BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF026M23

Length=644
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606961.1|  PREDICTED: SUMO-activating enzyme subunit 2        283   1e-87   Nicotiana tomentosiformis
ref|XP_009765006.1|  PREDICTED: SUMO-activating enzyme subunit 2        282   4e-87   Nicotiana sylvestris
ref|XP_006362029.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    281   6e-87   
ref|XP_011088448.1|  PREDICTED: SUMO-activating enzyme subunit 2        280   2e-86   Sesamum indicum [beniseed]
gb|KJB47536.1|  hypothetical protein B456_008G030900                    273   2e-86   Gossypium raimondii
ref|XP_006423381.1|  hypothetical protein CICLE_v100281691mg            264   3e-86   
ref|XP_010251621.1|  PREDICTED: SUMO-activating enzyme subunit 2        278   9e-86   Nelumbo nucifera [Indian lotus]
ref|XP_004230873.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    278   1e-85   Solanum lycopersicum
gb|KJB47539.1|  hypothetical protein B456_008G030900                    273   7e-85   Gossypium raimondii
emb|CDO97017.1|  unnamed protein product                                275   9e-85   Coffea canephora [robusta coffee]
ref|XP_010942467.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    275   2e-84   Elaeis guineensis
gb|KJB47537.1|  hypothetical protein B456_008G030900                    274   3e-84   Gossypium raimondii
gb|KJB32554.1|  hypothetical protein B456_005G246300                    270   6e-84   Gossypium raimondii
ref|XP_010107832.1|  SUMO-activating enzyme subunit 2                   272   8e-84   
ref|XP_007042098.1|  SUMO-activating enzyme 2 isoform 2                 269   1e-83   
gb|KDO49458.1|  hypothetical protein CISIN_1g006294mg                   266   2e-83   Citrus sinensis [apfelsine]
gb|KJB32553.1|  hypothetical protein B456_005G246300                    272   2e-83   Gossypium raimondii
ref|XP_008797037.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    271   4e-83   Phoenix dactylifera
ref|XP_007042099.1|  SUMO-activating enzyme 2 isoform 3                 269   4e-83   
ref|XP_007042097.1|  SUMO-activating enzyme 2 isoform 1                 271   6e-83   Theobroma cacao [chocolate]
ref|XP_008236951.1|  PREDICTED: SUMO-activating enzyme subunit 2        269   2e-82   Prunus mume [ume]
ref|XP_007199741.1|  hypothetical protein PRUPE_ppa002704mg             269   2e-82   Prunus persica
ref|NP_001145407.1|  uncharacterized protein LOC100278764               261   3e-82   
ref|XP_004289650.1|  PREDICTED: SUMO-activating enzyme subunit 2        268   3e-82   Fragaria vesca subsp. vesca
gb|KDO49457.1|  hypothetical protein CISIN_1g006294mg                   266   6e-82   Citrus sinensis [apfelsine]
ref|XP_009372987.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    268   6e-82   Pyrus x bretschneideri [bai li]
ref|XP_010429058.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    267   1e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010472141.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    266   1e-81   
ref|XP_008382303.1|  PREDICTED: SUMO-activating enzyme subunit 2        267   1e-81   Malus domestica [apple tree]
ref|XP_010066186.1|  PREDICTED: SUMO-activating enzyme subunit 2        267   1e-81   Eucalyptus grandis [rose gum]
ref|XP_010416892.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    266   2e-81   Camelina sativa [gold-of-pleasure]
gb|KDO49456.1|  hypothetical protein CISIN_1g006294mg                   267   2e-81   Citrus sinensis [apfelsine]
ref|NP_179742.2|  SUMO-activating enzyme subunit 2                      266   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006487357.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    267   2e-81   Citrus sinensis [apfelsine]
ref|NP_001189570.1|  SUMO-activating enzyme subunit 2                   266   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838625.1|  hypothetical protein AMTR_s00002p00233990          266   4e-81   Amborella trichopoda
ref|XP_008357172.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    266   4e-81   Malus domestica [apple tree]
