S K+E+QYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDHSSAKLEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVGTN L+LGTDVSFDTK GA TK NAGLSFTN+DLIASL LNDKGD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDVSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SLSASYYH V+PL+ TAVGAE
Sbjct  181  SLSASYYHIVSPLTMTAVGAE  201



>ref|XP_009779190.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   342 bits (876),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PDQ S K+E+QYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAKLEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVGTN L+LGTD+SFDTK GA TK NAGLSFTN+DLIASL LNDKGD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+PL+ TAV AE
Sbjct  181  ALSASYYHIVSPLTMTAVSAE  201



>emb|CDP00287.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   342 bits (876),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGK+ARDLLY+DYQ DHKF++TTYSP GV IT++G KKG+LFLGDVNTQL
Sbjct  1    MVKGPGLYSDIGKRARDLLYKDYQGDHKFSVTTYSPNGVAITASGLKKGELFLGDVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTDFKVDTNS VFTTITVDE APGLK I SF VPDQRSGKVELQYLH++AGIS+S
Sbjct  61   KNKNITTDFKVDTNSKVFTTITVDEPAPGLKTIFSFVVPDQRSGKVELQYLHEYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV G + LALGTDVSFDT +G FTKYNAGLSFTNSDLIA+LTLNDKGD
Sbjct  121  IGLTANPIVNFSGVAGNDKLALGTDVSFDTATGNFTKYNAGLSFTNSDLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLTASYYHSVSPLTNTAVGAE  201



>gb|KHG03636.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=276

 Score =   342 bits (876),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQTDHKFT+TT SPTGV ITS G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDHKFTLTTSSPTGVAITSAGTKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDT SN++TTITVD+ APGLK I SFR PDQRSGKVELQYLH++AGIS+S
Sbjct  61   KNKNVTTDIKVDTYSNLYTTITVDQPAPGLKAIFSFRAPDQRSGKVELQYLHEYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVN SGV+GTN LALGTD+SFDTK+G FTK NAGLSF+N DLIASLTLN+KGD
Sbjct  121  IGLTANPIVNLSGVIGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASLTLNEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH VNP++NTAVGAE
Sbjct  181  SLNASYYHIVNPMTNTAVGAE  201



>ref|XP_010524325.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   341 bits (874),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ D KFTITTYSPTGV ITSTG+KKGD+FL DV TQL
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQNDQKFTITTYSPTGVAITSTGTKKGDVFLADVATQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KV T+S + TTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVGTDSTLLTTITVDEPAPGLKSIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVGTN LALGTDVSFDTK+G FTK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGTNVLALGTDVSFDTKTGNFTKCNAGLSFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +++ASYYH VNPLSNTAVGAE
Sbjct  181  TVNASYYHIVNPLSNTAVGAE  201



>gb|AIL25718.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   340 bits (873),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PDQ S ++E+QYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAELEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVGTN L+LGTD+SFDTK GA TK NAGLSFTN+DLIASL LNDKGD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+PL+ TAV AE
Sbjct  181  ALSASYYHIVSPLTMTAVSAE  201



>ref|XP_008230727.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Prunus mume]
Length=275

 Score =   338 bits (868),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYTDIGKKARDLLY+DYQ+D KFT+TTYSPTGV ITS+G+KKG+LFL DVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYKDYQSDQKFTVTTYSPTGVAITSSGTKKGELFLADVNTQLKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  437
            N+TTD KVDT+SN+ TT+TVD+ APGLK I SF+VPDQRSGKVELQYLHD+AGISTSVGL
Sbjct  63   NVTTDIKVDTDSNLSTTVTVDQPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTSVGL  122

Query  438  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  617
            TANPIVNFSGV+GTN LALGTD+SFDTK+G  TK NAG+SF+N+DLIA+LTLNDKGD LS
Sbjct  123  TANPIVNFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGVSFSNADLIAALTLNDKGDILS  182

Query  618  ASYYHHVNPLSNTAVGAE  671
            ASYYH+VNPL+NTAVGAE
Sbjct  183  ASYYHNVNPLANTAVGAE  200



>gb|AAQ87020.1| VDAC1.2 [Lotus japonicus]
Length=276

 Score =   338 bits (867),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGK+ARDLL++DY +D KFTITTYSPTGV ITS+G KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIKKGELFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTT+TVDE APGLK I SFRVPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLT NPIVNFSGVVGTNALA+GTD+SFDTK G  TK+NAGL+FT +DLIASLT+NDKGD
Sbjct  121  VGLTPNPIVNFSGVVGTNALAVGTDLSFDTKIGELTKFNAGLNFTKADLIASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH VNPL+NTA GAE
Sbjct  181  ALNASYYHIVNPLTNTAFGAE  201



>ref|XP_010550070.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   337 bits (865),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ+D KF+ITTYSPTGV ITSTG KKGDLFL DV TQL
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQSDQKFSITTYSPTGVAITSTGIKKGDLFLADVATQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KV T+S + TTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVGTDSTLLTTITVDEPAPGLKSIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP+VNFSGVVG+N LALGTDVSFDTK+G FTK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  IGLTANPVVNFSGVVGSNVLALGTDVSFDTKTGNFTKCNAGLSFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ SYYH VNPLSNTAVGAE
Sbjct  181  TLNGSYYHIVNPLSNTAVGAE  201



>ref|XP_004234781.2| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   337 bits (865),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKK RDLLYRDYQTDHKFTITTYS TGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSATGVAITSSGLKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I S R+PDQ S K+ELQYLHD+AGI TS
Sbjct  61   KNKNLTTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+GTN LALGTDVSFDTK+GA TK NAGL FTN+DLI SL LN+KGD
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLRFTNADLITSLNLNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SLSASYYH V+PL++TAVGAE
Sbjct  181  SLSASYYHIVSPLTSTAVGAE  201



>gb|AAY82249.1| mitochrondrial voltage-dependent anion-selective channel [Phaseolus 
coccineus]
Length=276

 Score =   336 bits (862),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKKARDLL++DY +D KFT+TTYSPTGV ITS+G++KG+LFL DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTVTTYSPTGVAITSSGTRKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTITV+E APGLK I +F+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVGTN LALG D+SFDTK G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+A+YYH VNPL+NTAVGAE
Sbjct  181  ALNAAYYHVVNPLTNTAVGAE  201



>ref|XP_003543710.1| PREDICTED: outer plastidial membrane protein porin-like [Glycine 
max]
Length=276

 Score =   336 bits (861),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD K+DTNSN+ TTITV+E APGLK I SFRVPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKLDTNSNLLTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVGTN LALGTDVSFDTK G  TK+NAGL+FT  DL+ASLT+NDKGD
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH VN L+NTAVGAE
Sbjct  181  ALNASYYHAVNRLTNTAVGAE  201



>ref|XP_003554316.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Glycine max]
Length=276

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT SN+FTTITV+E APGLK I SFRVPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTGSNLFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVGTN LALGTDVSFDTK G  TK+NAGL+FT  DL+ASLT+N+KGD
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH VN L+NTAVGAE
Sbjct  181  SLNASYYHTVNRLTNTAVGAE  201



>gb|KHN13242.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD K+DTNSN+ TTITV+E APGLK I SFRVPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKLDTNSNLLTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSG+VGTN LALGTDVSFDTK G  TK+NAGL+FT  DL+ASLT+NDKGD
Sbjct  121  VGLTANPIVNFSGIVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH VN L+NTAVGAE
Sbjct  181  ALNASYYHAVNRLTNTAVGAE  201



>ref|XP_007139603.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
 gb|ESW11597.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
Length=276

 Score =   335 bits (860),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKKARDLL++DY +D KFT+TTYSPTGV ITS+G++KG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTVTTYSPTGVAITSSGTRKGELFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTITV+E APGLK I +F+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVGTN LALG D+SFDTK G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+A+YYH VNPL+NTAVGAE
Sbjct  181  ALNAAYYHVVNPLTNTAVGAE  201



>emb|CBI32017.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   334 bits (856),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK ARDLLYRDYQ+DHKFT+TTY+ +GV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MGKGPGLYSDIGKIARDLLYRDYQSDHKFTVTTYTSSGVAITSSGTKKGELFIADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF +PDQRSGKVELQYLH++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKTIFSFIIPDQRSGKVELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG N L+LGTD+SFDT +G FTK NAGL F+N+DLIA+LTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGNNTLSLGTDLSFDTATGNFTKCNAGLGFSNADLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLNASYYHTVSPLTNTAVGAE  201



>ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Vitis vinifera]
Length=276

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK ARDLLYRDYQ+DHKFT+TTY+ +GV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MGKGPGLYSDIGKIARDLLYRDYQSDHKFTVTTYTSSGVAITSSGTKKGELFIADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF +PDQRSGKVELQYLH++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKTIFSFIIPDQRSGKVELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG N L+LGTD+SFDT +G FTK NAGL F+N+DLIA+LTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGNNTLSLGTDLSFDTATGNFTKCNAGLGFSNADLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLNASYYHTVSPLTNTAVGAE  201



>ref|XP_011010796.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Populus euphratica]
Length=276

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV ITSTG KKG+LFL D+++QL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAITSTGIKKGELFLADISSQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF+VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG+N +ALGTD+SFDT +G FTK NAGLS+TNSDLIASLT+NDKGD
Sbjct  121  LGLTANPIVNFSGVVGSNVVALGTDLSFDTATGNFTKCNAGLSYTNSDLIASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+PL++TAVGAE
Sbjct  181  TLSASYYHTVSPLTSTAVGAE  201



>ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=276

 Score =   335 bits (858),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKARDLLY+DYQ DHKFT+TTY+ TGV ITSTG KKG+++LGD+ +QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQGDHKFTVTTYTSTGVAITSTGIKKGEIYLGDITSQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SNV TTITVDE APGLK I SF++PDQRSGKVELQY H+HAGISTS
Sbjct  61   KNKNITTDIKVDTSSNVSTTITVDEPAPGLKTIFSFKIPDQRSGKVELQYQHEHAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV+G++A+ALGTD+SFDT SG FTK NAGLS++N+DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVIGSSAVALGTDLSFDTASGNFTKLNAGLSYSNTDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLNASYYHIVSPLTNTAVGAE  201



>gb|AFK40985.1| unknown [Lotus japonicus]
Length=276

 Score =   334 bits (857),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGK+ARDLL++DY +D KFTITTYSPTGV ITS+G +KG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIEKGELFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTT+TVDE APGLK I SFRVPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLT NPIVNFSGVVGTNA A+GTD+SFDTK G  TK+NAGL+FT +DLIASLT+NDKGD
Sbjct  121  VGLTPNPIVNFSGVVGTNARAVGTDLSFDTKIGELTKFNAGLNFTKADLIASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH VNPL+NTA GAE
Sbjct  181  ALNASYYHIVNPLTNTAFGAE  201



>ref|XP_008341536.1| PREDICTED: outer plastidial membrane protein porin-like [Malus 
domestica]
Length=275

 Score =   334 bits (857),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYTDIGKKARDLLY+DYQ+D KFTITT+SPTGV IT++G+ KG+LFLGDVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYKDYQSDKKFTITTFSPTGVAITTSGTNKGELFLGDVNTQLKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  437
            N+TTD KVDT+SN+ TTITVD+ APGLK I  F+VPDQRSGKVELQYLHD+AGIS+SVGL
Sbjct  63   NVTTDIKVDTDSNLSTTITVDQPAPGLKAIFCFKVPDQRSGKVELQYLHDYAGISSSVGL  122

Query  438  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  617
            TANPIVNFSGV+GTN LALG D+SFDTK+G  TK NAGLSF+N+DLIA+LTLNDKGD LS
Sbjct  123  TANPIVNFSGVIGTNQLALGADLSFDTKTGILTKCNAGLSFSNADLIAALTLNDKGDILS  182

Query  618  ASYYHHVNPLSNTAVGAE  671
            ASYYH VNPLSNTAVGAE
Sbjct  183  ASYYHSVNPLSNTAVGAE  200



>ref|XP_010242364.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nelumbo nucifera]
Length=276

 Score =   334 bits (857),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLY+DYQ DHKFT+TT++  GV ITSTG KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQNDHKFTLTTFTSAGVAITSTGLKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSNVFTTITV+E APGLK I SF VPDQ+SGK ELQYLHDHAGISTS
Sbjct  61   KNKNITTDVKVDTNSNVFTTITVNEPAPGLKTIVSFVVPDQKSGKAELQYLHDHAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+PIVNFSGVVGT+A ++GTD+SFDT +G F KYNAGLSF+N+DLIASLTLNDKGD
Sbjct  121  IGLTASPIVNFSGVVGTSAASIGTDLSFDTSTGKFVKYNAGLSFSNADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH V+PL+NTAVGAE
Sbjct  181  KLTASYYHTVSPLTNTAVGAE  201



>ref|XP_011085779.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   334 bits (856),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLLY+DY +D KFT+TTYSPTGV +TSTG+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSTGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K+KN+TTD KVDT+SN+ TT+TVDE  PGLK I SFRVPDQRSGK+ELQYLH++AGIS+S
Sbjct  61   KHKNVTTDIKVDTSSNLHTTVTVDEPTPGLKTILSFRVPDQRSGKLELQYLHEYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVG N LALG+DVSFDTK GAF K N G SFTN+DLIA+LTLNDKGD
Sbjct  121  VGLTANPIVNFSGVVGNNKLALGSDVSFDTKEGAFIKCNFGASFTNADLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+PLSNTAVGAE
Sbjct  181  TLSASYYHIVSPLSNTAVGAE  201



>ref|XP_010066951.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Eucalyptus grandis]
 gb|KCW65006.1| hypothetical protein EUGRSUZ_G02544 [Eucalyptus grandis]
Length=276

 Score =   333 bits (855),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLY+DYQ DHKFTITTY+ TG+ +TSTG KKG+ FL DV+TQL
Sbjct  1    MAKGPGLYSDIGKKARDLLYKDYQGDHKFTITTYTSTGIALTSTGIKKGEFFLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG N LALGTD+SFDT SG FTK NAGLSFTNSDLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGNNLLALGTDLSFDTASGNFTKCNAGLSFTNSDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+PL++TAVGAE
Sbjct  181  TLSASYYHTVSPLTSTAVGAE  201



>ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nelumbo nucifera]
Length=276

 Score =   333 bits (855),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV +TSTG KKG+LFL D+NTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQSDHKFTLTTYTSTGVAVTSTGIKKGELFLADINTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSNVFTTITVDE APGLK I SF+VPDQRSGK ELQYLHD+AGIS S
Sbjct  61   KNKNITTDIKVDTNSNVFTTITVDEPAPGLKTILSFKVPDQRSGKAELQYLHDYAGISAS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVGT+A ++GTD+SFDT SG FTK+NAG S +N+DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGTSAASVGTDLSFDTASGNFTKFNAGASLSNADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL++TAVGAE
Sbjct  181  TLTASYYHIVSPLTHTAVGAE  201



>ref|XP_011085778.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   333 bits (853),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLLY+DY +D KFT+TTYSPTGV +TS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSSGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K+KNITTD KVDTNSN+ TT+TVDE  PGLK I SFRVPDQRSGK+ELQYLHD+AGIS++
Sbjct  61   KHKNITTDIKVDTNSNLHTTVTVDEPTPGLKTILSFRVPDQRSGKLELQYLHDYAGISSN  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVG N +ALG+DVSFDTK GAF K N G SFTN+DLIA+LTLNDKGD
Sbjct  121  VGLTANPIVNFSGVVGNNKVALGSDVSFDTKEGAFVKCNFGASFTNADLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+PL+NTAVGAE
Sbjct  181  TLSASYYHIVSPLTNTAVGAE  201



>ref|XP_002282471.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Vitis vinifera]
 emb|CAN61274.1| hypothetical protein VITISV_039065 [Vitis vinifera]
 emb|CBI22157.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   332 bits (852),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQ+DHK TIT+ SPTGV ITS+G+KKGD+F+ DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKLTITSCSPTGVAITSSGTKKGDIFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD K+DT+SN+F T+TVDE APGLK I +F+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDVKIDTSSNLFVTVTVDEPAPGLKSIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSG +GTN +ALGTD+SFDTKSG FTK NAG+SF N+DLIASLT+NDKGD
Sbjct  121  IGLTANPIVNFSGTIGTNVVALGTDLSFDTKSGNFTKCNAGVSFCNADLIASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +++ASY+H VN L+NTAVGAE
Sbjct  181  AVNASYFHSVNLLTNTAVGAE  201



>ref|NP_001238377.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
 dbj|BAG09368.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=276

 Score =   332 bits (852),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LFL DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+GTN LALG D+SFDTK G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+A+YYH VNPL+NTAVGAE
Sbjct  181  ALNAAYYHVVNPLTNTAVGAE  201



>ref|XP_006378154.1| porin family protein [Populus trichocarpa]
 gb|ABK92505.1| unknown [Populus trichocarpa]
 gb|ERP55951.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   332 bits (851),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+  GV ITSTG KKG+LFL D+++QL
Sbjct  1    MGKGPGLYFDIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSTGIKKGELFLADISSQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF+VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG+N +ALGTD+SFDT +G FTK NAGLS+TNSDLIASLT+NDKGD
Sbjct  121  LGLTANPIVNFSGVVGSNVVALGTDLSFDTATGNFTKCNAGLSYTNSDLIASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+PL++TAVGAE
Sbjct  181  TLSASYYHTVSPLTSTAVGAE  201



>gb|EYU34113.1| hypothetical protein MIMGU_mgv1a011597mg [Erythranthe guttata]
Length=276

 Score =   332 bits (850),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLL RDYQ+D KFT+TT SPTGV +TSTG+KKGDLFL D+NTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLNRDYQSDQKFTLTTCSPTGVTLTSTGTKKGDLFLADINTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K+KN+TTDFKVDT SN+FTT+T+DE APGLK I SF+VPDQRSGK+ELQYLHD+AGIS+S
Sbjct  61   KHKNVTTDFKVDTGSNLFTTVTIDEPAPGLKTIISFKVPDQRSGKLELQYLHDYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVG N  ++G+DVS+DTK GA TK N G SFTN+DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVVGNNLFSVGSDVSYDTKEGALTKCNFGASFTNADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SLSASYYH V P++NTAVGAE
Sbjct  181  SLSASYYHTVTPVTNTAVGAE  201



>ref|XP_003552508.1| PREDICTED: outer plastidial membrane protein porin-like isoform 
1 [Glycine max]
 gb|KHN13654.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   332 bits (850),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LFL DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+GTN LALG D+SFD+K G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDSKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+A+YYH VNPL+NTAVGAE
Sbjct  181  ALNAAYYHVVNPLTNTAVGAE  201



>ref|XP_002312708.1| porin family protein [Populus trichocarpa]
 gb|ABK94257.1| unknown [Populus trichocarpa]
 gb|EEE90075.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   332 bits (850),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV +TSTG KKG+LFL DV+ QL
Sbjct  1    MGKGPGLYVDIGKKARDLLYKDYQSDHKFTVTTYTSTGVALTSTGIKKGELFLADVSGQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF+VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV+G+N ++LGTD+SFDT +G FTKYNAGLS+TN+DLIASLT+NDKGD
Sbjct  121  LGLTANPIVNFSGVIGSNVVSLGTDLSFDTATGNFTKYNAGLSYTNADLIASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V PL++TAVGAE
Sbjct  181  TLTASYYHTVRPLTSTAVGAE  201



>ref|XP_011034213.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Populus euphratica]
Length=276

 Score =   332 bits (850),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV +TSTG KKG+LFL DV+ QL
Sbjct  1    MGKGPGLYADIGKKARDLLYKDYQSDHKFTVTTYTSTGVALTSTGIKKGELFLADVSGQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF+VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV+G+N ++LGTD+SFDT +G FTKYNAGLS+TN+DLIASLT+NDKGD
Sbjct  121  LGLTANPIVNFSGVIGSNVVSLGTDLSFDTATGNFTKYNAGLSYTNADLIASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V PL++TAVGAE
Sbjct  181  TLTASYYHTVRPLTSTAVGAE  201



>gb|KJB11402.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=276

 Score =   331 bits (849),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K++N+TTD KVDT+SN+FTTITVDE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S
Sbjct  61   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV+GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGD
Sbjct  121  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VN  +NT VGAE
Sbjct  181  SVNASYYHIVNLSTNTVVGAE  201



>gb|KHN11584.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   331 bits (849),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LF+ DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+GTN LALG D+SFDTK G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+A+YYH VNPL+NTAVGAE
Sbjct  181  ALNAAYYHVVNPLTNTAVGAE  201



>gb|ACU20122.1| unknown [Glycine max]
Length=276

 Score =   331 bits (849),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LF+ DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+GTN LALG D+SFDTK G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+A+YYH VNPL+NTAVGAE
Sbjct  181  ALNAAYYHVVNPLTNTAVGAE  201



>emb|CAJ42303.1| VDAC-like porin [Plantago major]
Length=250

 Score =   330 bits (845),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGK+ARDLLY+DYQTDHKFT+TT SPTGV +TS G+KKGDLFL D+ TQL
Sbjct  22   MGKGPGLYTEIGKRARDLLYKDYQTDHKFTLTTTSPTGVTLTSAGTKKGDLFLADITTQL  81

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTDFKVDT+SN+ TTIT+DE  PG K I SF+VPDQRSGK+ELQYLHD+AGI+TS
Sbjct  82   KNKNITTDFKVDTSSNLLTTITIDEPCPGTKTILSFKVPDQRSGKLELQYLHDYAGITTS  141