ref|XP_010531451.1|  PREDICTED: SUMO-activating enzyme subunit 2        265   7e-81   Tarenaya hassleriana [spider flower]
gb|KFK32895.1|  hypothetical protein AALP_AA6G302000                    265   8e-81   Arabis alpina [alpine rockcress]
ref|XP_002283529.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    265   9e-81   Vitis vinifera
ref|NP_973506.1|  SUMO-activating enzyme subunit 2                      265   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009412808.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    264   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002878554.1|  sumo-activating enzyme 2                           265   2e-80   
ref|XP_006293831.1|  hypothetical protein CARUB_v10022825mg             263   2e-80   Capsella rubella
ref|XP_011037464.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    264   2e-80   Populus euphratica
ref|XP_010690827.1|  PREDICTED: SUMO-activating enzyme subunit 2        263   3e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011047900.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    264   3e-80   Populus euphratica
ref|XP_008777005.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    264   3e-80   
ref|XP_011047909.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    263   3e-80   Populus euphratica
ref|XP_009399956.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    261   4e-80   
gb|KDP41752.1|  hypothetical protein JCGZ_26770                         262   6e-80   Jatropha curcas
ref|XP_007133804.1|  hypothetical protein PHAVU_011G210500g             262   1e-79   Phaseolus vulgaris [French bean]
gb|KHN19464.1|  SUMO-activating enzyme subunit 2                        262   1e-79   Glycine soja [wild soybean]
ref|XP_003540521.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    262   1e-79   Glycine max [soybeans]
ref|XP_009399955.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    262   1e-79   
ref|XP_002460940.1|  hypothetical protein SORBIDRAFT_02g037850          261   2e-79   Sorghum bicolor [broomcorn]
ref|XP_010938776.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    261   2e-79   Elaeis guineensis
ref|XP_006404595.1|  hypothetical protein EUTSA_v10000089mg             261   2e-79   Eutrema salsugineum [saltwater cress]
ref|XP_003541605.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    260   4e-79   Glycine max [soybeans]
ref|XP_008460981.1|  PREDICTED: SUMO-activating enzyme subunit 2        260   7e-79   Cucumis melo [Oriental melon]
gb|KEH19101.1|  SUMO1 activating enzyme subunit 2                       259   1e-78   Medicago truncatula
ref|XP_004510996.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    258   2e-78   Cicer arietinum [garbanzo]
emb|CDY13814.1|  BnaA09g43160D                                          258   3e-78   Brassica napus [oilseed rape]
ref|NP_001060130.1|  Os07g0586500                                       251   1e-77   
emb|CDX99589.1|  BnaC04g33460D                                          256   2e-77   
ref|XP_009140282.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    255   2e-77   Brassica rapa
ref|XP_004150065.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    256   2e-77   Cucumis sativus [cucumbers]
ref|XP_004165550.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    256   2e-77   
emb|CDY15890.1|  BnaA04g12210D                                          255   3e-77   Brassica napus [oilseed rape]
ref|XP_010236228.1|  PREDICTED: SUMO-activating enzyme subunit 2        254   7e-77   Brachypodium distachyon [annual false brome]
ref|XP_004958165.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    254   8e-77   Setaria italica
ref|XP_009117402.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    254   1e-76   Brassica rapa
emb|CDX82033.1|  BnaC08g35680D                                          253   2e-76   
ref|XP_002512954.1|  ubiquitin-activating enzyme E1b, putative          253   2e-76   Ricinus communis
ref|XP_009347843.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    253   2e-76   Pyrus x bretschneideri [bai li]
gb|EYU37827.1|  hypothetical protein MIMGU_mgv1a002832mg                252   5e-76   Erythranthe guttata [common monkey flower]
gb|EEC82353.1|  hypothetical protein OsI_26664                          252   6e-76   Oryza sativa Indica Group [Indian rice]
gb|EMT21367.1|  SUMO-activating enzyme subunit 2                        250   3e-75   
gb|KJB32552.1|  hypothetical protein B456_005G246300                    249   7e-75   Gossypium raimondii
emb|CBI37697.3|  unnamed protein product                                247   3e-74   Vitis vinifera
gb|EEE67493.1|  hypothetical protein OsJ_24922                          246   1e-73   Oryza sativa Japonica Group [Japonica rice]
gb|AAN03851.1|  SUMO activating enzyme 2                                245   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006657898.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    242   2e-72   
gb|EMS58354.1|  SUMO-activating enzyme subunit 2                        243   2e-72   Triticum urartu
ref|XP_001762389.1|  predicted protein                                  234   3e-70   
gb|EPS74543.1|  hypothetical protein M569_00206                         236   3e-70   Genlisea aurea
ref|XP_002990197.1|  SUMO activating enzyme 2                           233   4e-69   
ref|XP_002992493.1|  SUMO activating enzyme 2                           233   4e-69   
ref|XP_001775802.1|  predicted protein                                  229   2e-67   
ref|XP_003063899.1|  SUMO1 activating enzyme subunit 2                  223   3e-65   Micromonas pusilla CCMP1545
ref|XP_002505850.1|  SUMO1 activating enzyme subunit 2                  220   8e-64   Micromonas commoda
gb|KFX51507.1|  Ubiquitin-activating enzyme E1-like                     205   3e-62   Talaromyces marneffei PM1
gb|KFX51510.1|  Ubiquitin-activating enzyme E1-like                     206   6e-62   Talaromyces marneffei PM1
gb|KEQ66215.1|  putative ubiquitin-like activating enzyme               214   1e-61   Aureobasidium melanogenum CBS 110374
gb|KEQ95428.1|  hypothetical protein AUEXF2481DRAFT_5033                213   2e-61   Aureobasidium subglaciale EXF-2481
gb|KEQ72622.1|  ThiF family protein                                     213   4e-61   Aureobasidium namibiae CBS 147.97
ref|XP_005844208.1|  hypothetical protein CHLNCDRAFT_27175              212   6e-61   Chlorella variabilis
gb|KEQ89414.1|  hypothetical protein M438DRAFT_401525                   211   2e-60   Aureobasidium pullulans EXF-150
ref|XP_007776555.1|  ubiquitin-like 1-activating enzyme E1 B            210   2e-60   Coniosporium apollinis CBS 100218
ref|XP_002545122.1|  hypothetical protein UREG_04639                    209   7e-60   Uncinocarpus reesii 1704
gb|AHG26147.1|  ubiquitin-activating enzyme E1-like protein             209   7e-60   Shiraia sp. slf14
emb|CDP27100.1|  Putative Ubiquitin-activating enzyme E1-like           208   2e-59   Podospora anserina S mat+
gb|EKG19357.1|  hypothetical protein MPH_03220                          208   2e-59   Macrophomina phaseolina MS6
ref|XP_001417248.1|  predicted protein                                  206   2e-59   Ostreococcus lucimarinus CCE9901
gb|KFY98743.1|  hypothetical protein V498_01273                         208   2e-59   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
ref|XP_001909380.1|  hypothetical protein                               208   2e-59   Podospora anserina S mat+
gb|KDO17056.1|  hypothetical protein SPRG_17525                         202   2e-59   Saprolegnia parasitica CBS 223.65
ref|XP_009844967.1|  hypothetical protein H257_17773                    206   3e-59   Aphanomyces astaci
emb|CBJ28586.1|  conserved unknown protein                              199   3e-59   Ectocarpus siliculosus
gb|KFY06738.1|  hypothetical protein V492_07786                         207   3e-59   Pseudogymnoascus sp. VKM F-4246
ref|XP_007584112.1|  putative ubiquitin-like activating enzyme pr...    207   3e-59   
gb|KFX85719.1|  hypothetical protein V490_09456                         207   4e-59   Pseudogymnoascus sp. VKM F-3557