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+GT  LA G D+SFDTK GA TKYN G SF+N DLIASL LNDKGD
Sbjct  142  VGLTANPIVNFSGVLGTKTLAAGADLSFDTKEGALTKYNFGASFSNVDLIASLALNDKGD  201

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH VNPL++T+VGAE
Sbjct  202  TLSASYYHIVNPLTSTSVGAE  222



>gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea]
Length=276

 Score =   330 bits (846),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLLY+DY +D KFT+TTYSPTGV +TS+G++KGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSSGTRKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+FTTITVDE APGLK I SF+VPDQRSGK+ELQYLHD+AGIS+S
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEPAPGLKTILSFKVPDQRSGKLELQYLHDYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+G NA ALG+D+SFDTK G  TK+N G S++N+DLIA+L LNDKGD
Sbjct  121  VGLTANPIVNFSGVLGNNAFALGSDLSFDTKEGNVTKWNFGASYSNADLIAALALNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V+P++NTAVG E
Sbjct  181  TLSASYYHLVSPVTNTAVGGE  201



>gb|ACU24178.1| unknown [Glycine max]
Length=276

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LFL DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGV+GTN LALG D+SFD+K G  TK NAGLSFT  DLIASL LNDKGD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDSKIGELTKSNAGLSFTKDDLIASLALNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+A+YYH VNPL+NTAVGAE
Sbjct  181  ALNAAYYHVVNPLTNTAVGAE  201



>emb|CDP00288.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGK+ARDLLY+DYQ DHKFT+TTY+  GV ITS+G KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKRARDLLYKDYQGDHKFTVTTYTANGVAITSSGIKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNS VFTTITVDE APGLK I SF VPDQRSGKVELQYLH++AGIST 
Sbjct  61   KNKNITTDVKVDTNSKVFTTITVDEPAPGLKTIISFVVPDQRSGKVELQYLHEYAGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV G + LALG D+SFDT +G FTKYNAG SFTNSDLIA+LTLNDKGD
Sbjct  121  IGLTANPIVNFSGVAGNDKLALGADLSFDTATGNFTKYNAGFSFTNSDLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLTASYYHSVSPLTNTAVGAE  201



>gb|AAQ87019.1| VDAC1.1 [Lotus japonicus]
 gb|AFK40743.1| unknown [Lotus japonicus]
Length=276

 Score =   328 bits (841),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKKARDLL++DY +D KFTITT+SPTGV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTITTFSPTGVAITSSGTKKGELFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTI V++ APGLK I SF+VPDQRSGKVELQYLHD+AGIS+S
Sbjct  61   KNKNITTDIKVDTDSNLFTTIAVNDPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV+GTN LALG D++FDTK G  TK NAGLSFT  DLIA+LTLNDKGD
Sbjct  121  IGLTANPIVNFSGVIGTNVLALGADLTFDTKIGELTKSNAGLSFTKDDLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  ALNASYYHVVSPLTNTAVGAE  201



>ref|XP_010096343.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
 gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
Length=276

 Score =   328 bits (840),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLY+DYQ DHKFTITTY+  GV ITSTG KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQADHKFTITTYTSAGVAITSTGIKKGELFLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP VNFSG VG N LA+GTD+SFDT +G FTK+NAGL+FT SDLIASLTLNDKGD
Sbjct  121  IGLTANPSVNFSGAVGNNTLAIGTDLSFDTATGNFTKFNAGLNFTRSDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  ALTASYYHSVSPLTNTAVGAE  201



>ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana sylvestris]
 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   327 bits (839),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV ITS+G KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSSTGVAITSSGLKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSNV+TTITVDE APGLK I SF +PDQRSGKVELQYLH++AGIST 
Sbjct  61   KNKNVTTDVKVDTNSNVYTTITVDEPAPGLKTIVSFVLPDQRSGKVELQYLHEYAGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+P+VNFSGV G N +ALGTD+SFDT SG FTK NAGLSF+ SDLIASL LNDKGD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTASGNFTKCNAGLSFSTSDLIASLALNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V P++NTAVGAE
Sbjct  181  TLSASYYHTVKPVTNTAVGAE  201



>ref|XP_010683253.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   327 bits (838),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGK+ARDLLYRDYQ+DHKFT+TT++  GV ITSTG+KKG+LFL DV+T+L
Sbjct  1    MVKGPGLYSDIGKRARDLLYRDYQSDHKFTLTTFTSNGVAITSTGTKKGELFLADVSTKL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
             NKNITTD KVDTNSN+FTTITVDE APGLK I SFRVPDQRSGKVELQYLH++AGISTS
Sbjct  61   TNKNITTDVKVDTNSNLFTTITVDEPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV+G + LALGTD+SFDT SG FTK NAGL+FTN+DLIASL +NDK D
Sbjct  121  LGLTANPIVNFSGVIGNSTLALGTDLSFDTASGNFTKCNAGLNFTNTDLIASLNVNDKAD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH V+PL+NTAVGAE
Sbjct  181  ILNASYYHIVSPLTNTAVGAE  201



>gb|KJB11404.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   325 bits (833),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 181/201 (90%), Gaps = 1/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTG  ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGA-ITSAGTKKGDLFLADVNTQL  59

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K++N+TTD KVDT+SN+FTTITVDE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S
Sbjct  60   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  119

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV+GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGD
Sbjct  120  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGD  179

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VN  +NT VGAE
Sbjct  180  SVNASYYHIVNLSTNTVVGAE  200



>gb|AFK39621.1| unknown [Lotus japonicus]
Length=276

 Score =   325 bits (833),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKKARDLL++DY +D KFTITT+SPTGV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTITTFSPTGVAITSSGTKKGELFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTI V++ APGLK I SF+VPDQRSGKVELQYLHD+AGIS+S
Sbjct  61   KNKNITTDIKVDTDSNLFTTIAVNDPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV+GTN LALG D++FDTK G  TK NAGL FT  DLIA+LTLND+GD
Sbjct  121  IGLTANPIVNFSGVIGTNVLALGADLTFDTKIGGLTKSNAGLGFTKDDLIAALTLNDRGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  ALNASYYHVVSPLTNTAVGAE  201



>gb|AAA96275.1| voltage-dependent anion channel protein [Spinacia oleracea]
Length=276

 Score =   324 bits (831),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGK+ARDLLYRDYQ+DHKFT+TTY+  GV ITSTG+KKG+LFL DV+T+L
Sbjct  1    MVKGPGLYSDIGKRARDLLYRDYQSDHKFTLTTYTANGVAITSTGTKKGELFLADVSTKL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
             NKNITTD KVDTNSN+FTTITVDE APGLK I SFRVPDQRSGKVELQYLH++AGISTS
Sbjct  61   TNKNITTDVKVDTNSNLFTTITVDEPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV G + LALGTD+SFDT SG FTK NAGLSFTN DLIAS+ +NDK D
Sbjct  121  LGLTANPIVNFSGVFGNSTLALGTDLSFDTASGNFTKCNAGLSFTNDDLIASVNVNDKLD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH V+PL+NTAVGAE
Sbjct  181  ILNASYYHIVSPLTNTAVGAE  201



>gb|KDP45473.1| hypothetical protein JCGZ_09722 [Jatropha curcas]
Length=274

 Score =   324 bits (831),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 180/201 (90%), Gaps = 2/201 (1%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQTD KFTITTYSPTGV ITSTG KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTITTYSPTGVAITSTGLKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K  N TTD KVDT+SN+FTTITVDE APGLK I SF+VPDQRSGK+E+QYLHD+A +S+S
Sbjct  61   KKNNFTTDVKVDTDSNLFTTITVDEPAPGLKAILSFKVPDQRSGKLEVQYLHDYAAVSSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NPIVNFSGV+G+NA++LGTD+SFDTKSG FTK NAGLS++N+DL+A+LTLNDKGD
Sbjct  121  IGLTPNPIVNFSGVIGSNAVSLGTDLSFDTKSGNFTKCNAGLSYSNADLVAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL ASYYH VNP    AVGAE
Sbjct  181  SLKASYYHIVNPTH--AVGAE  199



>ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
 gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
Length=276

 Score =   324 bits (831),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY++IGKKARDLLY+DYQ+DHKFT+TTY+  GV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF VPDQRSGKVELQY H++AGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +G TANPIVNFSGVVG N++ALGTD+SFDT +G FTK NAGLS+T++DLIASLTLNDKGD
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHTDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLNASYYHIVSPLTNTAVGAE  201



>ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana tomentosiformis]
Length=276

 Score =   324 bits (830),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV ITS+G KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSSTGVAITSSGLKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSNV+TTITVDE APGLK I SF +PDQ+SGKVELQYLH++AGIST 
Sbjct  61   KNKNVTTDVKVDTNSNVYTTITVDEPAPGLKTIVSFVLPDQKSGKVELQYLHEYAGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+P+VNFSGV G N +ALGTD+SF+T SG FTK NAGLSF+ SDLIASL LNDKGD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFNTASGNFTKCNAGLSFSTSDLIASLALNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH V P++NTAVGAE
Sbjct  181  TLSASYYHTVKPVTNTAVGAE  201



>ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Citrus sinensis]
Length=276

 Score =   323 bits (827),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY++IGKKARDLLY+DYQ+DHKFT+TTY+  GV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF VPDQRSGKVELQY H++AGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +G TANPIVNFSGVVG N++ALGTD+SFDT +G FTK NAGLS+T+ DLIASLTLNDKGD
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHIDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLNASYYHIVSPLTNTAVGAE  201



>ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Solanum lycopersicum]
Length=276

 Score =   322 bits (826),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLYRDY +DHKFTITT+S TGV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTITTFSTTGVAITSSGLKKGELFLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN++TTITVDE APGLK I SF VPDQ+SGKVELQYLH++AGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+P+VNFSGV G N +ALGTDVSFDT +G FTK NAGLSF++SDLIASL LNDKGD
Sbjct  121  IGLTASPLVNFSGVAGNNIVALGTDVSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            ++SASYYH V P++NTAVGAE
Sbjct  181  TVSASYYHTVKPVTNTAVGAE  201



>ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   322 bits (825),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTY+  GV ITS+G KKG+  L DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYTSNGVAITSSGVKKGEFLLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN TTD KVDTNSNV+TTITVDE APGLK I SF VPDQ+SGKVELQYLH++AGISTS
Sbjct  61   KNKNFTTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GL A+P+VNFSGV G N +ALGTD+SFDT SG FTK NAGL+FT SDLIASL LNDKGD
Sbjct  121  IGLAASPLVNFSGVAGNNKIALGTDLSFDTSSGNFTKCNAGLNFTTSDLIASLALNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +LSASYYH VNPL+NTAVGAE
Sbjct  181  TLSASYYHTVNPLTNTAVGAE  201



>ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum 
tuberosum]
 sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 
kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56600.1| 36kDA porin II [Solanum tuberosum]
Length=276

 Score =   322 bits (825),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV IT++G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSNV+TTITVDE APGLK I SF VPDQ+SGKVELQYLH++AGI+TS
Sbjct  61   KNKNITTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+P+VNFSGV G N +ALGTD+SFDT +G FTK NAGLSF++SDLIASL LNDKGD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            ++SASYYH V P++NTAVGAE
Sbjct  181  TVSASYYHTVKPVTNTAVGAE  201



>gb|KDP21225.1| hypothetical protein JCGZ_21696 [Jatropha curcas]
Length=276

 Score =   322 bits (825),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT TTY+  GV ITSTG KKG+LFL DV++QL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQGDHKFTFTTYTAAGVAITSTGIKKGELFLADVSSQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+FTTIT+D+ APGLK I SF++PDQRSGKV+LQY H+++GIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITIDDLAPGLKTIFSFKIPDQRSGKVDLQYQHEYSGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG + +ALGTD+SFDT SG FTK NAGLS+TN+DLIAS+TLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGNSTIALGTDLSFDTASGNFTKLNAGLSYTNADLIASVTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL++TAVGAE
Sbjct  181  TLNASYYHTVSPLTDTAVGAE  201



>ref|XP_008221678.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Prunus mume]
Length=276

 Score =   322 bits (825),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK+NAGL+FT++DLIASL LNDK D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIASLILNDKAD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +++ASYYH V+PL+NTAVGAE
Sbjct  181  TVTASYYHTVSPLTNTAVGAE  201



>gb|KHG10147.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=271

 Score =   322 bits (824),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 5/201 (2%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K++N+TTD KVDT+SN      +DE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S
Sbjct  61   KSRNVTTDIKVDTSSNA-----IDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  115

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV+GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGD
Sbjct  116  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGD  175

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNP +NTAVGAE
Sbjct  176  SVNASYYHIVNPSTNTAVGAE  196



>ref|XP_009360395.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Pyrus x bretschneideri]
Length=276

 Score =   322 bits (824),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSNV TTITVDE APGLK I SF  PDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNVITTITVDEPAPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK NAGL+F + DLIASL LNDK D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFIHCDLIASLLLNDKAD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +++ASYYH V+PL+NTAVGAE
Sbjct  181  TITASYYHTVSPLTNTAVGAE  201



>ref|XP_008389525.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Malus domestica]
Length=276

 Score =   322 bits (824),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSNV TTITVDE +PGLK I SF  PDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNVITTITVDEPSPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIV+FSGVVG N L+LGTD+SFDT SG FTK NAGL+FT+SDLIASL LNDK D
Sbjct  121  IGLTANPIVHFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFTHSDLIASLLLNDKAD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +++ASYYH V+PL+NTAVGAE
Sbjct  181  TITASYYHTVSPLTNTAVGAE  201



>ref|XP_008339931.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Malus domestica]
Length=276

 Score =   322 bits (824),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KG+L+LGDV+TQL
Sbjct  1    MVKGPGLYFDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGELYLGDVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF  PDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITIDEPAPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK NAGL+FT+SDLIASL LNDK D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFTHSDLIASLLLNDKAD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +++ASYYH V+PL+NTAVGAE
Sbjct  181  TITASYYHTVSPLTNTAVGAE  201



>ref|XP_008456460.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis melo]
Length=276

 Score =   321 bits (823),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+  GV I+STG KKGD+FL DV+TQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTAGGVAISSTGVKKGDIFLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KN NITTD KVDT+SNV TT+T+DE APGLK I SFRVPDQRSGKVELQY H++AGIST 
Sbjct  61   KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYAGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+PIVNF+GV+G   L+LGTD+SFDT SG  TK NAGLS+T+SDLIA+LTLNDKGD
Sbjct  121  IGLTASPIVNFAGVIGNEKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PLSNTAVGAE
Sbjct  181  ALTASYYHLVSPLSNTAVGAE  201



>ref|XP_010670319.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   321 bits (822),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKKARDLLY+DYQTD KF+ITTYS TGV +TS G+K+GDLF GDV+T+L
Sbjct  1    MAKGPGLYTDIGKKARDLLYKDYQTDQKFSITTYSATGVALTSCGTKEGDLFFGDVSTKL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K  NITTD KVDTNSN+ TTITVD AAPGLK I SF+VPDQRSGK+ELQYLHD+ G+ TS
Sbjct  61   KKNNITTDIKVDTNSNLVTTITVDGAAPGLKTILSFKVPDQRSGKLELQYLHDYVGVCTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VG TANPIVNFSGV+GTN +ALGTDVSFDTK+G FTKYNAGLSF + DLIA+LT NDKG+
Sbjct  121  VGATANPIVNFSGVIGTNMVALGTDVSFDTKTGNFTKYNAGLSFASEDLIAALTFNDKGN  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+AS+YH+VNP++  ++GAE
Sbjct  181  NLNASFYHYVNPMTKLSIGAE  201



>emb|CAA56601.1| 36kDa porin I [Solanum tuberosum]
Length=276

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV IT++G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVD NSNV+TTITVDE APGLK I SF VPDQ+SGKVELQYLH++AGI+TS
Sbjct  61   KNKNITTDVKVDANSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+P+VNFSGV G N +ALGTD+SFDT +G FTK NAGLSF++SDLIASL LNDKGD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            ++SASYYH V P++NTAVGAE
Sbjct  181  TVSASYYHTVKPVTNTAVGAE  201



>sp|P42054.2|VDAC_PEA RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Pisum sativum]
 emb|CAA80988.1| Porin [Pisum sativum]
Length=276

 Score =   320 bits (820),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKKARDLLY+DY +D KFTI+TYSPTGV ITS+G+KKG+LFLGDVNTQL
Sbjct  1    MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGELFLGDVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+FTTITV+E APG+K I SF+VP+Q SGKVELQYLH++AGIS+S
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVNEPAPGVKAILSFKVPEQTSGKVELQYLHEYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGL ANPIVNFS V+GTNALA G D+SFDTK G  TK NA ++F   DLI SLTLN+KGD
Sbjct  121  VGLKANPIVNFSSVIGTNALAFGADISFDTKLGELTKSNAAVNFVKDDLIGSLTLNEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             LSASYYH +NPLSNTAVG +
Sbjct  181  LLSASYYHAINPLSNTAVGVD  201



>gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca]
Length=276

 Score =   320 bits (820),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK NAGL+FT++DLIASL LNDK D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKCNAGLNFTHTDLIASLILNDKAD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +++ASYYH V+PL+NTAVGAE
Sbjct  181  TVTASYYHTVSPLTNTAVGAE  201



>gb|AID59897.1| voltage-dependent anion channel protein [Prunus persica]
Length=276

 Score =   320 bits (820),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPDQRSGKVELQY H++AGIST 
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK+NAGL+FT++DLIASL LNDK D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIASLILNDKAD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +++ASYYH V+PL+NTAVGAE
Sbjct  181  TVTASYYHTVSPLTNTAVGAE  201



>ref|XP_010033217.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW52798.1| hypothetical protein EUGRSUZ_J02133 [Eucalyptus grandis]
Length=276

 Score =   320 bits (819),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKA+DLLY+DYQ+DHKFTITT S TGV ITS  +KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKAKDLLYKDYQSDHKFTITTSSVTGVTITSAATKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+ T ITVDE  PGLK I SF VPDQRSG++ELQYLHD+AGISTS
Sbjct  61   KNKNVTTDVKVDTNSNLVTKITVDEPFPGLKTIFSFTVPDQRSGQIELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANP+VNF+ V+G+N L+LGTDVSFD+K+  FTK NAG+SF+N+DLIASL LN+KGD
Sbjct  121  VGLTANPVVNFAAVLGSNVLSLGTDVSFDSKASNFTKCNAGISFSNADLIASLALNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH VNP+++TA+GAE
Sbjct  181  SLTASYYHIVNPVTSTAIGAE  201



>gb|KJB11403.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   320 bits (819),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 179/201 (89%), Gaps = 1/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K++N+TTD KVDT+SN+FTTITVDE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S
Sbjct  61   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGV+GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL L   GD
Sbjct  121  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALY-VGD  179

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VN  +NT VGAE
Sbjct  180  SVNASYYHIVNLSTNTVVGAE  200



>ref|XP_004146750.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
 ref|XP_004162535.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
Length=276

 Score =   319 bits (818),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+  GV I+STG KKG++FL DV+TQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSGGVAISSTGIKKGEIFLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KN NITTD KVDT+SNV TT+T+DE APGLK I SFRVPDQRSGKVELQY H++AGIST 
Sbjct  61   KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYAGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+PIVNF+GV+G + L+LGTD+SFDT SG  TK NAGLS+T+SDLIA+LTLNDKGD
Sbjct  121  IGLTASPIVNFAGVIGNDKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PLSNTAVGAE
Sbjct  181  ALTASYYHLVSPLSNTAVGAE  201



>gb|EYU34669.1| hypothetical protein MIMGU_mgv1a011608mg [Erythranthe guttata]
Length=276

 Score =   319 bits (818),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGK+ARDLL +DY +D KFT+TTYSPTGV +TS+G+KKG+LFL DVNTQ 
Sbjct  1    MGKGPGLYSDIGKRARDLLNKDYNSDQKFTLTTYSPTGVTLTSSGTKKGELFLADVNTQF  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDT+SN+FTTITVDE  PGLK I SF+ PDQRSGK+ELQYLHD+AG+S+S
Sbjct  61   KNKNVTTDIKVDTSSNLFTTITVDELTPGLKTILSFKAPDQRSGKLELQYLHDYAGLSSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP+VNF+GV+G N LALG+DVSFDTK GAF KYN G SFTN+DLIA++TLN+K D
Sbjct  121  IGLTANPVVNFAGVLGNNKLALGSDVSFDTKEGAFLKYNFGASFTNADLIAAVTLNNKFD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S+SASYYH V+PL+NTAVG E
Sbjct  181  SVSASYYHTVSPLTNTAVGGE  201



>ref|XP_004302356.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   319 bits (817),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M  GPGLYT+IGKKARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGD+FL DV TQL
Sbjct  1    MANGPGLYTEIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDVFLADVTTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K +N+TTD KVDT SN+ TTITVD+  PG+K I SF+VPDQ SGK ELQYLHD+AGISTS
Sbjct  61   KKQNVTTDIKVDTESNLLTTITVDQPCPGVKAILSFKVPDQNSGKAELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANP+VNFSGV+GTN LALGTDVSFDTKSG FTK NAGL+F+N+DL+ASL LN+KGD
Sbjct  121  VGLTANPVVNFSGVLGTNLLALGTDVSFDTKSGNFTKCNAGLNFSNADLMASLNLNEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             +S S+YH + P  NTAVGAE
Sbjct  181  VVSGSFYHSLYPEQNTAVGAE  201