gb|KFZ11212.1|  hypothetical protein V502_07664                         207   4e-59   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY45166.1|  hypothetical protein V495_03087                         207   4e-59   Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|KFY09724.1|  hypothetical protein V491_08009                         207   4e-59   Pseudogymnoascus sp. VKM F-3775
ref|XP_008869322.1|  hypothetical protein H310_06150                    206   4e-59   Aphanomyces invadans
gb|KFX98161.1|  hypothetical protein O988_04493                         207   5e-59   Pseudogymnoascus sp. VKM F-3808
gb|KFY85661.1|  hypothetical protein V500_08228                         207   5e-59   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
dbj|GAA84113.1|  ubiquitin-like activating enzyme                       206   6e-59   Aspergillus kawachii IFO 4308
gb|KID76746.1|  Molybdenum cofactor biosynthesis, MoeB                  208   7e-59   Metarhizium brunneum ARSEF 3297
gb|KFZ12488.1|  hypothetical protein V501_04200                         207   7e-59   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|EXU99576.1|  ubiquitin activating enzyme (E1) subunit UBA2 fam...    207   7e-59   Metarhizium robertsii
gb|KFY75005.1|  hypothetical protein V499_05024                         206   7e-59   Pseudogymnoascus sp. VKM F-103
gb|KFX51509.1|  Ubiquitin-activating enzyme E1-like                     206   8e-59   Talaromyces marneffei PM1
gb|KFY62206.1|  hypothetical protein V496_04690                         206   9e-59   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KID88908.1|  Molybdenum cofactor biosynthesis, MoeB                  207   1e-58   Metarhizium guizhouense ARSEF 977
gb|KIE02655.1|  Molybdenum cofactor biosynthesis, MoeB                  207   1e-58   Metarhizium majus ARSEF 297
ref|XP_003709447.1|  SUMO-activating enzyme subunit uba-2               207   1e-58   Magnaporthe oryzae 70-15
gb|KFG79382.1|  putative ubiquitin-activating enzyme UBA2               207   1e-58   Metarhizium anisopliae
ref|XP_007809976.1|  putative ubiquitin-activating enzyme UBA2          207   1e-58   Metarhizium acridum CQMa 102
ref|XP_007818741.1|  Ubiquitin-activating enzyme, E1, active site...    207   1e-58   Metarhizium robertsii ARSEF 23
ref|XP_001268153.1|  ubiquitin-like activating enzyme (UbaB), put...    206   1e-58   Aspergillus clavatus NRRL 1
ref|XP_002145297.1|  ubiquitin-like activating enzyme (UbaB), put...    206   1e-58   Talaromyces marneffei ATCC 18224
gb|EQL34861.1|  ubiquitin-like 1-activating enzyme E1 B                 206   1e-58   Blastomyces dermatitidis ATCC 26199
gb|KCW64020.1|  hypothetical protein EUGRSUZ_G016992                    204   1e-58   Eucalyptus grandis [rose gum]
ref|XP_002621726.1|  ubiquitin-like activating enzyme UbaB              206   1e-58   Blastomyces gilchristii SLH14081
gb|EGE81131.1|  ubiquitin-activating enzyme                             206   1e-58   Blastomyces dermatitidis ATCC 18188
ref|XP_001820796.2|  ubiquitin-activating enzyme E1-like protein        206   1e-58   
dbj|GAM85103.1|  hypothetical protein ANO11243_031060                   205   1e-58   fungal sp. No.11243
ref|XP_007512390.1|  predicted protein                                  206   1e-58   Bathycoccus prasinos
gb|KIN01521.1|  hypothetical protein OIDMADRAFT_104066                  206   1e-58   Oidiodendron maius Zn
gb|EEQ91823.1|  ubiquitin-activating enzyme                             206   1e-58   Blastomyces dermatitidis ER-3
ref|XP_002376522.1|  ubiquitin-like activating enzyme (UbaB), put...    206   1e-58   Aspergillus flavus NRRL3357
gb|EIT74958.1|  SMT3/SUMO-activating complex, catalytic component...    205   1e-58   Aspergillus oryzae 3.042
gb|ELQ38550.1|  SUMO-activating enzyme subunit uba-2                    207   2e-58   Magnaporthe oryzae Y34
gb|KFY38951.1|  hypothetical protein V494_04157                         206   2e-58   Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|XP_002487254.1|  ubiquitin-like activating enzyme (UbaB), put...    205   2e-58   Talaromyces stipitatus ATCC 10500