>gb|KJB50696.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=276

 Score =   319 bits (817),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L D++T+L
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQADHKFTLTTYTSNGVAITSTGTKKGELLLADISTEL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITT+ KVDT+S +F T+TVDE APGLK I SF  PDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTNVKVDTSSKLFATVTVDEPAPGLKTIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP+VNFSGVVG N++ +GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD
Sbjct  121  IGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLNASYYHIVSPLTNTAVGAE  201



>ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
 gb|EMJ23560.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
Length=344

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 184/210 (88%), Gaps = 1/210 (0%)
 Frame = +3

Query  42   FRFSALAAEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDL  221
            F FS     M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL
Sbjct  61   FEFSR-ETIMVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDL  119

Query  222  FLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYL  401
            +LGDV+TQLKNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPDQRSGKVELQY 
Sbjct  120  YLGDVSTQLKNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQ  179

Query  402  HDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIA  581
            H++AGIST +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK+NAGL+FT++DLIA
Sbjct  180  HEYAGISTGIGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIA  239

Query  582  SLTLNDKGDSLSASYYHHVNPLSNTAVGAE  671
            SL LNDK D+++ASYYH V+PL+NTAVGAE
Sbjct  240  SLILNDKADTVTASYYHTVSPLTNTAVGAE  269



>ref|XP_009599229.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M  GPGLY+DIGKKARDLLYRDY +DHKFT+TTY+  GV ITS+G KKG+  L DVNTQL
Sbjct  1    MVMGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYTSNGVAITSSGVKKGEFLLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN TTD KVDTNSNV+TTITVDE APGLK I SF VPDQ+SGKVELQYLH++AGISTS
Sbjct  61   KNKNFTTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GL A+P+VNFSGV G N +ALGTD+SFDT SG FTK NAGL+FT SDLIASL LNDK D
Sbjct  121  IGLAASPLVNFSGVAGNNKIALGTDLSFDTSSGNFTKCNAGLNFTTSDLIASLALNDKAD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH VNPL+NTAVGAE
Sbjct  181  TLTASYYHTVNPLTNTAVGAE  201



>gb|KGN47800.1| hypothetical protein Csa_6G404150 [Cucumis sativus]
Length=342

 Score =   319 bits (817),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+  GV I+STG KKG++FL DV+TQL
Sbjct  67   MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSGGVAISSTGIKKGEIFLADVSTQL  126

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KN NITTD KVDT+SNV TT+T+DE APGLK I SFRVPDQRSGKVELQY H++AGIST 
Sbjct  127  KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYAGISTG  186

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+PIVNF+GV+G + L+LGTD+SFDT SG  TK NAGLS+T+SDLIA+LTLNDKGD
Sbjct  187  IGLTASPIVNFAGVIGNDKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGD  246

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PLSNTAVGAE
Sbjct  247  ALTASYYHLVSPLSNTAVGAE  267



>ref|XP_007046221.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
 gb|EOY02053.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
Length=276

 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY++IGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+TQL
Sbjct  1    MGKGPGLYSEIGKKARDLLYKDYQGDHKFTVTTYTSDGVAITSTGIKKGELLLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+S +FTT+TVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTSSKLFTTVTVDEPAPGLKTIFSFVVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP+VNFSGVVG N +++GTD+SFDT SG FTK NAGL+FT+SDLIAS+T+NDK D
Sbjct  121  IGLTANPLVNFSGVVGNNCVSVGTDLSFDTASGNFTKLNAGLNFTHSDLIASVTVNDKCD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  NLTASYYHIVSPLTNTAVGAE  201



>ref|XP_002324035.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
 gb|ABK94151.1| unknown [Populus trichocarpa]
 gb|EEF04168.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
Length=274

 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 176/201 (88%), Gaps = 2/201 (1%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M  GPGLY++IGKKARDLLY+DYQTDHKFT+ T SPTGV ITS+G+KKGDL   DVNTQL
Sbjct  1    MVNGPGLYSEIGKKARDLLYKDYQTDHKFTLNTSSPTGVTITSSGTKKGDLLAADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTTITVDE APGLK I SF+VPDQRSGKVE+QYLHD+A +S+S
Sbjct  61   KNKNITTDIKVDTSSNLFTTITVDEPAPGLKTIFSFKVPDQRSGKVEIQYLHDYAAVSSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLT NPIVNFSGV+GTN  +LGTD+SFDTK+G F K NAG+S +  DLIASLTLNDKGD
Sbjct  121  VGLTVNPIVNFSGVIGTNVASLGTDLSFDTKTGDFIKCNAGVSLSKVDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH VNPL  TAVGAE
Sbjct  181  SLNASYYHIVNPL--TAVGAE  199



>ref|XP_002517470.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF45012.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=274

 Score =   316 bits (810),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 176/201 (88%), Gaps = 2/201 (1%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQTD KFTITTYSPTGV ITSTG KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTITTYSPTGVAITSTGVKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN+TTD KVDT+SN+FTT TVDE APGLK I S ++PDQRSGK+E+QYLHD+A +S+S
Sbjct  61   KQKNVTTDIKVDTDSNLFTTTTVDELAPGLKTILSCKLPDQRSGKLEIQYLHDYAAVSSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGL  NP VNFSGV+GTN ++LGT++SFDTKSG FTK NAG S++N+DLIASLTLNDKGD
Sbjct  121  VGLAPNPTVNFSGVIGTNVVSLGTELSFDTKSGNFTKCNAGFSYSNADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL ASYY  VNP+   AVGAE
Sbjct  181  SLKASYYQIVNPVH--AVGAE  199



>gb|KHG13762.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   316 bits (810),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKK+RDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+T+L
Sbjct  1    MGKGPGLYSDIGKKSRDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KN NITT+ KVDT SN+F T+TVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNNNITTNVKVDTKSNLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GL ANP+VNFSGVVG N +++GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLNASYYHIVSPLTNTAVGAE  201



>ref|XP_003532049.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Glycine max]
 gb|KHN13488.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   315 bits (807),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITTY+ TGV ITSTG +KG+++L DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PDQ+SGKVELQY H++AGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLRTTITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGINTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP+VNFSGVVG N +A+GTD+SFDT SG FTKYNAGL+ T++DLIASLTLNDKGD
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTASGNFTKYNAGLNITHADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH VNPL+NTAVGAE
Sbjct  181  NLTASYYHIVNPLTNTAVGAE  201



>ref|XP_011005064.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Populus euphratica]
Length=274

 Score =   314 bits (805),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 177/201 (88%), Gaps = 2/201 (1%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY++IGKKARDLLY+DYQTDHKFT+ T SPTGV ITS+G+KKGDL   DVNTQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQTDHKFTLNTSSPTGVTITSSGTKKGDLLAADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K+KNITTD KVDT+SN+FTTITVDE APGLK I SF+VPDQRSGKVE+QYLHD+A +S+S
Sbjct  61   KSKNITTDIKVDTSSNLFTTITVDEPAPGLKTIFSFKVPDQRSGKVEIQYLHDYAAVSSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NPIVNFSGV+GTN  +LGTD+SFDTK+G F K NAG+S +  DLIASLTLN+KGD
Sbjct  121  IGLTVNPIVNFSGVIGTNVASLGTDLSFDTKTGDFIKCNAGVSLSKVDLIASLTLNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH VNPL  TAVGAE
Sbjct  181  SLNASYYHIVNPL--TAVGAE  199



>gb|AAQ87021.1| VDAC1.3 [Lotus japonicus]
Length=276

 Score =   314 bits (805),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLL++DYQ DHKFTITTY+  GV ITSTG KKG+++L DV+T+L
Sbjct  1    MVKGPGLYSDIGKKARDLLFKDYQNDHKFTITTYTSAGVEITSTGVKKGEIYLADVSTKL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PDQ+SGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLHTTITVDEPAPGLKTIFSFIFPDQKSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+PIVNFSG++G N +A+GTD+SFDT SG FTKYNAGL+ T++DLIASLTLNDKGD
Sbjct  121  IGLTASPIVNFSGIIGNNLVAVGTDLSFDTASGNFTKYNAGLNVTHADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH V+PL+NTAVGAE
Sbjct  181  SLNASYYHVVSPLTNTAVGAE  201



>gb|KJB30018.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
 gb|KJB30019.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=276

 Score =   314 bits (804),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+T+L
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KN NITT+ KVDT S +F T+TVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNNNITTNVKVDTKSTLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GL ANP+VNFSGVVG N +++GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNFTKLNAGLNFTHSDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLNASYYHIVSPLTNTAVGAE  201



>emb|CDY28690.1| BnaCnng05760D [Brassica napus]
Length=276

 Score =   314 bits (804),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP GV ITSTG+KKG+  LGDV  QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDVVFQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KNITTDFKV T++ V  T TVDEAAPGLK I SF+ PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGVVG N LALGTDVSFDTKSG+FTK NAGL+FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVVGNNLLALGTDVSFDTKSGSFTKINAGLNFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNPL NTAVGAE
Sbjct  181  SVNASYYHIVNPLFNTAVGAE  201



>ref|XP_006408480.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
 gb|ESQ49933.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
Length=341

 Score =   315 bits (808),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 179/223 (80%), Gaps = 10/223 (4%)
 Frame = +3

Query  33   RLCFRFS----------ALAAEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTG  182
            RL  RFS             A+M KGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP G
Sbjct  44   RLYLRFSDSVELSFLSFTTEAKMVKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAG  103

Query  183  VVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRV  362
            V ITSTG+KKGDL LGDV  Q K KNITTDFKV T+S V  T TVDEAAPGLK I SF+V
Sbjct  104  VAITSTGTKKGDLLLGDVAFQSKQKNITTDFKVCTDSTVLITATVDEAAPGLKSIFSFKV  163

Query  363  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  542
            PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+G+N +ALGTDVSFDTKSG FTK 
Sbjct  164  PDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGSNVVALGTDVSFDTKSGNFTKI  223

Query  543  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAE  671
            NAGLSFT  DLIASLTLN+KGD+++ SYYH VNPL NTAVGAE
Sbjct  224  NAGLSFTKDDLIASLTLNEKGDAMNLSYYHIVNPLFNTAVGAE  266



>ref|XP_009131920.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Brassica 
rapa]
Length=276

 Score =   313 bits (802),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP GV ITSTG+KKG+  LGDV  QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDVVFQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KNITTDFKV T++ V  T TVDEAAPGLK I SF+ PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+G NALA+GTDVSFDTKSG FTK NAGL+FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVIGNNALAVGTDVSFDTKSGNFTKINAGLNFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNPL NTAVGAE
Sbjct  181  SVNASYYHIVNPLFNTAVGAE  201



>ref|NP_001241054.1| uncharacterized protein LOC100805016 [Glycine max]
 gb|ACU21099.1| unknown [Glycine max]
 gb|KHN31779.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   313 bits (801),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITTY+ TGV ITSTG +KG+++L DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ T ITVDE APGLK I SF  PDQ+SGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLRTIITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP+VNFSGVVG N +A+GTD+SFDT SG FTKYNAGL+ T++DLIASLTLNDKGD
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTTSGNFTKYNAGLNITHADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH VNPL+N+AVGAE
Sbjct  181  NLTASYYHIVNPLTNSAVGAE  201



>gb|ACU19720.1| unknown [Glycine max]
Length=241

 Score =   311 bits (796),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITTY+ TGV ITSTG +KG+++L DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PDQ+SGKVELQY H++AGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLRTTITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGINTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP+VNFSGVVG N +A+GTD+SFDT SG F KYNAGL+ T++DLIASLTLNDKGD
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTASGNFIKYNAGLNITHADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  NLTASYYHIVSPLTNTAVGAE  201



>emb|CDY66736.1| BnaCnng52100D [Brassica napus]
Length=276

 Score =   312 bits (799),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPG YTDIGKKARDLLY+D+ +D K +ITT+SP GV ITSTG+KKGD  LGDV+ QL
Sbjct  1    MGKGPGRYTDIGKKARDLLYKDHNSDQKLSITTHSPAGVAITSTGTKKGDSLLGDVSLQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KNITTD KV T+S V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLH++AGISTS
Sbjct  61   KQKNITTDLKVSTDSTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGVVGTN LALGTDVSFDTKSG FTK NAG++FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVVGTNVLALGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNPL NTAVGAE
Sbjct  181  SVNASYYHIVNPLFNTAVGAE  201



>gb|AAW22621.1| outer mitochondrial membrane protein porin 1 [Brassica napus]
Length=276

 Score =   312 bits (799),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPG YTDIGKKARDLLY+D+ +D K +ITT+SP GV ITSTG+KKGD  LGDV+ QL
Sbjct  1    MGKGPGRYTDIGKKARDLLYKDHNSDQKLSITTHSPAGVAITSTGTKKGDSLLGDVSLQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KNITTD KV T+S V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLH++AGISTS
Sbjct  61   KQKNITTDLKVSTDSTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGVVGTN LALGTDVSFDTKSG FTK NAG++FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVVGTNVLALGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNPL NTAVGAE
Sbjct  181  SVNASYYHIVNPLFNTAVGAE  201



>ref|XP_007153842.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
 gb|ESW25836.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
Length=276

 Score =   311 bits (797),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGK+ RDLL++DYQ DHKFTITT + TGV ITSTG +KG+L+L D++T+L
Sbjct  1    MVKGPGLYTDIGKRTRDLLFKDYQNDHKFTITTQTSTGVEITSTGVRKGELYLADISTKL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNIT+D KVDTNS++ TTITVDE APGLK I SF  PDQ+SGKVELQYLH++AGISTS
Sbjct  61   KNKNITSDIKVDTNSSLRTTITVDEPAPGLKAIFSFIFPDQKSGKVELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANPIVNFSGVVG N +A+GTD+SFDT SG FTKYNAGL+ T++DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGNNLVAVGTDLSFDTASGNFTKYNAGLNITHADLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLNASYYHIVSPLTNTAVGAE  201



>ref|XP_009125035.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   311 bits (797),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP GV ITSTG+KKG+  LGD   QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDGGFQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KNITTDFKV T++ V  T TVDEAAPGLK I SF+ PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGVVG N LALGTDVSFDTKSG+FTK NAGL+FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVVGNNLLALGTDVSFDTKSGSFTKINAGLNFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNPL NTAVGAE
Sbjct  181  SVNASYYHIVNPLFNTAVGAE  201



>gb|KHG20441.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   311 bits (797),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD K D+ SN+FTT+T+DE APGLK I SF VPDQ+SGKVELQY H++AGIST 
Sbjct  61   KNKNITTDVKFDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGKVELQYRHEYAGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA P+V+FSGV+G +++++GTD+SFDT SG F K NAGL+ T+SDLIAS+TLNDKGD
Sbjct  121  IGLTAKPLVSFSGVIGNDSVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLTASYYHIVSPLTNTAVGAE  201



>gb|KFK37589.1| hypothetical protein AALP_AA3G002700 [Arabis alpina]
Length=276

 Score =   311 bits (797),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTD+GKKARDL+Y+D+ +D KF+I+TYSPTGV ITSTG KKG+L +GDV  Q 
Sbjct  1    MVKGPGLYTDVGKKARDLIYKDHNSDQKFSISTYSPTGVAITSTGIKKGELLVGDVAFQS  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN+TTD KV T+S V  T TVDEAAPGLK I SF+VPDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLVTATVDEAAPGLKSIFSFKVPDQNSGKIELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+GTNALA+GTDVSFDTKSG FTK N GLSF   DLIASLTLN+KGD
Sbjct  121  MGLTQNPTVNFSGVIGTNALAIGTDVSFDTKSGNFTKINGGLSFIKEDLIASLTLNEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYHHVNPL NTAVGAE
Sbjct  181  LLNASYYHHVNPLFNTAVGAE  201



>gb|EYU22439.1| hypothetical protein MIMGU_mgv1a011543mg [Erythranthe guttata]
Length=278

 Score =   311 bits (797),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  75   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  254
            KGPGLY DIGK+ARDLLY+DYQ DHKFT+TTYS  G+ ITSTG+KKG+L LGDVNTQLKN
Sbjct  5    KGPGLYPDIGKRARDLLYKDYQGDHKFTLTTYSSNGLAITSTGTKKGELILGDVNTQLKN  64

Query  255  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            KNITTD KVDTNSNV TTITVDE APG+K I SF  PDQ+SGKVELQY H++A ISTS+G
Sbjct  65   KNITTDLKVDTNSNVCTTITVDEPAPGVKAIISFAAPDQKSGKVELQYFHEYAAISTSLG  124

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTA PIVNFSGV G++  A GTDVSFDT +G FTKYNAG+SFT +DLIAS  LNDKG SL
Sbjct  125  LTAKPIVNFSGVAGSHKAAFGTDVSFDTATGNFTKYNAGVSFTTTDLIASFILNDKGQSL  184

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASY+H V+PL+NTAVGAE
Sbjct  185  TASYFHTVSPLTNTAVGAE  203



>ref|XP_006298185.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31083.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=309

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = +3

Query  63   AEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNT  242
            A M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITS+G+KKGDL LGDV  
Sbjct  32   ATMVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDLLLGDVAF  91

Query  243  QLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGIS  422
            Q + KN+TTDFKV T+S V  T TVDEAAPGLK I SF+ PDQ SGK+ELQYLHD+AGIS
Sbjct  92   QSRQKNVTTDFKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGIS  151

Query  423  TSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDK  602
            TS+GLT NP VNFSGV+GTN LA+GTDVSFDTKSG FTK NAGLSFT  DLIASLT+N+K
Sbjct  152  TSMGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEK  211

Query  603  GDSLSASYYHHVNPLSNTAVGAE  671
            GD L+ASYYH VNPL NTAVGAE
Sbjct  212  GDLLNASYYHIVNPLFNTAVGAE  234



>ref|XP_004489166.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   310 bits (794),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKKARDLL++DY +D KF+ITTYSPTGV ITS+G+KKG+LFL DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFSITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDT SN+FTTITV+E APG+K I SF+VPDQ SGKVELQYLHD+AG+S S
Sbjct  61   KNKNVTTDIKVDTESNLFTTITVNEPAPGVKAILSFKVPDQTSGKVELQYLHDYAGLSGS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
             GL ANPIVN S VVGTN LA+G D+SFDTK G  TK NAGLS+   DLIASLTLN+KGD
Sbjct  121  FGLKANPIVNLSSVVGTNVLAIGADLSFDTKLGELTKSNAGLSYAKDDLIASLTLNNKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+AS+YH VNPL+NTA G +
Sbjct  181  ALNASFYHLVNPLTNTAFGVD  201



>ref|XP_011086392.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Sesamum indicum]
Length=278

 Score =   310 bits (793),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  75   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  254
            KGPGLY+DIGKKARDLLYRDYQ D KFT+TTY+  GV ITS+G++KGDLFL D+NTQLKN
Sbjct  5    KGPGLYSDIGKKARDLLYRDYQGDQKFTLTTYTSNGVAITSSGTRKGDLFLADINTQLKN  64

Query  255  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            KNITTD KVDT SNV+TTITVDE APG+K I SF  PDQ+SGKVELQY H+HAGISTS+G
Sbjct  65   KNITTDVKVDTYSNVYTTITVDEPAPGVKAIVSFVAPDQKSGKVELQYFHEHAGISTSLG  124

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTA PIVNFSGV G    A GTD+SFDT +G FTK NAG+SFT +DLIASL LNDKG+++
Sbjct  125  LTAKPIVNFSGVAGNQKAAFGTDISFDTATGNFTKCNAGVSFTTTDLIASLMLNDKGETV  184

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASY+H V+PL+NTAVGAE
Sbjct  185  TASYFHTVSPLTNTAVGAE  203



>gb|KJB60739.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=276

 Score =   309 bits (792),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVD+ SN+FTT+T+DE APGLK I SF VPDQ+SG VELQY H++AGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA P+V+FSGV+G + +++GTD+SFDT SG F K NAGL+ T+SDLIAS+TLNDKGD
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLTASYYHIVSPLTNTAVGAE  201



>emb|CDX91952.1| BnaC03g32540D [Brassica napus]
Length=276

 Score =   309 bits (792),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKK RDLLY+D+ +DHK +ITT+SP GV ITSTG+KKGDL LGDV  QL
Sbjct  1    MVKGPGLYTDIGKKVRDLLYKDHNSDHKLSITTHSPAGVAITSTGTKKGDLLLGDVTFQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KNITTD +V T++ V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+GTN LA GTDVSFDTKSG FTK NAG++FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNPL NTAVGAE
Sbjct  181  SVNASYYHIVNPLFNTAVGAE  201



>ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   309 bits (792),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 175/201 (87%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLYRDYQTDHKFT+TT + +GV ITS+G KKGDL LGDV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYQTDHKFTVTTLTASGVAITSSGIKKGDLLLGDVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+  TITVDE APGLK I SF VPDQ+S +VELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLATITVDEPAPGLKAILSFIVPDQKSARVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP++NFSGVVG  AL+LGTDVSFDT SG  TK NAGL+F ++DLIASL +NDKGD
Sbjct  121  LGLTANPVINFSGVVGNAALSLGTDVSFDTASGNLTKLNAGLNFIHTDLIASLLVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYY  V+P++ TAVGAE
Sbjct  181  TLTASYYQTVSPITCTAVGAE  201



>ref|XP_002884286.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60545.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   309 bits (792),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+D+ +D KF+ITT+SP GV ITSTG+KKGDL LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            + KNITTD KV T+S V  T TVDEAAPGLK I SF+VPDQ SGK+ELQYLHD+AGISTS
Sbjct  61   RQKNITTDLKVCTDSTVLITATVDEAAPGLKSIFSFKVPDQNSGKIELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+GTN LA+GTDVSFDTKSG FTK NAGLSFT  DLIASLT+N+KGD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPL NTAVGAE
Sbjct  181  LLNASYYHIVNPLFNTAVGAE  201



>gb|KJB60742.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=207

 Score =   306 bits (783),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVD+ SN+FTT+T+DE APGLK I SF VPDQ+SG VELQY H++AGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA P+V+FSGV+G + +++GTD+SFDT SG F K NAGL+ T+SDLIAS+TLNDKGD
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGA+
Sbjct  181  TLTASYYHIVSPLTNTAVGAD  201



>ref|XP_009147408.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   307 bits (787),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKA+DLLY+D+ +D KF+ITT SP GV ITS+G+KKGD  LGDV+ QL
Sbjct  1    MGKGPGLYTDIGKKAKDLLYKDHNSDQKFSITTQSPAGVGITSSGTKKGDSLLGDVSLQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KNITTD KV T++ V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLH++AGISTS
Sbjct  61   KQKNITTDLKVSTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFS V+GTN LA GTDVSFDTKSG FTK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSAVMGTNVLAAGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNPL NTAVGAE
Sbjct  181  SVNASYYHIVNPLFNTAVGAE  201



>ref|XP_011071026.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Sesamum indicum]
Length=278

 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 174/199 (87%), Gaps = 0/199 (0%)
 Frame = +3

Query  75   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  254
            KGPGLY+DIGK+ARDLLY+DYQ D KFT+TT +  GV+ITS+G+KKG+LFL DVNTQLKN
Sbjct  5    KGPGLYSDIGKRARDLLYKDYQGDQKFTLTTCTSNGVIITSSGTKKGELFLADVNTQLKN  64

Query  255  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            KNITTD KVDTNSNV TTITVDE APG+K I SF  PDQ+SGKVELQYLH++AGISTS+G
Sbjct  65   KNITTDVKVDTNSNVHTTITVDEPAPGVKAIFSFVAPDQKSGKVELQYLHEYAGISTSLG  124

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTA PIVNFSGV G +  A GTD+SFDT +G FTKYNAG+SFT +DLIASL LNDKG ++
Sbjct  125  LTAKPIVNFSGVAGNHKAAFGTDISFDTATGNFTKYNAGVSFTTTDLIASLILNDKGQTV  184

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASY+H ++PL+NTAVGAE
Sbjct  185  TASYFHTISPLTNTAVGAE  203



>emb|CDY68122.1| BnaA05g37480D [Brassica napus]
Length=276

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKA+DLLY+D+ +D KF+ITT SP GV ITS+G+KKGD  LGDV+ QL
Sbjct  1    MGKGPGLYTDIGKKAKDLLYKDHNSDQKFSITTQSPAGVGITSSGTKKGDSLLGDVSLQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KNITTD KV T++ V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLH++AGISTS
Sbjct  61   KQKNITTDLKVSTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFS V+GTN LA GTDVSFDTKSG FTK NAGLSFT  DL+ASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSAVMGTNVLAAGTDVSFDTKSGNFTKINAGLSFTKDDLVASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNPL NTAVGAE
Sbjct  181  SVNASYYHIVNPLFNTAVGAE  201



>gb|KHG01383.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
 gb|KHG16984.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=270

 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 175/201 (87%), Gaps = 6/201 (3%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYTDIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L D++T+L
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQADHKFTLTTYTSNGVAITSTGTKKGELLLADISTEL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITT+ K+      F T+TVDE APGLK I SF  PDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTNVKL------FATVTVDEPAPGLKTIFSFIAPDQRSGKVELQYQHEYAGISTS  114

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP+VNFSGVVG N++ +GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD
Sbjct  115  IGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGD  174

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  175  TLNASYYHIVSPLTNTAVGAE  195



>ref|XP_004489372.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLYRDY +D KFTITTYSPTGV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLYRDYNSDQKFTITTYSPTGVAITSSGTKKGELFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KN+NITTD KVDT+SN+ TTITV+E APG+K + SFR+PDQRSGKVE+QYLHD+ GI  S
Sbjct  61   KNRNITTDIKVDTDSNLSTTITVNEPAPGVKTVLSFRIPDQRSGKVEVQYLHDYFGIGAS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPI+N SG +GTN +ALG D+++DTK G FTK N GL+FT  DL+ASLTL DKGD
Sbjct  121  VGLTANPIINVSGTLGTNVIALGHDLTYDTKIGEFTKLNTGLNFTKDDLVASLTLTDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VN L+ TAVGAE
Sbjct  181  VLNASYYHVVNHLTKTAVGAE  201



>ref|NP_186777.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
 sp|Q9SRH5.3|VDAC1_ARATH RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=AtVDAC1; Short=VDAC-1 [Arabidopsis thaliana]
 gb|AAF03498.1|AC010676_8 putative porin [Arabidopsis thaliana]
 gb|AAK59817.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AAM47472.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AEE73632.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
Length=276

 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+D+ +D KF+ITT+SP GV ITSTG+KKGDL LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            + KNITTD KV T+S    T TVDEAAPGL+ I SF+VPDQ SGKVELQYLH++AGISTS
Sbjct  61   RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+G+N LA+GTDVSFDTKSG FTK NAGLSFT  DLIASLT+NDKGD
Sbjct  121  MGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPL NTAVGAE
Sbjct  181  LLNASYYHIVNPLFNTAVGAE  201



>gb|AAM65525.1| putative porin [Arabidopsis thaliana]
Length=276

 Score =   306 bits (783),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+D+ +D KF+ITT+SP GV ITSTG+KKGDL LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            + KNITTD KV T+S    T TVDEAAPGL+ I SF+VPDQ SGKVELQYLH++AGISTS
Sbjct  61   RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+G+N LA+GTDVSFDTKSG FTK NAGLSFT  DLIASLT+NDKGD
Sbjct  121  MGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPL NTAVGAE
Sbjct  181  LLNASYYHIVNPLFNTAVGAE  201



>emb|CDY63765.1| BnaCnng42590D [Brassica napus]
Length=276

 Score =   305 bits (782),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ D K ++TTYS TGV IT+TG+ KGDLF+GDV+TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVSTQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV T+S++ TT T DEA PGLK I S +VPDQ+SGKVELQYLHD+AGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTA+PIVNFSGVVG N LALGTDVSF+T+SG F  +NAG SFT  DLIA+LTLNDKGD
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGGFKHFNAGFSFTKDDLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPLSNT VGAE
Sbjct  181  KLNASYYHIVNPLSNTVVGAE  201



>emb|CDX85566.1| BnaA02g02470D [Brassica napus]
Length=276

 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ D K ++TTYS TGV IT+TG+ KGDLF+GDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVTTQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV T+S++ TT T DEA PGLK I S +VPDQ+SGKVELQYLHD+AGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTA+PIVNFSGVVG N LALGTDVSF+T+SG F ++NAG SFT  DLIA+LTLNDKGD
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGDFKQFNAGFSFTKDDLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPLSNT VGAE
Sbjct  181  KLNASYYHIVNPLSNTVVGAE  201



>ref|XP_009134621.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKK RDLLY+D+ +DHK +ITT+SP GV ITSTG+KKGDL LGDV   L
Sbjct  1    MVKGPGLYTDIGKKVRDLLYKDHNSDHKLSITTHSPAGVAITSTGTKKGDLLLGDVGFLL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KNITTD +V T++ V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+GTN LA GTDVSFDTKSG FTK NAG++FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNPL NTAVGAE
Sbjct  181  SVNASYYHIVNPLFNTAVGAE  201



>ref|XP_006842115.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
 gb|ERN03790.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
Length=276

 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY++IGKKARDLLY+DY +D KF +TTY+ TGV ITS+G+KKGDLFL DV TQL
Sbjct  1    MGKGPGLYSEIGKKARDLLYKDYHSDQKFILTTYTSTGVAITSSGTKKGDLFLADVTTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+ TTITVDEAAPGLK I S   PDQRSGKVELQYLHD+AGIS+S
Sbjct  61   KNKNVTTDIKVDTNSNLSTTITVDEAAPGLKTIFSCIFPDQRSGKVELQYLHDYAGISSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA PIVNFSGV+G    ALGTDV+FDT +   TK NAG SFT SDLIA+ T+NDKG+
Sbjct  121  IGLTATPIVNFSGVLGNETFALGTDVAFDTATSKLTKCNAGFSFTTSDLIAAATVNDKGN  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+ T+VGAE
Sbjct  181  TLTASYYHTVSPLTRTSVGAE  201



>ref|NP_001288964.1| mitochondrial outer membrane protein porin 3 [Brassica rapa]
 gb|ABB97031.1| unknown [Brassica rapa]
Length=276

 Score =   305 bits (782),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ D K ++TTYS TGV IT+TG+ KGDLF+GDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVTTQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV T+S++ TT T DEA PGLK I S +VPDQ+SGKVELQYLHD+AGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTA+PIVNFSGVVG N LALGTDVSF+T+SG F ++NAG SFT  DLIA+LTLNDKGD
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGDFKQFNAGFSFTKDDLIAALTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPLSNT VGAE
Sbjct  181  KLNASYYHIVNPLSNTVVGAE  201



>gb|KHN45480.1| Mitochondrial outer membrane protein porin of 34 kDa [Glycine 
soja]
Length=267

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +3

Query  117  DLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSN  296
            DLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQLKNKNITTD KVDT SN
Sbjct  8    DLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQLKNKNITTDIKVDTGSN  67

Query  297  VFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVG  476
            +FTTITV+E APGLK I SFRVPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSGVVG
Sbjct  68   LFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVVG  127

Query  477  TNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNT  656
            TN LALGTDVSFDTK G  TK+NAGL+FT  DL+ASLT+N+KGDSL+ASYYH VN L+NT
Sbjct  128  TNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNNKGDSLNASYYHTVNRLTNT  187

Query  657  AVGAE  671
            AVGAE
Sbjct  188  AVGAE  192



>emb|CDY59668.1| BnaCnng35410D [Brassica napus]
Length=276

 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQ D K +ITTYS TGV IT++G+ KGDLF+GDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSSTGVSITTSGTNKGDLFVGDVATQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV ++S++ TT T DEA PGLK I S +VPDQ+S KVELQYLH HAGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKTIVSAKVPDQKSAKVELQYLHPHAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANP+VNFSGV+GT+ LALGTDVSFDT+SG F  +NAG+SFT  DLIASLTLNDKG+
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNFKHFNAGVSFTKDDLIASLTLNDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPL NT VGAE
Sbjct  181  KLNASYYHIVNPLKNTVVGAE  201



>gb|AAS48868.1| voltage-dependent anion-selective channel [Brassica rapa subsp. 
pekinensis]
 emb|CDY69321.1| BnaA10g29750D [Brassica napus]
Length=276

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQ D K +ITTYS TGV IT++G+ KGDLFLGDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSSTGVAITTSGTNKGDLFLGDVVTQI  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV ++S++ TT T DEA PGLK I S +VPDQ+S KVELQY+H HAGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKAIVSAKVPDQKSAKVELQYMHPHAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANP+VNFSGV+GT+ LALGTDVSFDT+SG F  +N G+SFT  DLIASLTLNDKG+
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNFKHFNTGVSFTKDDLIASLTLNDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPL NT VGAE
Sbjct  181  KLTASYYHIVNPLKNTVVGAE  201



>emb|CDX74294.1| BnaA03g27530D [Brassica napus]
Length=276

 Score =   303 bits (777),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKK RDLL++D+ +DHK +ITT SP GV ITSTG+KKGDL LGDV   L
Sbjct  1    MVKGPGLYTDIGKKVRDLLFKDHNSDHKLSITTQSPAGVAITSTGTKKGDLLLGDVGFLL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KNITTD +V T++ V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+GTN LA GTDVSFDTKSG FTK NAG++FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S++ASYYH VNPL NTAVGAE
Sbjct  181  SVNASYYHIVNPLFNTAVGAE  201



>ref|XP_010512938.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Camelina 
sativa]
Length=276

 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITSTG+KKGD+ LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSTGTKKGDVLLGDVAFQS  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            + KN+TTDFKV T+S V  T TVDEAAPGLK I SF+ PDQ SGK+E+QYLH++AGISTS
Sbjct  61   RQKNVTTDFKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+GTN LA+GTD+SFDTKSG FTK NAGLSF   DLIASLT+N+K D
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDISFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPL NTAVGAE
Sbjct  181  LLNASYYHIVNPLFNTAVGAE  201



>ref|NP_001288856.1| mitochondrial outer membrane protein porin 3-like [Brassica rapa]
 gb|AAS21632.1| voltage-dependent anion-selective channel protein [Brassica rapa]
Length=276

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQ D K +IT YS TGV IT++G+ KGDLFLGDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITAYSSTGVAITTSGTNKGDLFLGDVVTQI  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV ++S++ TT T DEA PGLK I S +VPDQ+S KVELQY+H HAGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKAIVSAKVPDQKSAKVELQYMHPHAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANP+VNFSGV+GT+ LALGTDVSFDT+SG F  +N G+SFT  DLIASLTLNDKG+
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNFKHFNTGVSFTKDDLIASLTLNDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPL NT VGAE
Sbjct  181  KLNASYYHIVNPLKNTVVGAE  201



>ref|XP_010485517.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITS+G+KKGD+ LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDVLLGDVAFQS  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN+TTD KV T+S V  T TVDEAAPGLK I SF+ PDQ SGK+E+QYLHD+AGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+GTN LA+GTDVSFDTKSG FTK NAGLSF   DLIASLT+N+K D
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPL NTAVGAE
Sbjct  181  LLNASYYHIVNPLFNTAVGAE  201



>ref|XP_006400027.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
 gb|ESQ41480.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
Length=276

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ D K +ITTYS +GV IT++G+ KGDLFL DV TQ+
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSASGVAITTSGTNKGDLFLADVATQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNK  T D KV T+S++ TT T DEA PGLK I S ++PDQ+SGKVELQYLHD+AGISTS
Sbjct  61   KNKKFTADIKVATDSSLLTTFTYDEATPGLKAILSAKLPDQKSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANPIVNFSGVVGTN LALG DVSF+T+SG F  +NAG SFT  DLIASLTLNDKG+
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGADVSFNTESGNFKHFNAGFSFTKDDLIASLTLNDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPLSNT VGAE
Sbjct  181  KLNASYYHIVNPLSNTVVGAE  201



>gb|AFK34190.1| unknown [Medicago truncatula]
 gb|KEH24972.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 176/203 (87%), Gaps = 2/203 (1%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLLY+DY TD KFT+TTYSPTG+ +T++ +KKG+LFL D+NTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLYKDYNTDQKFTLTTYSPTGIALTASSTKKGELFLADINTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQ--RSGKVELQYLHDHAGIS  422
            K+KN+TTD KVDT+SN+FTTITV E APGLK I SFR+P+   +SGK E+QYLHD+AGIS
Sbjct  61   KHKNVTTDIKVDTDSNLFTTITVTEPAPGLKTILSFRIPEPELKSGKAEVQYLHDYAGIS  120

Query  423  TSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDK  602
             S+GLTANP+ NFSGV+G N +ALG D+S+DTK+G FT+ NAGL+FT  DLIASLTLN+K
Sbjct  121  ASIGLTANPVANFSGVIGNNVVALGGDLSYDTKTGVFTRLNAGLNFTKDDLIASLTLNEK  180

Query  603  GDSLSASYYHHVNPLSNTAVGAE  671
             ++L+ASYYH VNP++ TAVGAE
Sbjct  181  ANALNASYYHVVNPVTKTAVGAE  203



>gb|AFK37646.1| unknown [Lotus japonicus]
Length=177

 Score =   298 bits (762),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGK+ARDLL++DY +D KFTITTYSPTGV ITS+G KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIKKGELFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+SN+FTT+TVDE APGLK I SFRVPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLND  599
            VGLT NPIVNFSGVVGTNALA+GTD+SFDTK G  TK+NAGL+FT +DLIASLT+ND
Sbjct  121  VGLTPNPIVNFSGVVGTNALAVGTDLSFDTKIGELTKFNAGLNFTKADLIASLTVND  177



>ref|XP_010463547.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   300 bits (769),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITS+G+KKGD+ LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDVLLGDVAFQS  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN+TTD KV T+S V  T TVDEAAPGLK I SF+ PDQ SGK+E+QYLHD+AGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT NP VNFSGV+GTN LA+GTDVSFDTKSG FTK NAGLSF   DLIASLT+N+K D
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNP+ NTAVGAE
Sbjct  181  LLNASYYHIVNPVFNTAVGAE  201



>dbj|BAG09387.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=181

 Score =   296 bits (758),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT SN+FTTITV+E APGLK I SFRVPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTGSNLFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDK  602
            VGLTANPIVNFSGVVGTN LALGTDVSFDTK G  TK+NAGL+FT  DL+ASLT+N K
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNTK  178



>gb|KHG07129.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=344

 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 168/191 (88%), Gaps = 5/191 (3%)
 Frame = +3

Query  99   IGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFK  278
            IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQLK++N+TTD K
Sbjct  84   IGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQLKSRNVTTDIK  143

Query  279  VDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVN  458
            VDT+SN      +DE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVN
Sbjct  144  VDTSSNA-----IDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVN  198

Query  459  FSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHV  638
            FSGV+GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGDS++ASYYH V
Sbjct  199  FSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIV  258

Query  639  NPLSNTAVGAE  671
            NP +NTAVGAE
Sbjct  259  NPSTNTAVGAE  269



>ref|XP_010492333.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV T+S++ TT TVDE  PG+K I S R+PDQ+SGK+ELQYLHD+AGISTS
Sbjct  61   KNKNFTADIKVSTDSSLVTTFTVDEPTPGVKAILSARLPDQKSGKLELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLT +P VNFSGVVGTN LALGTDVSF+T SG F  +NAGLSFT  DLIASL L+DKG+
Sbjct  121  VGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKEDLIASLILSDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYY  VNPL+NT VGAE
Sbjct  181  KLNASYYQIVNPLTNTVVGAE  201



>gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Erythranthe guttata]
Length=278

 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  75   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  254
            KGPGLY DIGK+ARDLLY+DYQ D KFT+TTY+  GV ITS+G++KGDLFL DV+TQ+KN
Sbjct  5    KGPGLYPDIGKRARDLLYKDYQGDQKFTLTTYTSNGVAITSSGTQKGDLFLADVSTQMKN  64

Query  255  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            KNITTD KVDTNSNV+TT TVDE APG+K I SF  PDQ+SGKVELQY H+++GISTS+G
Sbjct  65   KNITTDVKVDTNSNVYTTFTVDEPAPGVKAIFSFVAPDQKSGKVELQYFHEYSGISTSLG  124

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTA PIVNFSGV G +  A GTDVSFDT++G F K NA LSFT +DL+ASL L+DKG+++
Sbjct  125  LTAKPIVNFSGVAGNHTFAFGTDVSFDTETGNFIKSNAALSFTTADLVASLGLSDKGETV  184

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASY+H V+PL+NTAVGAE
Sbjct  185  TASYFHTVSPLTNTAVGAE  203



>ref|XP_004514771.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cicer arietinum]
Length=276

 Score =   296 bits (758),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 175/201 (87%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGK+ARDLL++DYQ DHKFT+TT + +GV ITS+G +KG++FL DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTVTTQTLSGVEITSSGVRKGEIFLADVSTKV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PDQ S KVELQY H++ GI+TS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITVDEPAPGLKTIFSFIFPDQNSAKVELQYQHEYVGINTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA+PIVNFS V+G N +++G+DVSFDT SG F KYNAGL+ T++DLIASLT+NDKGD
Sbjct  121  IGLTASPIVNFSSVIGNNLVSVGSDVSFDTASGNFIKYNAGLNVTHADLIASLTINDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  181  TLNASYYHVVSPLTNTAVGAE  201



>ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   296 bits (758),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IGKKARDLLY+DY TD KFT+TTY+  GV IT++G+KK +   G++ +QLKNK
Sbjct  2    GPGLYSEIGKKARDLLYKDYLTDQKFTVTTYTSNGVAITASGTKKNEFIFGEIQSQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            NIT D K +++SN+ TT+TVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++  +G
Sbjct  62   NITVDVKANSDSNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNAGIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANPIVN SGVVGT AL++G DVSFDT SG FTKYNAGLS TN+DLIA+LTLN+KGDSL
Sbjct  122  LTANPIVNLSGVVGTKALSVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            SASYYH VNPLS+TAVGAE
Sbjct  182  SASYYHLVNPLSSTAVGAE  200



>emb|CAN67632.1| hypothetical protein VITISV_019646 [Vitis vinifera]
Length=175

 Score =   292 bits (747),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLYT+IGKKARDLLY+DYQ+DHK TIT+ SPTGV ITS+G+KKGD+F+ DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKLTITSCSPTGVAITSSGTKKGDIFVADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD K+DT+SN+F T+TVDE APGLK I +F+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDVKIDTSSNLFVTVTVDEPAPGLKSIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTL  593
            +GLTANPIVNFSG +GTN +ALGTD+SFDTKSG FTK NAG+SF N+DLIASLT+
Sbjct  121  IGLTANPIVNFSGTIGTNVVALGTDLSFDTKSGNFTKCNAGVSFCNADLIASLTV  175



>pir||B55017 porin, plastid - garden pea
Length=275

 Score =   295 bits (756),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYTDIGKKARDLLY+DY +D KFTI+TYSPTGV ITS+G+KKG L LGDVNTQL
Sbjct  1    MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGFLELGDVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITT  KVDTNSN+FTTITV+E APG+K I S +VP+QRSGK+E QYLH++AG++ S
Sbjct  61   KNKNITTQIKVDTNSNLFTTITVNEPAPGVKAILSEKVPEQRSGKLEFQYLHEYAGVNAS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGL +NP+VN SG  G+ AL++G DVSFDT +  FTKYNA ++F    LI SLTLN+KGD
Sbjct  121  VGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAAVNFVKDSLIGSLTLNEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             LSASYYH +NPLSNTAVG +
Sbjct  181  LLSASYYHAINPLSNTAVGVD  201



>ref|XP_010453637.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV T+S++ TT TVDE  PG+K I + ++PDQ+SGK+ELQYLHD+AGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTVDEPTPGVKAILTAKLPDQKSGKLELQYLHDYAGIATS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT +P VNFSGVVGTN LALGTDVSF+T SG F  +NAGLSFT  DLIASLTLNDKG+
Sbjct  121  IGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKDDLIASLTLNDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNP++NT VGAE
Sbjct  181  KLNASYYHIVNPVTNTVVGAE  201



>gb|KFK25745.1| hypothetical protein AALP_AA8G154100 [Arabis alpina]
Length=276

 Score =   295 bits (754),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ DHK T+TT S TGVVIT+TG  KG+LF+GDV TQ+
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQGDHKLTVTTSSETGVVITTTGINKGNLFVGDVATQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV T+S++ TT+T DEAAPGLK I S ++PDQ+SGK+ELQYLHD+AGI TS
Sbjct  61   KNKNFTADLKVATDSSLLTTLTYDEAAPGLKTILSAKLPDQKSGKLELQYLHDYAGICTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLTANP VNF+GVVGTN LALGTD SF+T++G     N GLSFT  DLIASL LNDKG+
Sbjct  121  VGLTANPTVNFAGVVGTNILALGTDASFNTETGNLKHLNFGLSFTKDDLIASLNLNDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPL+NT VGAE
Sbjct  181  KLNASYYHIVNPLTNTVVGAE  201



>ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IGKKARDLLYRDYQTDHKFT+TT +  GV IT+TG++K DL  G++ +Q+KNK
Sbjct  2    GPGLYSEIGKKARDLLYRDYQTDHKFTVTTCTSNGVAITATGTRKNDLIFGEIQSQIKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K +++SNV TT+TVDE A PGLK I SF +PDQRSGKVELQYLHD+AG++ S+G
Sbjct  62   NVTFDVKTNSDSNVTTTVTVDELATPGLKTIFSFVIPDQRSGKVELQYLHDYAGVNASIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANP+VN SGVVG+  +++G DV+FDT +G F KYNAGLS TN+DLIASLTLN+KGDSL
Sbjct  122  LTANPVVNLSGVVGSKNVSVGADVAFDTATGNFIKYNAGLSITNTDLIASLTLNNKGDSL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            SASYYH VNPLS+TAVGAE
Sbjct  182  SASYYHLVNPLSSTAVGAE  200



>ref|XP_010420161.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Camelina 
sativa]
Length=276

 Score =   294 bits (752),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV T+S++ TT TVDE  PG+K I S ++PDQ+SGK+ELQY HD+AGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTVDEPTPGVKAILSAKLPDQKSGKLELQYFHDYAGIATS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT +P VNFSGVVGTN LALGTDVSF+T SG F  +NAGLSFT  DLIASLTLNDKG+
Sbjct  121  IGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKDDLIASLTLNDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH V+PL+NT VGAE
Sbjct  181  KLNASYYHIVSPLTNTVVGAE  201



>ref|XP_006286537.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
 gb|EOA19435.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
Length=276

 Score =   291 bits (746),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV T+S++ TT T+DE  PG+K I S ++PDQ+SGK ELQYL+D+AGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTLDEPTPGVKAIFSAKLPDQKSGKFELQYLNDYAGIATS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            + LT +PIVNFSGVVGTN +ALGTDVSF+T+SG F  +NAG+SFT  DLIASLTLNDKG+
Sbjct  121  LSLTGSPIVNFSGVVGTNVVALGTDVSFETESGNFKHFNAGVSFTKDDLIASLTLNDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYYH VNPLSNT VGAE
Sbjct  181  KLNASYYHIVNPLSNTVVGAE  201



>ref|XP_008775594.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IG+KARDLLY+DY TD KFT+TTY+  GV IT++G+KK +   G++ +QLKNK
Sbjct  2    GPGLYSEIGRKARDLLYKDYLTDQKFTVTTYTSNGVAITASGTKKNEFIFGEIQSQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            NI+ D K +++SN+ TT+TVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++  +G
Sbjct  62   NISVDVKANSDSNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNAGIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANPIVN SGVVGT  L++G DVSFDT SG FTKYNAGLS  N+DLIA+LTLN+KGDSL
Sbjct  122  LTANPIVNLSGVVGTRGLSVGADVSFDTASGNFTKYNAGLSVINADLIAALTLNNKGDSL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            SASYYH VNPL NTAVGAE
Sbjct  182  SASYYHLVNPLWNTAVGAE  200



>ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   291 bits (744),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IGKKARDLLY+DY TD KFT+TTY+ TGV IT++G+KK +   G++ +QLK K
Sbjct  2    GPGLYSEIGKKARDLLYKDYLTDQKFTVTTYTSTGVAITASGTKKTEFIFGEIQSQLKKK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            NIT D K ++ SN+ TT+TVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++TS+G
Sbjct  62   NITVDVKANSESNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNTSIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANPIVN S V GT A A+G DVSFDT SG FTKYNAGLS TN+DLIA+LTLN+KGDSL
Sbjct  122  LTANPIVNISSVFGTKAFAVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            S SYYH V+PLS+TAVGAE
Sbjct  182  SGSYYHLVSPLSSTAVGAE  200



>gb|KHG07130.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=258

 Score =   290 bits (741),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 163/186 (88%), Gaps = 5/186 (3%)
 Frame = +3

Query  114  RDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNS  293
            +DLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQLK++N+TTD KVDT+S
Sbjct  3    KDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQLKSRNVTTDIKVDTSS  62

Query  294  NVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVV  473
            N      +DE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVNFSGV+
Sbjct  63   NA-----IDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVL  117

Query  474  GTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSN  653
            GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGDS++ASYYH VNP +N
Sbjct  118  GTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNPSTN  177

Query  654  TAVGAE  671
            TAVGAE
Sbjct  178  TAVGAE  183



>ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 167/199 (84%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IGKKARDLLYRDY TD KFT+TTY+ +GV IT++G+KK +   G++ +QLK K
Sbjct  2    GPGLYSEIGKKARDLLYRDYLTDQKFTVTTYTSSGVAITASGTKKNEFIFGEIQSQLKKK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            NIT D K ++ SN+ TT+TVDE A PGL+ I SF VP+QRSGKVELQYLHD+AG++TS+G
Sbjct  62   NITVDVKANSESNLLTTVTVDELATPGLRTIFSFVVPEQRSGKVELQYLHDYAGVNTSIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANPIVN SGV GT   A+G DVSFDT SG FTKYNAGLS TN+DLIA+LTLN+KGDSL
Sbjct  122  LTANPIVNLSGVFGTKGFAVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            SASYYH  +PLS+ AVGAE
Sbjct  182  SASYYHLASPLSSAAVGAE  200



>ref|XP_003621109.1| Outer plastidial membrane protein porin [Medicago truncatula]
 gb|AES77327.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=277

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  72   GKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLK  251
             KGPGLYTDIGKKARDLL++DY +D KFT++TYSPTGV ITS+G+KKG+LF+GDVNTQLK
Sbjct  3    AKGPGLYTDIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGTKKGELFVGDVNTQLK  62

Query  252  NKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSV  431
            NKN T D KVDT SN+FTTITV E APG+K I S +VPD  SGKVELQYLHD+AGIS ++
Sbjct  63   NKNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNI  122

Query  432  GLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDS  611
            GL ANP+VN SGV GTNALA G D+S+DTK    TK N G+SF   DL+ +LTLN+KGD 
Sbjct  123  GLKANPVVNLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDV  182

Query  612  LSASYYHHVNPLSNTAVGAE  671
            L+ASYYH +NP++NTAVG +
Sbjct  183  LNASYYHVINPVTNTAVGVD  202



>gb|AFK38338.1| unknown [Medicago truncatula]
Length=277

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  72   GKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLK  251
             KGPGLYTDIGKKARDLL++DY +D KFT++TYSPTGV ITS+G+KKG+LF+GDVNTQLK
Sbjct  3    AKGPGLYTDIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGTKKGELFVGDVNTQLK  62

Query  252  NKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSV  431
            NKN T D KVDT SN+FTTITV E APG+K I S +VPD  SGKVELQYLHD+AGIS ++
Sbjct  63   NKNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNI  122

Query  432  GLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDS  611
            GL ANP+VN SGV GTNALA G D+S+DTK    TK N G+SF   DL+ +LTLN+KGD 
Sbjct  123  GLKANPVVNLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDV  182

Query  612  LSASYYHHVNPLSNTAVGAE  671
            L+ASYYH +NP++NTAVG +
Sbjct  183  LNASYYHVINPVTNTAVGVD  202



>ref|XP_002873707.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49966.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
Length=276

 Score =   288 bits (738),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 167/201 (83%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV T+S++ TT+T DE APGLK+I   ++PD +SGK E+QY HD+A ISTS
Sbjct  61   KNKNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAAISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VG TA+PIVNFSGVVGTN LALGTDV+F+T+SG F  +NAGL+FT  DLIASL LN+KG+
Sbjct  121  VGFTASPIVNFSGVVGTNVLALGTDVAFNTESGNFKHFNAGLNFTKDDLIASLILNEKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYY  VNPL+NT VGAE
Sbjct  181  KLNASYYQIVNPLTNTVVGAE  201



>ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=276

 Score =   288 bits (737),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IGKKARDLLY+DY TD KFT+ TY+  GV IT++G+KK +L  G++ +QLKNK
Sbjct  2    GPGLYSEIGKKARDLLYKDYHTDQKFTVATYTANGVAITASGTKKNELIFGEIQSQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            NIT D K +++SN+ TT+TVDE A PGLK I SF VPDQRSGKVELQYLHDH G++ S+G
Sbjct  62   NITVDVKANSDSNLSTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDHGGVNASIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANPIVN SGVVGT+A+A+G DVSFDT +G F K NAGLS TN+DLIASLT+NDKGD +
Sbjct  122  LTANPIVNLSGVVGTDAVAVGADVSFDTANGDFIKCNAGLSITNADLIASLTVNDKGDCV  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V+PLS+TAVGAE
Sbjct  182  NASYYHLVSPLSSTAVGAE  200



>ref|XP_006660565.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Oryza brachyantha]
Length=274

 Score =   288 bits (737),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  437
            NIT D K +++SNV TT+TVDE  PGLK I SF VPDQRSGK ELQYLHD+AG+S S+GL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYLHDYAGVSASIGL  122

Query  438  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  617
            TANP+VN S V GT ALA+G DVS DT +G  TKYNAGLSFTN DLIASL LN+KGDSL+
Sbjct  123  TANPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFTNDDLIASLNLNNKGDSLT  182

Query  618  ASYYHHVNPLSNTAVGAE  671
            ASYYH VN  S TAVGAE
Sbjct  183  ASYYHIVNH-SATAVGAE  199



>gb|ACJ85253.1| unknown [Medicago truncatula]
Length=277

 Score =   288 bits (736),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  72   GKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLK  251
             KGPGLYT+IGKKARDLL++DY +D KFT++TYSPTGV ITS+G+KKG+LF+GDVNTQLK
Sbjct  3    AKGPGLYTNIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGAKKGELFVGDVNTQLK  62

Query  252  NKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSV  431
            NKN T D KVDT SN+FTTITV E APG+K I S +VPD  SGKVELQYLHD+AGIS ++
Sbjct  63   NKNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNI  122

Query  432  GLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDS  611
            GL ANP+VN SGV GTNALA G D+S+DTK    TK N G+SF   DL+ +LTLN+KGD 
Sbjct  123  GLKANPVVNLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDV  182

Query  612  LSASYYHHVNPLSNTAVGAE  671
            L+ASYYH +NP++NTAVG +
Sbjct  183  LNASYYHVINPVTNTAVGVD  202



>ref|XP_004956656.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Setaria italica]
Length=276

 Score =   287 bits (735),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 167/199 (84%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYT+IGKK RDLLYRDYQTDHKFT+TTY+  GV +T+T +KK DL +G++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYRDYQTDHKFTLTTYTSNGVAVTATSTKKADLIIGEIQSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDEAA-PGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            NIT D K +++SNV TT+T+DE A PGLK I SF VPDQRSGK ELQYLHD+AG++ S+G
Sbjct  63   NITVDVKANSDSNVITTVTIDEVATPGLKAILSFAVPDQRSGKFELQYLHDYAGVNASIG  122

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            +TANPIVN SG  GT ALA+G D+S DT +G FTKYNAGLS T+ DLIASL LN+KGDSL
Sbjct  123  MTANPIVNLSGSFGTKALAVGADISLDTATGNFTKYNAGLSVTHEDLIASLNLNNKGDSL  182

Query  615  SASYYHHVNPLSNTAVGAE  671
            +A+YYH V+ L++TAVGAE
Sbjct  183  TAAYYHSVSQLTSTAVGAE  201



>ref|XP_003578022.1| PREDICTED: mitochondrial outer membrane porin [Brachypodium distachyon]
Length=276

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYT+IGKK RDLLYRDYQTDHKFT+TTY+  GV IT+T SKK DL  G++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYRDYQTDHKFTLTTYTANGVAITATSSKKADLIFGEIQSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
             +T D K ++ SNV TT+TVDE AAPGLK I SF +PDQRSGK+ELQYLHD+AGI+ S+G
Sbjct  63   GVTVDVKANSASNVITTVTVDELAAPGLKTIFSFAIPDQRSGKLELQYLHDYAGINASIG  122

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANP+VN SG  GTNALA+G DVS DT +  FTKYNAGLSFTN DL ASL LN+KGDSL
Sbjct  123  LTANPVVNLSGSFGTNALAVGADVSLDTATKNFTKYNAGLSFTNDDLTASLNLNNKGDSL  182

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V   + TAVGAE
Sbjct  183  TASYYHFVEKSTKTAVGAE  201



>ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IGK+ARDLLY+DYQTD KFT+TTY+  GV IT++G+KK +L  G++ +QLKNK
Sbjct  2    GPGLYSEIGKQARDLLYKDYQTDQKFTVTTYTANGVAITASGTKKNELIFGEIQSQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            NIT D K  ++SN+ T + VDE A PGLK I SF +PDQRSG+VELQY HDHAG++ S+G
Sbjct  62   NITVDVKAGSDSNLSTKVAVDELATPGLKTIFSFVLPDQRSGQVELQYQHDHAGVNASIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANPIV+ SGVVGTNA+A+G DVSFDT  G F KYNAGLS TN+DLIASLT+NDKGDS+
Sbjct  122  LTANPIVSLSGVVGTNAVAVGADVSFDTAVGDFIKYNAGLSITNADLIASLTVNDKGDSV  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V+PLS+TAVGAE
Sbjct  182  NASYYHLVSPLSSTAVGAE  200



>gb|ACJ85279.1| unknown [Medicago truncatula]
 gb|AFK33360.1| unknown [Medicago truncatula]
 gb|KEH19832.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=276

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITT +  GV ITS G +KG+ FL DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTQTLAGVEITSAGVRKGEAFLADVSTKV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+ TTITVDE  PGLK I SF  P+Q+SGKVELQYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLRTTITVDETVPGLKTIFSFIYPEQKSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA P VN S V+G N +++G+DVSF+T SG+  K N GL+ T++DLIASLT+ND+GD
Sbjct  121  IGLTATPTVNISAVLGNNLVSVGSDVSFETSSGSLNKCNFGLNVTHADLIASLTVNDRGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH V+PL+NTAVGAE
Sbjct  181  SLNASYYHVVSPLTNTAVGAE  201



>gb|KEH19833.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITT +  GV ITS G +KG+ FL DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTQTLAGVEITSAGVRKGEAFLADVSTKV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+TTD KVDTNSN+ TTITVDE  PGLK I SF  P+Q+SGKVELQYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLRTTITVDETVPGLKTIFSFIYPEQKSGKVELQYLHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTA P VN S V+G N +++G+DVSF+T SG+  K N GL+ T++DLIASLT+ND+GD
Sbjct  121  IGLTATPTVNISAVLGNNLVSVGSDVSFETSSGSLNKCNFGLNVTHADLIASLTVNDRGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            SL+ASYYH V+PL+NTAVGAE
Sbjct  181  SLNASYYHVVSPLTNTAVGAE  201



>ref|XP_007046222.1| Mitochondrial outer membrane protein porin 1 isoform 2, partial 
[Theobroma cacao]
 gb|EOY02054.1| Mitochondrial outer membrane protein porin 1 isoform 2, partial 
[Theobroma cacao]
Length=224

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 166/201 (83%), Gaps = 16/201 (8%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY++IGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+TQL
Sbjct  28   MGKGPGLYSEIGKKARDLLYKDYQGDHKFTVTTYTSDGVAITSTGIKKGELLLADVSTQL  87

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDT+S +FTT+TVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  88   KNKNITTDVKVDTSSKLFTTVTVDEPAPGLKTIFSFVVPDQRSGKVELQYQHEYAGISTS  147

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLTANP+VNFSGVVG N +++GTD+SFDT SG FTK NAGL+FT+SDLIAS+T+     
Sbjct  148  IGLTANPLVNFSGVVGNNCVSVGTDLSFDTASGNFTKLNAGLNFTHSDLIASVTV-----  202

Query  609  SLSASYYHHVNPLSNTAVGAE  671
                       PL+NTAVGAE
Sbjct  203  -----------PLTNTAVGAE  212



>gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea]
Length=278

 Score =   285 bits (729),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  75   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  254
            K PGLY+DIGKKARDLLYRDY  DHKFT+T+Y+  GV ITS+  KKGD  L D++ QLKN
Sbjct  5    KSPGLYSDIGKKARDLLYRDYGGDHKFTLTSYTSNGVSITSSAVKKGDSVLADISAQLKN  64

Query  255  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            KNITTD KVDTNS V TTIT+DE APG+K I S   PDQ+SGKVELQY H++AGISTS+ 
Sbjct  65   KNITTDVKVDTNSKVLTTITIDEPAPGVKAIFSITAPDQKSGKVELQYFHEYAGISTSLF  124

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTA PIVNFSGV G   +  GTDVSFDT +G FTKYNAG+SFT +DLIASL LNDKG+ +
Sbjct  125  LTAKPIVNFSGVAGNKNVFFGTDVSFDTATGNFTKYNAGISFTTADLIASLNLNDKGEKI  184

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASY+H V+PL+NTAVGAE
Sbjct  185  TASYFHTVSPLTNTAVGAE  203



>gb|EAZ08792.1| hypothetical protein OsI_31052 [Oryza sativa Indica Group]
Length=274

 Score =   283 bits (723),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  437
            NIT D K +++SNV TT+TVDE  PGLK I SF VPDQRSGK ELQY HD+AG+S S+GL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  438  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  617
            TA+P+VN S V GT ALA+G DVS DT +G  TKYNAGLSF+N DLIASL+LN+KGDSL+
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLSLNNKGDSLT  182

Query  618  ASYYHHVNPLSNTAVGAE  671
            ASYYH VN  S TAVGAE
Sbjct  183  ASYYHIVNH-SATAVGAE  199



>ref|NP_001105619.1| voltage-dependent anion channel protein1a [Zea mays]
 gb|AAD56651.1|AF178950_1 voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   283 bits (723),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTY+  GV +T++ +KK DL LG++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K ++ SN+ TTITVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++ S+G
Sbjct  63   NMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANP+VN S   GT A+ALG D+S DT +G  TKYNA L FT+ DL+ASL LN+KGDSL
Sbjct  123  LTANPVVNLSAAFGTKAVALGADISLDTATGNLTKYNAALRFTHEDLVASLNLNNKGDSL  182

Query  615  SASYYHHVNPLSNTAVGAE  671
            + +YYH V+ L+NTAVGAE
Sbjct  183  TGAYYHKVSELTNTAVGAE  201



>ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IGKKARDLLY+DYQTDHKFT+TT +  GV IT++G++K D+  G++ +Q+KN 
Sbjct  2    GPGLYSEIGKKARDLLYKDYQTDHKFTVTTCTANGVAITASGTRKNDIIFGEIQSQIKNN  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            NIT D K +++SNV TT+T++E A PGLK I SF +PDQRSGKVEL YLHD+AG++ S+G
Sbjct  62   NITFDVKTNSDSNVTTTVTINELATPGLKTIFSFVIPDQRSGKVELHYLHDYAGVNASIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANP+VNFSGVVG+  +++G DV+FDT +G F KYNA LS TN+DLIA+L LN+KGDSL
Sbjct  122  LTANPVVNFSGVVGSKTVSVGADVAFDTATGNFIKYNASLSITNADLIAALALNNKGDSL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            SASYYH VNPLS+TAVGAE
Sbjct  182  SASYYHLVNPLSSTAVGAE  200



>ref|NP_001062983.1| Os09g0361400 [Oryza sativa Japonica Group]
 sp|Q6K548.3|VDAC1_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=OsVDAC1 [Oryza sativa Japonica Group]
 emb|CAB82853.1| voltage-dependent anion channel [Oryza sativa]
 dbj|BAD23330.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAF24897.1| Os09g0361400 [Oryza sativa Japonica Group]
 dbj|BAG87823.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87525.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  437
            NIT D K +++SNV TT+TVDE  PGLK I SF VPDQRSGK ELQY HD+AG+S S+GL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  438  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  617
            TA+P+VN S V GT ALA+G DVS DT +G  TKYNAGLSF+N DLIASL LN+KGDSL+
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLT  182

Query  618  ASYYHHVNPLSNTAVGAE  671
            ASYYH VN  S TAVGAE
Sbjct  183  ASYYHIVNH-SATAVGAE  199



>gb|EAZ44453.1| hypothetical protein OsJ_29066 [Oryza sativa Japonica Group]
Length=274

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  437
            NIT D K +++SNV TT+TVDE  PGLK I SF VPDQRSGK ELQY HD+AG+S S+GL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  438  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  617
            TA+P+VN S V GT ALA+G DVS DT +G  TKYNAGLSF+N DLIASL LN+KGDSL+
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLT  182

Query  618  ASYYHHVNPLSNTAVGAE  671
            ASYYH VN  S TAVGAE
Sbjct  183  ASYYHIVNH-SATAVGAE  199



>gb|ABK24200.1| unknown [Picea sitchensis]
Length=276

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 165/201 (82%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKK RDLL +DY  D KF+ T+Y+ TG+  TSTG KKG+ FLGD+NTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLNKDYNFDQKFSFTSYTSTGLAFTSTGIKKGEFFLGDLNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KN N+TTD KVDT+SN+F T+T+DE APGLK I SF VPDQRSGKVELQYLHD+AG+STS
Sbjct  61   KNNNVTTDIKVDTSSNLFATVTIDEPAPGLKTILSFTVPDQRSGKVELQYLHDYAGVSTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT +PI +FSGV+G +  ++G +VSFDT SG F KY+AGLSF+  D ++SLTL  KGD
Sbjct  121  IGLTPSPITHFSGVIGNDTFSVGGEVSFDTASGNFLKYDAGLSFSKPDFVSSLTLTGKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L ASY H V+PL+ TAVGAE
Sbjct  181  TLKASYLHTVSPLTKTAVGAE  201



>gb|ACF85328.1| unknown [Zea mays]
 gb|ACG42313.1| isochorismate synthase 1 [Zea mays]
 tpg|DAA39954.1| TPA: voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTY+  GV +T++ +KK DL LG++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K ++ SN+ TTITVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++ S+G
Sbjct  63   NMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANP+VN S   GT A+A+G D+S DT +G  TKYNA L FT+ DL+ASL LN+KGDSL
Sbjct  123  LTANPVVNLSAAFGTKAVAVGADISLDTATGNLTKYNAALRFTHEDLVASLNLNNKGDSL  182

Query  615  SASYYHHVNPLSNTAVGAE  671
            + +YYH V+ L+NTAVGAE
Sbjct  183  TGAYYHKVSELTNTAVGAE  201



>gb|KDO82798.1| hypothetical protein CISIN_1g0238541mg, partial [Citrus sinensis]
Length=174

 Score =   278 bits (710),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLY++IGKKARDLLY+DYQ+DHKFT+TTY+  GV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF VPDQRSGKVELQY H++AGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLT  590
            +G TANPIVNFSGVVG N++ALGTD+SFDT +G FTK NAGLS+T++DLIASLT
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHTDLIASLT  174



>ref|XP_002460110.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
 gb|EER96631.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
Length=276

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY +IGKK +DLLY+DYQTDHKFT+TTY+  GV +T++ +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYAEIGKKTKDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLIFGEIQSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            NIT D K ++ SN+ TT+TVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++ S+G
Sbjct  63   NITVDVKANSESNIITTVTVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANP+VN S   GT ALA+G DVS DT +G  TKYN+GL FT+ DLIASL+LN++GDSL
Sbjct  123  LTANPVVNLSAAFGTKALAVGADVSLDTATGNLTKYNSGLRFTHEDLIASLSLNNRGDSL  182

Query  615  SASYYHHVNPLSNTAVGAE  671
            + +YYH V+ L+NTAVGAE
Sbjct  183  TGAYYHKVSELTNTAVGAE  201



>tpg|DAA61162.1| TPA: voltage-dependent anion-selective channel protein [Zea mays]
Length=276

 Score =   278 bits (710),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTYS  GV +T+T +KK DL   ++++Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K ++ SN+ TT+TV+E A PGLK I SF VPDQRSGKVELQYLHD+AG++ SV 
Sbjct  63   NMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASVS  122

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANP+ N S   GT ALA+G ++SFD+ +G FTKYNAGL FT+ DLIASL +N+KGD+L
Sbjct  123  LTANPVANLSAAFGTKALAVGAEISFDSATGNFTKYNAGLMFTHEDLIASLNMNNKGDNL  182

Query  615  SASYYHHVNPLSNTAVGAE  671
            + +YYH V+ L+NTAVGAE
Sbjct  183  TGAYYHKVSELTNTAVGAE  201



>gb|KJB30017.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=255

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 160/201 (80%), Gaps = 21/201 (10%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L D+    
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADL----  56

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
                             F T+TVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  57   -----------------FATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  99

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GL ANP+VNFSGVVG N +++GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD
Sbjct  100  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNFTKLNAGLNFTHSDLIASLTLNDKGD  159

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYYH V+PL+NTAVGAE
Sbjct  160  TLNASYYHIVSPLTNTAVGAE  180



>gb|AAM62480.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
Length=274

 Score =   276 bits (706),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 163/201 (81%), Gaps = 2/201 (1%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLYRDYQ D KF++TTYS TGV IT+TG+ KG LFLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN T D KV T+S++ TT+T DE APGLK+I   ++PD +SGK E+QY HD+AGISTS
Sbjct  61   KNKNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VG TA PIVNFSGVVGTN L+LGTDV+++T+SG F  +NAG +FT  DL ASL LNDKG+
Sbjct  121  VGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYY  V+P  +T VGAE
Sbjct  181  KLNASYYQIVSP--STVVGAE  199



>ref|NP_001104948.1| voltage-dependent anion channel protein1b [Zea mays]
 gb|AAD56652.1|AF178951_1 voltage-dependent anion channel protein 1b [Zea mays]
Length=276

 Score =   276 bits (705),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTYS  GV +T+T +KK DL   ++++Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNK  62

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K ++ SN+ TT+TV+E A PGLK I SF VPDQRSGKVELQYLHD+AG++ SV 
Sbjct  63   NMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASVS  122

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANP+ N S   GT ALA+G ++SFD+ +G FTKYNAGL FT+ DLIASL +N+KGD+L
Sbjct  123  LTANPVANLSAGFGTKALAVGAEISFDSATGNFTKYNAGLMFTHEDLIASLNMNNKGDNL  182

Query  615  SASYYHHVNPLSNTAVGAE  671
            + +YYH V+ L+NTAVGAE
Sbjct  183  TGAYYHKVSELTNTAVGAE  201



>ref|XP_009393634.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 165/199 (83%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY +IG+KAR+LLYRDYQTDHK T+TT +  GV IT++G++K DL  G++ + +KNK
Sbjct  2    GPGLYFEIGRKARELLYRDYQTDHKVTVTTCTSNGVEITASGTRKNDLIFGEIQSHIKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K +++SNV TTIT+DE A+PGLK I SF VPDQRSGKVE+QYLHD+ GI+ S+G
Sbjct  62   NVTFDVKTNSDSNVTTTITIDELASPGLKTIFSFVVPDQRSGKVEIQYLHDYTGINASIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANP+VN SG VG+  L++G DV+FDT +G F KYNAGLS TN+DLIA+LTLN++GDSL
Sbjct  122  LTANPVVNLSGAVGSKTLSVGADVAFDTTTGKFIKYNAGLSITNADLIAALTLNNRGDSL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V  LS TAVGAE
Sbjct  182  TASYYHLVKSLSRTAVGAE  200



>sp|P46274.1|VDAC1_WHEAT RecName: Full=Mitochondrial outer membrane porin; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC 
[Triticum aestivum]
 emb|CAA54788.1| voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 164/202 (81%), Gaps = 3/202 (1%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MG GPGLY+ IGKKA+DLLYRDYQTDHKFT+TTY+  G  IT+T +KK DL +G++ +Q+
Sbjct  1    MG-GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGPAITATSTKKADLTVGEIQSQI  59

Query  249  KNKNITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGIST  425
            KNKNIT D K ++ SNV TTIT D+ AAPGLK I SF VPDQ+SGKVELQYLHD+AGI+ 
Sbjct  60   KNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVELQYLHDYAGINA  119

Query  426  SVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKG  605
            S+GLTANP+VN SG  GT+ALA+G DVS DT +  F KYNA LS+TN DLIASL LN+KG
Sbjct  120  SIGLTANPVVNLSGAFGTSALAVGADVSLDTATKNFAKYNAALSYTNQDLIASLNLNNKG  179

Query  606  DSLSASYYHHVNPLSNTAVGAE  671
            DSL+ASYYH V   S TAVGAE
Sbjct  180  DSLTASYYHIVEK-SGTAVGAE  200



>ref|NP_197013.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 ref|NP_001190314.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 sp|Q9SMX3.3|VDAC3_ARATH RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Protein HYPERSENSITIVE RESPONSE 2; Short=Athsr2; 
AltName: Full=Voltage-dependent anion-selective channel protein 
3; Short=AtVDAC3; Short=VDAC-3 [Arabidopsis thaliana]
 emb|CAA10363.1| voltage-dependent anion-selective channel protein [Arabidopsis 
thaliana]
 emb|CAC01828.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
 gb|AAL36247.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AAM67451.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AED92115.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 gb|AED92116.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
Length=274

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 162/201 (81%), Gaps = 2/201 (1%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGLYT+IGKKARDLLYRDYQ D KF++TTYS TGV IT+TG+ KG LFLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KN N T D KV T+S++ TT+T DE APGLK+I   ++PD +SGK E+QY HD+AGISTS
Sbjct  61   KNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VG TA PIVNFSGVVGTN L+LGTDV+++T+SG F  +NAG +FT  DL ASL LNDKG+
Sbjct  121  VGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L+ASYY  V+P  +T VGAE
Sbjct  181  KLNASYYQIVSP--STVVGAE  199



>gb|KJB30016.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=184

 Score =   270 bits (689),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+T+L
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KN NITT+ KVDT S +F T+TVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNNNITTNVKVDTKSTLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTL  593
            +GL ANP+VNFSGVVG N +++GTD+SFDT SG FTK NAGL+FT+SDLIASLTL
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNFTKLNAGLNFTHSDLIASLTL  175



>gb|KCW56275.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=260

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +3

Query  189  ITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  368
            +TSTG+KKG+LFL DVNTQLKNKNITTD KVDT+SN+FTTITVDE APGLK I SF+VPD
Sbjct  25   LTSTGTKKGELFLADVNTQLKNKNITTDIKVDTSSNLFTTITVDEPAPGLKSIFSFKVPD  84

Query  369  QRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNA  548
            QRSGK+ELQYLH+HAGIS+S+GLTANPIV FSGV+GT+ALALGTDVSFDTKSG F K NA
Sbjct  85   QRSGKIELQYLHEHAGISSSIGLTANPIVTFSGVIGTSALALGTDVSFDTKSGDFAKCNA  144

Query  549  GLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAE  671
            GLSF+N+DLIASLT+NDKGD+L+ASYYH VN L+NTAVGAE
Sbjct  145  GLSFSNADLIASLTVNDKGDTLAASYYHLVNGLTNTAVGAE  185



>ref|XP_006298184.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31082.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=267

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = +3

Query  132  DYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTI  311
            D+ +D KF+ITTYSP GV ITS+G+KKGDL LGDV  Q + KN+TTDFKV T+S V  T 
Sbjct  13   DHNSDQKFSITTYSPAGVAITSSGTKKGDLLLGDVAFQSRQKNVTTDFKVCTDSTVLITA  72

Query  312  TVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALA  491
            TVDEAAPGLK I SF+ PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+GTN LA
Sbjct  73   TVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLA  132

Query  492  LGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAE  671
            +GTDVSFDTKSG FTK NAGLSFT  DLIASLT+N+KGD L+ASYYH VNPL NTAVGAE
Sbjct  133  VGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHIVNPLFNTAVGAE  192



>ref|XP_009408829.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   268 bits (685),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 164/199 (82%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY+DIGKKARDLLY+DYQTD K T+TTY+  G+ I+++G+KK +L  G++ +QLKNK
Sbjct  2    GPGLYSDIGKKARDLLYKDYQTDQKVTLTTYTLNGIAISASGTKKNELIFGELQSQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            NI+ D K  ++S + TT+TVDE A PGL+ I +F +PDQ+ GKVELQYLHD+ G++ +VG
Sbjct  62   NISFDVKATSDSKLLTTVTVDELATPGLRSIFNFIIPDQQLGKVELQYLHDYVGVTAAVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            LTANPIVN SGVVGTN  ++G DVSFDT +G F K N GLS  N+DLIASLT+NDKGDS+
Sbjct  122  LTANPIVNLSGVVGTNVYSVGADVSFDTATGNFIKCNGGLSVINADLIASLTVNDKGDSI  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V+PLS+TAVGAE
Sbjct  182  NASYYHLVSPLSSTAVGAE  200



>gb|KJB60740.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60741.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60743.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60744.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=175

 Score =   264 bits (675),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKNITTD KVD+ SN+FTT+T+DE APGLK I SF VPDQ+SG VELQY H++AGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTL  593
            +GLTA P+V+FSGV+G + +++GTD+SFDT SG F K NAGL+ T+SDLIAS+TL
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTL  175



>gb|EMS51310.1| Mitochondrial outer membrane porin [Triticum urartu]
Length=596

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 165/203 (81%), Gaps = 4/203 (2%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MG GPGLY+ IGKKA+DLLYRDYQTDHKFT+TTY+  G  IT+T +KK DL LG++ +Q+
Sbjct  1    MG-GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGAAITATSTKKADLILGEIQSQI  59

Query  249  KNKNITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKV-ELQYLHDHAGIS  422
            KNKNIT D K ++ SNV TTIT D+ AAPGLK I SF VPDQ+SGKV ELQYLHD+AGI+
Sbjct  60   KNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVVELQYLHDYAGIN  119

Query  423  TSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDK  602
             S+GLTANP+VN SG  GT+ALALG DVS DT +  FTKYNA LS+TN DLIASL LN+K
Sbjct  120  ASIGLTANPVVNLSGAFGTSALALGADVSLDTATKNFTKYNAALSYTNQDLIASLNLNNK  179

Query  603  GDSLSASYYHHVNPLSNTAVGAE  671
            GDSL+ASYYH V   S TAVGAE
Sbjct  180  GDSLTASYYHIVEK-SGTAVGAE  201



>gb|EMT02908.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=667

 Score =   273 bits (699),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 165/203 (81%), Gaps = 4/203 (2%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MG GPGLY+ IGKKA+DLLYRDYQTDHKFT+TTY+  G  IT+T +KK DL LG++ +Q+
Sbjct  1    MG-GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGAAITATSTKKADLILGEIQSQI  59

Query  249  KNKNITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKV-ELQYLHDHAGIS  422
            KNKNIT D K ++ SNV TTIT D+ AAPGLK I SF VPDQ+SGKV ELQYLHD+AGI+
Sbjct  60   KNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVVELQYLHDYAGIN  119

Query  423  TSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDK  602
             S+GLTANP+VN SG  GT+ALA+G DVS DT +  FTKYNA LS+TN DLIASL LN+K
Sbjct  120  ASIGLTANPVVNLSGAFGTSALAVGADVSLDTATKNFTKYNAALSYTNQDLIASLNLNNK  179

Query  603  GDSLSASYYHHVNPLSNTAVGAE  671
            GDSL+ASYYH V   S TAVGAE
Sbjct  180  GDSLTASYYHIVEK-SGTAVGAE  201



>ref|XP_009403419.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=273

 Score =   260 bits (664),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY+D+ K+ARDLLY+DYQTD KFTITT +  GV IT++G+KK +L  G++ +Q KN 
Sbjct  2    GPGLYSDVAKRARDLLYKDYQTDQKFTITTSTLNGVSITTSGTKKNELIFGELQSQWKNN  61

Query  258  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  437
            NI+ D K  ++S   TT+TVDE  PGL+ I S  +PDQRSGKVELQYLH++AG++  +GL
Sbjct  62   NISVDVKATSDSKFATTVTVDELTPGLRSIFSVIIPDQRSGKVELQYLHNYAGVTAGIGL  121

Query  438  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  617
            TANP+VN SGVVGTN  A+G DVSFDT +G F K N GL+  N+DLIASLT+NDKGDS++
Sbjct  122  TANPVVNLSGVVGTNTYAVGADVSFDTATGNFIKCNGGLNVINADLIASLTVNDKGDSVT  181

Query  618  ASYYHHVNPLSNTAVGAE  671
            ASYYH V+PLS TAVGAE
Sbjct  182  ASYYHLVSPLS-TAVGAE  198



>ref|NP_001043433.1| Os01g0588200 [Oryza sativa Japonica Group]
 sp|Q7F4F8.1|VDAC3_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Voltage-dependent anion-selective channel protein 
3; Short=OsVDAC3 [Oryza sativa Japonica Group]
 emb|CAC80851.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAB89921.1| putative porin [Oryza sativa Japonica Group]
 dbj|BAF05347.1| Os01g0588200 [Oryza sativa Japonica Group]
 gb|EAY74735.1| hypothetical protein OsI_02626 [Oryza sativa Indica Group]
 gb|EAZ12509.1| hypothetical protein OsJ_02405 [Oryza sativa Japonica Group]
 dbj|BAG92122.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=275

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 154/199 (77%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLYRDY T HKFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYGTHHKFTLTTCTPEGVTITAAGTRKNESVFGELQTQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
             +T D K ++ S++ TT+TVDE   PGLK I S  VPDQRSGK+ELQYLH++AGI+ SVG
Sbjct  62   KLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGINASVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L +NP+VN SGV G+  L++G DV+FDT +  FTKYNA LS TNSDLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVAFDTATSNFTKYNAALSLTNSDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
             ASYYH V   SNTAVGAE
Sbjct  182  IASYYHLVKHHSNTAVGAE  200



>ref|XP_010231957.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Brachypodium 
distachyon]
Length=275

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQIKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K ++ S++ TT+TVDE   PGLK I S  VPDQRSGK+E QYLH+ AGI+ +VG
Sbjct  62   NLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLEFQYLHEFAGINANVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L  NP+VN SGV G+  L++G DVSFDT +  FTKYNA LS TN DLIASL LN+ GD+L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTNPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V P S+TAVGAE
Sbjct  182  TASYYHLVKPHSSTAVGAE  200



>gb|EMS47295.1| Outer plastidial membrane protein porin [Triticum urartu]
Length=275

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 151/199 (76%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K ++ S++ TT TVDE A PGLK I S  VPDQRSGK+ELQYLH+ AGI+ SVG
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGINASVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L  NP+VN SGV G+  L++G DVSFDT +  FTKYNA LS T  DLIASL LN+ GD+L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V   S+TAVGAE
Sbjct  182  TASYYHLVKSHSSTAVGAE  200



>emb|CAA57646.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 151/199 (76%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K ++ S++ TT TVDE A PGLK I S  VPDQRSGK+ELQYLH+ AGI+ SVG
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGINASVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L  NP+VN SGV G+  L++G DVSFDT +  FTKYNA LS T  DLIASL LN+ GD+L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V   S+TAVGAE
Sbjct  182  TASYYHLVKYTSSTAVGAE  200



>emb|CDM83072.1| unnamed protein product [Triticum aestivum]
Length=275

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 151/199 (76%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K ++ S++ TT TVDE A PGLK I S  VPDQRSGK+ELQYLH+ AG++ SVG
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGVNASVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L  NP+VN SGV G+  L++G DVSFDT +  FTKYNA LS T  DLIASL LN+ GD+L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V   S+TAVGAE
Sbjct  182  TASYYHLVKSHSSTAVGAE  200



>dbj|BAL41368.1| porin, partial [Arum maculatum]
Length=198

 Score =   246 bits (628),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 144/183 (79%), Gaps = 0/183 (0%)
 Frame = +3

Query  123  LYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVF  302
            LY+DYQTD KF  +T +  GV ITSTG+KK DL  G++ TQ+KNK +TTD KV+++S + 
Sbjct  1    LYKDYQTDQKFVFSTCAANGVAITSTGTKKNDLIFGEIQTQIKNKGVTTDLKVNSDSTLL  60

Query  303  TTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTN  482
            TTITVDE AP  K I SF VPDQRSGKVELQYLHD+AGI+ S GLTANPIVNF+ VVGTN
Sbjct  61   TTITVDEIAPRFKTILSFVVPDQRSGKVELQYLHDYAGINASFGLTANPIVNFASVVGTN  120

Query  483  ALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAV  662
             LA G D+SF+T +G FTKYN GL+ TN DL+AS TLNDK D+L+ SYYH++ P   TAV
Sbjct  121  TLAAGVDLSFNTATGDFTKYNVGLNITNDDLVASFTLNDKFDTLTTSYYHYIKPSMATAV  180

Query  663  GAE  671
            GAE
Sbjct  181  GAE  183



>ref|XP_004969385.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Setaria italica]
Length=275

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSVTTCSPHGVAITAAGTRKNESLFGELHTQIKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
             +T D K ++ S++ TTITVDE   PGLK I S  VPDQRSGK+ELQYLH++AG++ SVG
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGVNASVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L +NP+VN SGV G+  L++G DVSFDT +  FTKYNA LS TN DLIASL LN+ GD++
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTNPDLIASLHLNNHGDTM  181

Query  615  SASYYHHVNPLSNTAVGAE  671
             ASYYH V   S TAVGAE
Sbjct  182  VASYYHLVKHHSGTAVGAE  200



>ref|XP_006646048.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Oryza brachyantha]
Length=275

 Score =   247 bits (630),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLY DIGKK RDLLY+DY T  KFT+TT +  GV +T+ G++K +   G+++TQLKNK
Sbjct  2    APGLYADIGKKTRDLLYKDYGTHQKFTLTTCTSEGVAVTAAGTRKNESVFGELHTQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K ++ S++ TT+TVDE   PGLK I S  VPDQRSGK+ELQYLH++AGI+ SVG
Sbjct  62   NLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGINASVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L +NP+VN SGV G+  L++G DV+FDT +  FTKYNA LS TNS+LIAS+ LN+ GD+L
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVAFDTATSNFTKYNAALSLTNSELIASMHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            + SYYH V   SNTAVGAE
Sbjct  182  TTSYYHLVKHHSNTAVGAE  200



>gb|ABK23226.1| unknown [Picea sitchensis]
Length=276

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 155/201 (77%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGL+++IGKKA+DLL RDY  D KFT+TT+S TG+  TSTG KKG+LF GD+NTQ 
Sbjct  1    MGKGPGLFSEIGKKAKDLLTRDYNYDQKFTVTTFSETGLAFTSTGVKKGELFSGDLNTQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K +N T D K+DTNSN+ TTIT+D+  P  K I SF++PDQ+SGKV+LQY HDH G+S+S
Sbjct  61   KYQNATVDVKIDTNSNILTTITLDQPIPNAKTIFSFKIPDQKSGKVDLQYFHDHVGLSSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT  PIV  SG +G++ +++G +++FDT S  F+KY+AG+  +  +  A++ L DKGD
Sbjct  121  IGLTPTPIVEVSGALGSDGISVGGEMAFDTASSTFSKYSAGIGVSKPEYTAAVILADKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            ++ ASY H VNP++ TAV AE
Sbjct  181  TVKASYTHIVNPITKTAVAAE  201



>ref|XP_004969745.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Setaria italica]
Length=275

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY+DIGKKARDLL +D+ TD KFT+TTY+  G  IT+  +KK +    ++  QLK K
Sbjct  2    GPGLYSDIGKKARDLLNKDFHTDQKFTLTTYTSNGAAITAASTKKNEAIFSEIQAQLKQK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K  T+S + TT+TV+E   PGLK I +   P+Q +GK E+QYLHD+AGI+ S G
Sbjct  62   NVTVDVKATTDSLLLTTVTVEEFGVPGLKKIVTIPFPNQAAGKAEVQYLHDYAGINASFG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L + P+VN SGV GT A+A+G DV++DT +G FTKYNAGL+FTN+DLIAS+TLN+KGDSL
Sbjct  122  LNSKPLVNLSGVFGTKAIAVGADVAYDTATGDFTKYNAGLNFTNTDLIASVTLNNKGDSL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH VN   NTAVGAE
Sbjct  182  TASYYHLVNAEKNTAVGAE  200



>dbj|BAJ99489.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K ++ S++ TT TVDE A PGLK I S  VPDQRSGK+ELQYLH+ A ++ SVG
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFASVNASVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L  +P+VN SGV G+  L++G DVSFDT +  FTKYNA LS    DLIASL LN+ GD+L
Sbjct  122  LNPSPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLAYPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V   S+TAVGAE
Sbjct  182  TASYYHLVKSHSSTAVGAE  200



>ref|XP_002458065.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
 gb|EES03185.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
Length=275

 Score =   244 bits (624),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 150/199 (75%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGVAITAAGTRKNESIFGELHTQIKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
             +T D K ++ S++ TTITVDE   PGLK I S  VPDQRSGK ELQYLH++AG++ S+G
Sbjct  62   KLTVDIKANSESDLLTTITVDELGTPGLKSILSLVVPDQRSGKFELQYLHEYAGVNASIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L  NP+VN SGV G+ AL++G DVSFDT +  FTKYNA LS T+ DLIASL LN+ GD+L
Sbjct  122  LNPNPMVNISGVFGSKALSVGVDVSFDTATSNFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
              SYYH V   S TAVGAE
Sbjct  182  VGSYYHLVKHHSGTAVGAE  200



>ref|NP_001278544.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF81491.1| unknown [Zea mays]
Length=275

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 151/199 (76%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTSSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
             +T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+E QYLH++AG++ SVG
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L +NP+VN SG  G+ AL++G DVSFDT S  FTKYNA LS T+ DLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTASSDFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
             ASYYH V   S TAVGAE
Sbjct  182  VASYYHLVKNHSGTAVGAE  200



>gb|AFW83107.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 151/199 (76%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
             +T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+E QYLH++AG++ SVG
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L +NP+VN SG  G+ AL++G DVSFDT +  FTKYNA LS T+ DLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
             ASYYH V   S TAVGAE
Sbjct  182  VASYYHLVKNHSGTAVGAE  200



>gb|ACG25664.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 150/199 (75%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLY+DY T  KF++TT SP G+ IT+ G++K +   GD++TQ+KN 
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGIAITAAGTRKNESTFGDLHTQIKNN  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
             +T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+ELQYLH++ G++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEIGTPGLKSILTLVVPDQRSGKLELQYLHEYTGVNASIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L +NP+VN SG  G+ AL++G DVSFDT+S  FTKYNA LS  N DLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTESSNFTKYNAALSLANPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
             ASYYH V   S TAVGAE
Sbjct  182  VASYYHLVKHHSGTAVGAE  200



>gb|ACG45954.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 150/199 (75%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLY+DY T  KF +TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
             +T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+E QYLH++AG++ SVG
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L +NP+VN SG  G+ AL++G DVSFDT +  FTKYNA LS T+ DLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
             ASYYH V   S TAVGAE
Sbjct  182  VASYYHLVKNHSGTAVGAE  200



>ref|NP_001141587.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF86667.1| unknown [Zea mays]
 tpg|DAA58725.1| TPA: outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 150/199 (75%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
             PGLYTDIGKK RDLLY+DY T  KF++TT SP G+ IT+ G++K +   GD++TQ+KN 
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGIAITAAGTRKNESTFGDLHTQIKNN  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
             +T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+ELQYLH++ G++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEIGTPGLKSILTLVVPDQRSGKLELQYLHEYTGVNASIG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L +NP+VN SG  G+ AL++G DVSFDT++  FTKYNA LS  N DLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTETSNFTKYNAALSLANPDLIASLHLNNHGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
             ASYYH V   S TAVGAE
Sbjct  182  VASYYHLVKHHSGTAVGAE  200



>sp|P42057.1|VDAC_MAIZE RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Zea mays]
 emb|CAA51828.1| porin [Zea mays]
Length=277

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = +3

Query  84   GLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNI  263
            GLYTDIGKK RDLLY+DY T  KF +TT SP GV IT+ G++K +   G+++TQ+KNK +
Sbjct  6    GLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQIKNKKL  65

Query  264  TTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLT  440
            T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+E QYLH++AG++ SVGL 
Sbjct  66   TVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVGLN  125

Query  441  ANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSA  620
            +NP+VN SG  G+ AL++G DVSFDT +  FTKYNA LS T+ DLIASL LN+ GD+L A
Sbjct  126  SNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVA  185

Query  621  SYYHHVNPLSNTAVGAE  671
            SYYH V   S TAVGAE
Sbjct  186  SYYHLVKNHSGTAVGAE  202



>gb|KJB30164.1| hypothetical protein B456_005G132100 [Gossypium raimondii]
Length=335

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 143/179 (80%), Gaps = 7/179 (4%)
 Frame = +3

Query  156  TITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSN---VFTTITVDEA  326
             +  YSPT V IT  G KK DLFL DVNTQLK +N+TTD KVDT+SN   +FTTITVDE 
Sbjct  82   CLIVYSPTDVAITFAGMKKCDLFLADVNTQLKFRNVTTDIKVDTSSNGLQLFTTITVDEP  141

Query  327  APGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDV  506
            APGLK I  F+VPDQRSGK++LQYL+++A IS+S+GLT NPIVNFSGV GTN LALGTD+
Sbjct  142  APGLKTIFGFKVPDQRSGKIKLQYLYEYARISSSIGLTTNPIVNFSGVFGTNVLALGTDI  201

Query  507  SFDTKSGAFTKYNAGLSFTNSDLIASLTL----NDKGDSLSASYYHHVNPLSNTAVGAE  671
            SF+ K G FTK NAGLSFTN+DLIASL L    N+KGDS++ASYYH VNP +N  VGAE
Sbjct  202  SFNMKFGNFTKCNAGLSFTNADLIASLALHVVMNEKGDSVNASYYHIVNPSTNIVVGAE  260



>ref|XP_004961383.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Setaria italica]
Length=276

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 143/199 (72%), Gaps = 3/199 (2%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYT+IGKKARDLLY+DY TD KFT+TTY+  G  IT+  ++K +    ++ +QLK++
Sbjct  5    GPGLYTEIGKKARDLLYKDYHTDQKFTLTTYASNGAAITAASTRKNEAIFSEIQSQLKHE  64

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K  + SNV TT TV E   PGLK I     P Q+S K ELQYLH HAG++ SVG
Sbjct  65   NVTVDVKATSESNVTTTFTVHELGTPGLKAILCIPFPYQKSAKAELQYLHHHAGVAASVG  124

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L ANP+VN SGV GT  +A+G D SFDT SG  TKYNAGLS+   D +A+ TLN+KGDSL
Sbjct  125  LNANPVVNLSGVFGTKTIAVGADASFDTSSGDLTKYNAGLSYNAGDFVAAATLNNKGDSL  184

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH VN  S TAVG E
Sbjct  185  AASYYHLVN--STTAVGGE  201



>gb|ADE77918.1| unknown [Picea sitchensis]
Length=276

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPGL+++IGKKARDLL +DY  D KF +TTYS  G+ ITSTG  KG LF GD++T  
Sbjct  1    MGKGPGLFSNIGKKARDLLTKDYSHDQKFAVTTYSEDGLGITSTGMNKGGLFCGDIDTHY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K +N T + KVDTNSN+ TTIT+DE  PG K + SF++PD++SGK++ QY H+H G+S+S
Sbjct  61   KYQNSTINVKVDTNSNISTTITIDEVLPGAKTVLSFKLPDEKSGKLDFQYSHEHVGLSSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGLT  P V+FSG +G++   +G +V FDT SG FTKYN G+  T  +  A++   DKGD
Sbjct  121  VGLTPKPQVDFSGAIGSDVFTVGGEVGFDTSSGLFTKYNGGIGITKPEFSAAILFADKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L ASY H +NP++ T   AE
Sbjct  181  TLKASYLHELNPITKTCFAAE  201



>ref|XP_002458403.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
 gb|EES03523.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
Length=277

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 147/199 (74%), Gaps = 1/199 (1%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY+DIGKKARDLL +D+ TD KF +TTYS  G VIT++ +KK +    ++  QLK K
Sbjct  2    GPGLYSDIGKKARDLLSKDFHTDQKFILTTYSSNGTVITASSTKKNESIFSEIQAQLKQK  61

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K +++S + TT+TV+E   PGLK   +   P +  GK E+QYLHD+AGIS S G
Sbjct  62   NVTVDVKANSDSLLLTTVTVEELGVPGLKKTMTIPFPHRGFGKFEIQYLHDYAGISASAG  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            + A P+VN S V G  A+A G DV++DT +  FTKYNAGLSFTN+DLIA++TLN+KG+SL
Sbjct  122  MNAKPLVNLSAVFGNKAIAAGADVAYDTATRDFTKYNAGLSFTNADLIAAVTLNNKGESL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH VN   NTAVGAE
Sbjct  182  TASYYHIVNTEKNTAVGAE  200



>ref|XP_003568015.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=278

 Score =   231 bits (590),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 147/201 (73%), Gaps = 5/201 (2%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLYT+IGKK+RDLLY+DYQTD KFT+TT +  G  IT+  +KK +  + ++ +QLK K
Sbjct  5    GPGLYTEIGKKSRDLLYKDYQTDQKFTLTTVAANGATITAASTKKNEAIVSEIQSQLKGK  64

Query  258  NITTDFKVDTNSNVFTTITVDEA-APGLKIISSFRVPDQRS--GKVELQYLHDHAGISTS  428
            N+T D KV + S+V  T+TV E   PGLK +    +P  +S  GK ELQYLH HAGI+ S
Sbjct  65   NVTVDVKVTSESSVIATVTVPELYTPGLKGMLCVPIPYNKSASGKAELQYLHAHAGINAS  124

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGL ANP+VN SGV+GT  LA G DV+FDT SG FTKYNAG+S TN DL AS+ LN+KGD
Sbjct  125  VGLNANPLVNLSGVLGTKDLAFGADVAFDTASGDFTKYNAGVSLTNEDLTASVVLNNKGD  184

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L+ASYY  V    +TAVGAE
Sbjct  185  TLAASYYQQVK--GSTAVGAE  203



>ref|XP_001779057.1| predicted protein [Physcomitrella patens]
 gb|EDQ56094.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   231 bits (590),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPG YTDIGKK +DLL +DY  D KF ITT + +G+  TSTG K+G+ F GD+NTQ 
Sbjct  1    MGKGPGFYTDIGKKTKDLLNKDYTYDQKFVITTSTKSGLAFTSTGLKRGEAFTGDLNTQF  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+T D KVDT SN+FTTIT+DE APG K + SF +PD +SGK+E+QY  D+ GI+ S
Sbjct  61   KNKNVTADVKVDTKSNIFTTITIDEFAPGAKSVFSFTIPDHKSGKLEIQYKQDYCGITGS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GL+ +PIV  +G +G +  ++G +V+FD+ +G+  KYNAG+     D  AS+ L +KGD
Sbjct  121  IGLSPSPIVEATGALGNDGFSVGGEVAFDSANGSLIKYNAGVGLVKPDFNASIILAEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L ASY H V+P+S T + AE
Sbjct  181  LLKASYLHTVSPISRTTMAAE  201



>ref|XP_001781995.1| predicted protein [Physcomitrella patens]
 gb|EDQ53219.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MGKGPG+Y+DIGKK +DLL +DY  D KF ITT + +G+  TSTG K+G+ F GDVNT  
Sbjct  1    MGKGPGMYSDIGKKTKDLLNKDYTYDQKFVITTNTQSGLAFTSTGVKRGEGFSGDVNTSF  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            KNKN+T D KVDT SN+F T+TVDE APG K + +F +PD +SGK+EL Y  D+ GIS S
Sbjct  61   KNKNVTADVKVDTKSNIFATVTVDEFAPGAKSVFTFTIPDHKSGKLELLYKQDYCGISGS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT +PIV  +G +G    ++G +++FDT SG+  KYNAG+ F   D  ASL L +KGD
Sbjct  121  IGLTPSPIVEATGALGNEGFSVGGELAFDTASGSLIKYNAGVGFVKPDFNASLMLAEKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
             L ASY H V+P+S T V AE
Sbjct  181  LLKASYLHTVSPVSRTTVAAE  201



>ref|NP_001104949.1| voltage-dependent anion channel protein2 [Zea mays]
 gb|AAD56653.1|AF178952_1 voltage-dependent anion channel protein 2 [Zea mays]
 gb|ACF85067.1| unknown [Zea mays]
 gb|ACG34248.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|AFW78894.1| outer membrane protein porinVoltage-dependent anion channel protein 
2 [Zea mays]
Length=276

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 145/199 (73%), Gaps = 3/199 (2%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IGKKARDLLY+DY TD KFT+TTY+  G  IT+  ++K +    ++ +QLK+ 
Sbjct  5    GPGLYSEIGKKARDLLYKDYHTDQKFTLTTYAANGAAITAASTRKDEAIFNEIQSQLKHN  64

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K  + SNV TTITV E   PGLK I     P Q+S K ELQYLH HAG++ SVG
Sbjct  65   NVTVDVKATSESNVITTITVHELGTPGLKAILCVPFPYQKSAKAELQYLHHHAGVAASVG  124

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L ANP+VN SGV GT A+A+G D +FDT SG  TKYNAGLS+T  D +A+ TLN+KGD++
Sbjct  125  LNANPVVNLSGVFGTKAIAVGADAAFDTSSGDLTKYNAGLSYTTPDFVAAATLNNKGDNI  184

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V+P   TAVG E
Sbjct  185  AASYYHSVSP--TTAVGGE  201



>ref|NP_001056162.1| Os05g0536200 [Oryza sativa Japonica Group]
 sp|Q6L5I5.1|VDAC2_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 2; AltName: 
Full=Voltage-dependent anion-selective channel protein 
2; Short=OsVDAC2 [Oryza sativa Japonica Group]
 emb|CAC80850.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 gb|AAT39214.1| voltage-dependent anion-selective channel (VDAC) protein [Oryza 
sativa Japonica Group]
 dbj|BAF18076.1| Os05g0536200 [Oryza sativa Japonica Group]
 dbj|BAG92718.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79592.1| hypothetical protein OsI_20774 [Oryza sativa Indica Group]
 gb|EEE64499.1| hypothetical protein OsJ_19349 [Oryza sativa Japonica Group]
Length=280

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 143/196 (73%), Gaps = 3/196 (2%)
 Frame = +3

Query  87   LYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNIT  266
            LY+DIGKKARDLLYRDY TD KFT+TTY+  G  IT  G+KK +    ++ +Q+KN N++
Sbjct  12   LYSDIGKKARDLLYRDYHTDQKFTLTTYAANGAAITVAGTKKNESIFSEIQSQVKNNNVS  71

Query  267  TDFKVDTNSNVFTTITV-DEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTA  443
             D K  ++S + TT TV D   PGLK I S   P Q+S K E+QYLH HAG++  VGL A
Sbjct  72   VDVKATSDSKLITTFTVHDLGTPGLKGILSIPFPYQKSAKAEVQYLHPHAGLNAIVGLNA  131

Query  444  NPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSAS  623
            NP+V+FSGV GT A A+GTDV+FDT +G FTKYNAGLS T  DL A+L LN+KGDSL+AS
Sbjct  132  NPLVSFSGVFGTGAFAVGTDVAFDTATGDFTKYNAGLSHTTPDLTAALLLNNKGDSLAAS  191

Query  624  YYHHVNPLSNTAVGAE  671
            YYH V+  S  AVGAE
Sbjct  192  YYHKVSKTS--AVGAE  205



>ref|XP_006845625.1| hypothetical protein AMTR_s00019p00217910 [Amborella trichopoda]
 gb|ERN07300.1| hypothetical protein AMTR_s00019p00217910 [Amborella trichopoda]
Length=275

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPG ++DIGKKARDLL RDY  D KFT+T  S  G+ +T+TG K+G  F GD++TQ 
Sbjct  1    MAKGPGPFSDIGKKARDLLTRDYNYDEKFTLTMLSDNGLALTTTGLKRGQFFTGDLSTQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K+ N T D KVDTN N+ +TITV+E  P  K   SF++PD +SGK+E+QYLHD A I++S
Sbjct  61   KSGNTTVDVKVDTNCNITSTITVNEIFPSSKTALSFKIPDHKSGKLEVQYLHDRAAINSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT  P++ FS  VG   ++LG +V+FDT + + TKYN G+  T  D  A+L + DKG+
Sbjct  121  IGLTPTPLLEFSAAVGNGEVSLGGEVAFDTATASLTKYNVGIGLTKEDYSAALMVADKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L ASY H VNP++ TAV AE
Sbjct  181  TLKASYLHTVNPVNGTAVAAE  201



>ref|XP_002440144.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
 gb|EES18574.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
Length=276

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IGKKARDLLY+DY TD KFT+TTY+  G  IT+  ++K +    ++ +QLK+ 
Sbjct  5    GPGLYSEIGKKARDLLYKDYHTDQKFTLTTYAANGAAITAASTRKDEAIFNEIQSQLKHN  64

Query  258  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K  + SN+ TTITV E   PGLK I     P Q+S K ELQYLH HAG++ SVG
Sbjct  65   NVTVDVKATSESNLITTITVHELGTPGLKGILCIPFPYQKSAKAELQYLHHHAGVAASVG  124

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L ANP+VN SGV GT  +A+G D ++DT SG  TKYNAGLS+T SD +A+ TLN KGD++
Sbjct  125  LNANPVVNLSGVFGTKTIAVGADAAYDTSSGDLTKYNAGLSYTTSDFVAAATLNHKGDNI  184

Query  615  SASYYHHVNPLSNTAVGAE  671
            +ASYYH V+P   TAVG E
Sbjct  185  AASYYHLVSP--TTAVGGE  201



>ref|XP_006655528.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Oryza brachyantha]
Length=281

 Score =   221 bits (564),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = +3

Query  78   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  257
            GPGLY++IGKKARDLLY+DY T+ KFT+TTY+  G  IT   ++K +    ++ +QLKN 
Sbjct  10   GPGLYSEIGKKARDLLYKDYHTNQKFTLTTYAANGAAITVASTRKDEAMSSEIQSQLKNN  69

Query  258  NITTDFKVDTNSNVFTTITV-DEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            N+T D K  ++S + TT TV D   PG K I S   P Q+S K E+QYLH HAG++  VG
Sbjct  70   NVTVDVKATSDSTLMTTFTVHDLCMPGTKGILSIPFPYQKSAKAEVQYLHPHAGLNACVG  129

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L+ANP+V+FSG  GT A A+G DV+FDT +G FTKYNA LS T  DL ASL LN+KGDSL
Sbjct  130  LSANPLVSFSGAFGTRAFAVGADVTFDTATGDFTKYNAALSHTTEDLTASLLLNNKGDSL  189

Query  615  SASYYHHVNPLSNTAVGAE  671
              SYYH V+ +S  AVGAE
Sbjct  190  VTSYYHSVSKVS--AVGAE  206



>ref|XP_008338437.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Malus 
domestica]
Length=276

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGL+TDIGKKA+DLL +DY +D KFTI+TYS  GV +TST  KKG L +GD+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTISTYSDAGVALTSTAVKKGGLSIGDILTQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN   D KVDT SN+ TT T++E  P  K I+SF+ PD  SGK+E+QY HDHA  +T+
Sbjct  61   KYKNTVVDVKVDTESNILTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHAAXTTA  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            V L  +P ++FS  +GT  +A G +  +DT SG FTKY AG+S T  D  AS+ L DKGD
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISITKPDQSASIILGDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S+ ASY H+++ L ++A   E
Sbjct  181  SIRASYVHYMDLLKSSAAVGE  201



>gb|KJB31318.1| hypothetical protein B456_005G186100, partial [Gossypium raimondii]
Length=247

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 135/179 (75%), Gaps = 15/179 (8%)
 Frame = +3

Query  156  TITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNV-------FTTIT  314
             +   SPTGV ITS G+KK DLFLGDVNTQLK++N+TTD KVD NSN+       FTT+ 
Sbjct  2    CLIVCSPTGVAITSAGTKKCDLFLGDVNTQLKSRNVTTDIKVDINSNIIHYVYKLFTTVI  61

Query  315  VDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALAL  494
            VD+  P LK I  FRV DQRS K        +AGIS+S+GLTANPIVN SGV+GTN LAL
Sbjct  62   VDKPIPRLKAIFGFRVSDQRSCK--------YAGISSSIGLTANPIVNLSGVLGTNVLAL  113

Query  495  GTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAE  671
            GTD+SFDTK+  FTK NA LSFTN+DLIASL LN+KG+S++ASYYH VNP +NT VG E
Sbjct  114  GTDISFDTKTKNFTKCNARLSFTNADLIASLALNEKGNSINASYYHIVNPSTNTVVGVE  172



>ref|XP_008777255.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008777256.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
isoform X1 [Phoenix dactylifera]
Length=282

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MG GP  ++DIGK+ARDLL +DY  D K T+TT S  G+ + +TG   G LF+GD++TQ 
Sbjct  1    MGDGPAPFSDIGKRARDLLTKDYNFDQKITLTTLSDNGLGLAATGVNIGQLFIGDISTQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K+   T D KVDTNSNV +T+TV+E   G+K   SF++PDQ+SGK+++QYLH HA I++ 
Sbjct  61   KSGKATVDVKVDTNSNVSSTVTVNELVAGVKTSFSFKIPDQKSGKLDVQYLHGHAAINSG  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT  P++  +  VG+  LALG +V FD+ S +FTKYNAG+ F   D  A+L L DKG+
Sbjct  121  IGLTPTPVLELAAAVGSKELALGAEVGFDSASASFTKYNAGIGFNKHDFSAALILADKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L ASY H VNP++ TAV AE
Sbjct  181  TLKASYVHVVNPITGTAVAAE  201



>emb|CAA57647.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=273

 Score =   219 bits (558),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +3

Query  81   PGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKN  260
            P LY +IGKKARDLL RDY T  KFT TT +  G  ITS+ +KK +  L D+ TQ+K KN
Sbjct  1    PALYNNIGKKARDLLNRDYTTGQKFTFTTTAANGATITSSSTKKNEAILADLQTQVKIKN  60

Query  261  ITTDFKVDTNSNVFTTITVDEA-APGLKIISSFRVPDQRS--GKVELQYLHDHAGISTSV  431
             T D K  ++S+V TTITV E   PGLK + S   P Q+S  GK ELQYLH H GI+ SV
Sbjct  61   FTVDVKATSDSSVVTTITVPELYTPGLKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSV  120

Query  432  GLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDS  611
            GL +NP+VNFSGV+GT A A G DV+FDT SG FTKYNAGLS TN DL ASL LN+K ++
Sbjct  121  GLNSNPLVNFSGVIGTKAFAFGVDVAFDTASGDFTKYNAGLSHTNQDLTASLNLNNKVNT  180

Query  612  LSASYYHHVNPLSNTAVGAE  671
            L+ASYYH V     TAVGAE
Sbjct  181  LAASYYHQVQ--RTTAVGAE  198



>dbj|BAJ99317.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 140/198 (71%), Gaps = 5/198 (3%)
 Frame = +3

Query  87   LYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNIT  266
            LY DIGKKARDLL RDY T  KFT TT +  G  ITS+ +KK +  L D+ TQ+K KN T
Sbjct  20   LYADIGKKARDLLNRDYTTGQKFTFTTTAANGATITSSSTKKNEAILSDLQTQVKIKNFT  79

Query  267  TDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRS--GKVELQYLHDHAGISTSVGL  437
             D K  ++S+V TTIT+ E   PGLK + S   P Q+S  GK ELQYLH H GI+ SVGL
Sbjct  80   VDVKATSDSSVVTTITIPELCKPGLKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSVGL  139

Query  438  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  617
              NP+VN SGV+GT ALA G DV+FDT SG FTKYNAG+S TN DL ASL LN+KG++L+
Sbjct  140  NPNPLVNISGVIGTKALAFGLDVAFDTASGDFTKYNAGMSHTNQDLTASLMLNNKGNTLA  199

Query  618  ASYYHHVNPLSNTAVGAE  671
            ASYYH V     TAVGAE
Sbjct  200  ASYYHQVQ--LTTAVGAE  215



>ref|XP_009354614.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Pyrus x bretschneideri]
 ref|XP_009379335.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Pyrus 
x bretschneideri]
Length=276

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGL+TDIGKKA+DLL +DY +D KFT++TYS  GV +TST  KKG L  GD+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDILTQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN   D KVDT SN+ TT T++E  P  K I+SF+ PD  SGK+E+QY HDHA I+T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHATITTA  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            V L  +P ++FS  +GT  +A G +  +DT SG FTKY AG+S T  D  AS+ L DKGD
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISITKPDQSASIILGDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S+ ASY H+++ L  +A   E
Sbjct  181  SIRASYVHYMDLLKRSAAVGE  201



>ref|XP_009150694.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Brassica 
rapa]
 ref|XP_009150695.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Brassica 
rapa]
Length=276

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 136/201 (68%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGL++DIGKKA+DLL RDY +DHKF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLMRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN   D K+DT+S V TT+T  E  P  K I SF+VPD  SGK+E+QY HDHA ++ +
Sbjct  61   KYKNAVFDVKIDTDSTVLTTVTFTEILPSTKAIVSFKVPDNSSGKLEVQYFHDHAAVTAT  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
              L  NP+++ +  +GT  ++ G +  +DT S  FTKYNAG+S T  D  AS+ L DKGD
Sbjct  121  AALKQNPLIDITATLGTPVISFGAEAGYDTSSKTFTKYNAGISVTKPDACASIILGDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S+ ASY HH++    +A   E
Sbjct  181  SIKASYLHHLDESKRSAAVGE  201



>ref|XP_008354718.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Malus domestica]
 ref|XP_009362557.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Pyrus x bretschneideri]
Length=276

 Score =   217 bits (552),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGL+TDIGKKA+DLL +DY +D KFT++TYS  GV +TST  KKG L  GD+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDILTQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN   D KVDT SN+ TT T++E  P  K I+SF+ PD  SGK+E+QY HDHA  +T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHATFTTA  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            V L+ +P ++FS  +GT  +A G +  +DT SG FTKY AG+S T  D  AS+ L DKGD
Sbjct  121  VALSQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISITKPDQSASIILGDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S+ ASY H+++ L  +A   E
Sbjct  181  SIRASYVHYMDLLKRSAAVGE  201



>emb|CDY08723.1| BnaA06g25010D [Brassica napus]
Length=276

 Score =   216 bits (551),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 136/201 (68%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGL++DIGKKA+DLL RDY +DHKF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN   D K+DT+S V TT+T  E  P  K I SF+VPD  SGK+E+QY HDHA ++ +
Sbjct  61   KYKNAVFDVKIDTDSTVLTTVTFTEILPSTKAIVSFKVPDNSSGKLEVQYFHDHAAVTAT  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
              L  NP+++ +  +GT  ++ G +  +DT S  FTKYNAG+S T  D  AS+ L DKGD
Sbjct  121  AALKQNPLIDITATLGTPVISFGAEAGYDTSSKTFTKYNAGISVTKPDACASIILGDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S+ ASY HH++    +A   E
Sbjct  181  SIKASYLHHLDESKRSAAVGE  201



>ref|XP_010550330.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Tarenaya 
hassleriana]
Length=276

 Score =   216 bits (550),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 134/201 (67%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGL+ DIGKKARDLL +DY +D KF+++TYS +GV +TST  KKG L   DV TQ 
Sbjct  1    MAKGPGLFADIGKKARDLLTKDYNSDQKFSVSTYSASGVALTSTALKKGGLHAADVATQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN   D K+DT SN+ TTIT  E  P  K I+SF+VPD  SGK+E+QY HDHA ++  
Sbjct  61   KYKNTLFDVKIDTESNISTTITFTEVLPSTKAIASFKVPDYNSGKLEVQYFHDHATLTAV  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
              L  NP+++ +  +GT  +A G +  +DT S  FTKYNAG+S T  D  AS+ L DKGD
Sbjct  121  AALKQNPLIDVTATLGTPTIAFGAEAGYDTASKTFTKYNAGISVTKPDACASIILGDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S+ ASY HHV+    +A   E
Sbjct  181  SIKASYLHHVDEAKRSAAVGE  201



>gb|KDO82799.1| hypothetical protein CISIN_1g0238541mg, partial [Citrus sinensis]
Length=162

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  189  ITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  368
            ITS+G KKG+LFL DV+TQLKNKNITTD KVDTNSN+FTTITVDE APGLK I SF VPD
Sbjct  29   ITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPD  88

Query  369  QRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNA  548
            QRSGKVELQY H++AGIST +G TANPIVNFSGVVG N++ALGTD+SFDT +G FTK NA
Sbjct  89   QRSGKVELQYQHEYAGISTGIGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNA  148

Query  549  GLSFTNSDLIASLT  590
            GLS+T++DLIASLT
Sbjct  149  GLSYTHTDLIASLT  162



>ref|XP_003569678.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=327

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 146/204 (72%), Gaps = 3/204 (1%)
 Frame = +3

Query  63   AEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNT  242
            +++  G GLY+++G+KARDLLY+D+ TD KFT+TT +  G  IT+T +KK +  LGD+ T
Sbjct  51   SKVAPGHGLYSEVGQKARDLLYKDFHTDQKFTLTTRANNGAAITATSTKKNEAILGDIKT  110

Query  243  QLKNKNITTDFKVDTNSNVF-TTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGI  419
            Q K  N+  D K  T+S V  TT T D    GLK I +   P+Q +GKVE+QYLHD+AG+
Sbjct  111  QFKFNNVKVDVKATTDSEVLITTTTEDLGLVGLKKIVTIPFPNQTAGKVEVQYLHDYAGL  170

Query  420  STSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLND  599
            + SVGL + P++N SGV G  ALA G DV++D+ +G FTKYNAG+S TN DL A++ LN+
Sbjct  171  NVSVGLNSKPLINLSGVFGNKALAAGADVAYDSATGNFTKYNAGVSLTNEDLSAAVMLNN  230

Query  600  KGDSLSASYYHHVNPLSNTAVGAE  671
            KGDSL+ASYYH VN    TAVGAE
Sbjct  231  KGDSLTASYYHSVN--KETAVGAE  252



>sp|Q0JJV1.3|VDAC4_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 4; AltName: 
Full=Voltage-dependent anion-selective channel protein 
4; Short=OsVDAC4 [Oryza sativa Japonica Group]
Length=317

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 141/196 (72%), Gaps = 1/196 (1%)
 Frame = +3

Query  87   LYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNIT  266
            LY +IGKKARDLLY+D+ TD KFT+TTY+  GVVIT+  + K +    ++ T+LK+ N+ 
Sbjct  47   LYFEIGKKARDLLYKDFHTDQKFTLTTYTNNGVVITAASTMKDEAIFSEIQTKLKSNNVM  106

Query  267  TDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTA  443
             D K  ++S V TTIT ++    GLK I S   P Q +GK ELQYLHD+AGIS  VGLT+
Sbjct  107  LDVKATSDSQVLTTITTEDLGVSGLKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTS  166

Query  444  NPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSAS  623
             P+VN SGV G  ++A+G DV+ DT +G FTKY+AGL+  NSDL A LTLN+KGDSL+AS
Sbjct  167  KPLVNLSGVFGNKSVAVGADVAVDTSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTAS  226

Query  624  YYHHVNPLSNTAVGAE  671
            YYH VN  S TA GAE
Sbjct  227  YYHLVNKESGTAAGAE  242



>ref|XP_008787191.1| PREDICTED: mitochondrial outer membrane protein porin 5-like 
[Phoenix dactylifera]
Length=275

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 140/199 (70%), Gaps = 0/199 (0%)
 Frame = +3

Query  75   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  254
            KGPGL++DIGKKA+DLL + Y  D K TI+TYS +GV +TS   KKG L+  D+ TQ K 
Sbjct  2    KGPGLFSDIGKKAKDLLTKGYSCDQKLTISTYSASGVGLTSAAVKKGGLYSFDIGTQYKY  61

Query  255  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  434
            KN   D KVDT+SNV TT+T+ E  P  K I+SF++PD  SGK+E+QY HDHAG++T+V 
Sbjct  62   KNTLVDVKVDTDSNVSTTLTMSEILPSTKTIASFKLPDYNSGKLEIQYFHDHAGVATAVA  121

Query  435  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  614
            L  +P+V+ SG +G + +A G +  FDT SG FTKYNAG+S    D  AS+ L DKGD+L
Sbjct  122  LKQSPVVDLSGTIGIHGIAFGAEAGFDTASGTFTKYNAGISLGKPDYNASIILADKGDTL  181

Query  615  SASYYHHVNPLSNTAVGAE  671
             ASY +H++ +  +A+  E
Sbjct  182  RASYVYHLDEMQKSAMVGE  200



>ref|XP_007205702.1| hypothetical protein PRUPE_ppa009821mg [Prunus persica]
 gb|EMJ06901.1| hypothetical protein PRUPE_ppa009821mg [Prunus persica]
Length=276

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 137/201 (68%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGL++DIGKKA+DLL +DY +D KFT++TYS  GV +TST  KKG L  GD+ TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTKDYNSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDIVTQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN   D KVDT SN+ TT T++E  P  K I+SF++PD  SGK+E+QY HDHA  +T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKIPDHNSGKLEVQYFHDHATFTTA  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            V L  +P ++FS  +GT  +A G +  +DT SG FTKY AG+S    D  AS+ L DKGD
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISVNKPDQSASIILGDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S+ ASY H ++ L  TA   E
Sbjct  181  SIRASYVHFLDVLKRTATVGE  201



>ref|XP_002279650.2| PREDICTED: mitochondrial outer membrane protein porin 2 [Vitis 
vinifera]
 emb|CAN75907.1| hypothetical protein VITISV_001975 [Vitis vinifera]
 emb|CBI33694.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 135/201 (67%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGL+ DIGKKA+DLL RDY +D KFT++TYS TGV ITST  KKG L  GDV  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYISDQKFTVSTYSDTGVAITSTAVKKGGLSTGDVAVQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN   D K DT SN+ TT+T  E  P  K I+SF+ PD  SGK+E+QY HDHA ++TS
Sbjct  61   KYKNSVIDVKADTGSNINTTLTFTEIIPSTKTIASFKFPDYNSGKLEVQYFHDHATLTTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            V L  +P V+ S  +GT ++A G +  +DT SG FTKY AG+S    D  AS+ L DKGD
Sbjct  121  VALNQSPAVDLSVTIGTPSIAFGAEAGYDTTSGCFTKYTAGISVAKPDSCASIILGDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            ++ ASY HH++ L  +A   E
Sbjct  181  TIRASYVHHLDSLKKSAAVGE  201



>ref|XP_010652706.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Vitis vinifera]
Length=276

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 135/201 (67%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGL+ DIGKKA+DLL RDY +D KFT++TYS TGV ITST  KKG L  GDV  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYISDQKFTVSTYSDTGVAITSTAVKKGGLSTGDVAVQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN   D K DT SN+ TT+T  E  P  K I+SF+ PD  SGK+E+QY HDHA ++TS
Sbjct  61   KYKNSVIDVKADTGSNINTTLTFTEIIPSTKTIASFKFPDYNSGKLEVQYFHDHATLTTS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            V L  +P V+ S  +GT ++A G +  +DT SG FTKY AG+S    D  AS+ L DKGD
Sbjct  121  VALNQSPAVDLSVTIGTPSIAFGAEAGYDTTSGCFTKYTAGISVAKPDSCASIILGDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            ++ ASY HH++ L  +A   E
Sbjct  181  TIRASYVHHLDSLKKSAAVGE  201



>ref|XP_004231921.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Solanum lycopersicum]
 ref|XP_010316016.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Solanum lycopersicum]
Length=330

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 147/224 (66%), Gaps = 2/224 (1%)
 Frame = +3

Query  6    LSH*NLSPSRLCFRFSA--LAAEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPT  179
            L + N S S  CF  ++  L  +M KGPGL++DIGKKARD+L +DY +D K +I+TYS T
Sbjct  32   LRYANFSLSLCCFYETSIPLPEKMSKGPGLFSDIGKKARDVLTKDYISDQKLSISTYSDT  91

Query  180  GVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFR  359
            GV +TST  KKG L  GDV  Q K KN   D KVDT SN+ TT+T+++ AP  K I+S +
Sbjct  92   GVALTSTAVKKGGLSTGDVGAQYKYKNTLIDVKVDTASNISTTLTLNDIAPSTKTIASLK  151

Query  360  VPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTK  539
             PD  SGK+E+QY H HA  ST+VGL  NPIV+ S  +GT   A+G + S++T  G   K
Sbjct  152  FPDYSSGKLEVQYYHHHAAFSTAVGLKQNPIVDLSVTLGTPTFAIGAEASYETAEGKLAK  211

Query  540  YNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAE  671
            Y AG+S T  D  A++ L DKGD++ ASY HH++ L  +A   E
Sbjct  212  YTAGISVTKPDSCAAIILGDKGDTIKASYIHHLDELKKSAAVGE  255



>ref|XP_010918626.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X1 [Elaeis guineensis]
 ref|XP_010918627.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X1 [Elaeis guineensis]
Length=276

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            MG GP  + DIGK+ARDLL +DY  D KFT+ T S  G+ + +TG K   LF+GD++TQ 
Sbjct  1    MGNGPAPFFDIGKRARDLLTKDYNFDQKFTLITSSDAGLGLMATGVKIDQLFIGDISTQY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K+   T D KVDTNSNV +T++V E   G+K   SF++PDQ+S K+++QYLHDHA I++S
Sbjct  61   KSGKTTVDVKVDTNSNVSSTVSVTELVAGVKTSFSFKIPDQKSSKLDVQYLHDHAAINSS  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            +GLT  P++  +  VG+  LALG +V FD+ S + TKYNAG+ F   D  A+L L DKG+
Sbjct  121  IGLTPTPLLELAAAVGSKELALGVEVGFDSASASVTKYNAGIGFNKHDFSAALILADKGE  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            +L ASY H VNP++  AV AE
Sbjct  181  TLKASYVHVVNPITGAAVAAE  201



>gb|KJB48714.1| hypothetical protein B456_008G082900 [Gossypium raimondii]
Length=276

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 138/201 (69%), Gaps = 0/201 (0%)
 Frame = +3

Query  69   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  248
            M KGPGL+ DIGKKA+DLL +DY +D KFT++TY+  GV +TST  KKG L  GDV    
Sbjct  1    MSKGPGLFVDIGKKAKDLLTKDYTSDQKFTVSTYTGAGVALTSTALKKGGLSTGDVAALY  60

Query  249  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  428
            K KN   D KVDTNSN+ TT+T  E  P  K I+SF+VPD  SGK+E+QY HDHA ++T+
Sbjct  61   KYKNTQFDVKVDTNSNISTTLTFTEILPSTKTIASFKVPDYNSGKLEVQYFHDHATVTTT  120

Query  429  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  608
            VGL   P V+ +  +GT ++A G +  +DT SG FTKY AG+S T  D  AS+ L DKGD
Sbjct  121  VGLNQTPGVDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISMTKPDSCASIILGDKGD  180

Query  609  SLSASYYHHVNPLSNTAVGAE  671
            S+ ASY H+++ L  +A  AE
Sbjct  181  SIKASYVHYMDQLKKSAAVAE  201



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600