emb|CEJ79950.1|  hypothetical protein VHEMI00161                        206   2e-58   Torrubiella hemipterigena
ref|XP_011108689.1|  hypothetical protein H072_2702                     205   2e-58   
gb|EZG00032.1|  ubiquitin-activating enzyme E1-like protein             196   2e-58   Trichophyton rubrum MR1459
emb|CEJ79951.1|  hypothetical protein VHEMI00161                        206   2e-58   Torrubiella hemipterigena
ref|XP_001211541.1|  conserved hypothetical protein                     204   2e-58   Aspergillus terreus NIH2624
gb|ELR05791.1|  hypothetical protein GMDG_01869                         205   2e-58   Pseudogymnoascus destructans 20631-21
ref|XP_004991968.1|  hypothetical protein PTSG_06582                    205   3e-58   Salpingoeca rosetta
gb|KFX51511.1|  Ubiquitin-activating enzyme E1-like                     206   3e-58   Talaromyces marneffei PM1
ref|XP_002594236.1|  hypothetical protein BRAFLDRAFT_65085              193   3e-58   Branchiostoma floridae
emb|CCU82288.1|  NEDD8-activating enzyme E1 catalytic subunit/ubi...    205   3e-58   Blumeria graminis f. sp. hordei DH14
ref|XP_001394085.1|  ubiquitin-activating enzyme E1-like protein        204   3e-58   Aspergillus niger CBS 513.88
gb|KCW64019.1|  hypothetical protein EUGRSUZ_G016992                    204   4e-58   Eucalyptus grandis [rose gum]
gb|EHK15498.1|  hypothetical protein TRIVIDRAFT_38683                   205   4e-58   Trichoderma virens Gv29-8
emb|CEJ00366.1|  hypothetical protein RMCBS344292_14423                 204   5e-58   Rhizopus microsporus
dbj|GAM34770.1|  SUMO E1-like activator                                 204   5e-58   Talaromyces cellulolyticus
ref|XP_009519056.1|  hypothetical protein PHYSODRAFT_349758             204   5e-58   Phytophthora sojae
ref|XP_750939.1|  ubiquitin-like activating enzyme (UbaB)               204   6e-58   Aspergillus fumigatus Af293
gb|KFH63366.1|  ubiquitin-like 1-activating enzyme E1 B                 204   7e-58   Mortierella verticillata NRRL 6337
emb|CEJ03477.1|  hypothetical protein RMCBS344292_17459                 203   8e-58   Rhizopus microsporus
emb|CEG80759.1|  hypothetical protein RMATCC62417_15055                 203   8e-58   Rhizopus microsporus
ref|XP_660054.1|  hypothetical protein AN2450.2                         203   9e-58   Aspergillus nidulans FGSC A4
gb|EER43692.1|  ubiquitin-activating enzyme                             203   9e-58   Histoplasma capsulatum H143
gb|EGC50026.1|  ubiquitin-activating enzyme                             203   9e-58   Histoplasma capsulatum H88
ref|XP_002679801.1|  ubiquitin-like 1 activating enzyme E1B             203   1e-57   Naegleria gruberi strain NEG-M
ref|XP_003069148.1|  ThiF family protein                                203   1e-57   Coccidioides posadasii C735 delta SOWgp
dbj|BAE58794.1|  unnamed protein product                                203   1e-57   Aspergillus oryzae RIB40
ref|XP_001240084.1|  hypothetical protein CIMG_09705                    203   1e-57   Coccidioides immitis RS
ref|XP_009050922.1|  hypothetical protein LOTGIDRAFT_178117             202   1e-57   Lottia gigantea
emb|CEF97583.1|  Molybdenum cofactor biosynthesis, MoeB                 202   1e-57   Ostreococcus tauri
gb|KFA63748.1|  hypothetical protein S40285_01953                       204   1e-57   Stachybotrys chlorohalonata IBT 40285
ref|XP_004359730.1|  sumo-activating enzyme subunit 2                   203   1e-57   Cavenderia fasciculata
emb|CCE26846.1|  related to ubiquitin-activating enzyme homolog UBA2    204   2e-57   Claviceps purpurea 20.1
gb|KEZ46093.1|  hypothetical protein SAPIO_CDS0942                      203   2e-57   Scedosporium apiospermum
gb|EFA83622.1|  sumo-activating enzyme subunit 2                        203   2e-57   Heterostelium album PN500
ref|XP_010315319.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    202   2e-57   Solanum lycopersicum
gb|KDO27496.1|  hypothetical protein SPRG_07085                         202   2e-57   Saprolegnia parasitica CBS 223.65
ref|XP_001258177.1|  ubiquitin-like activating enzyme (UbaB), put...    202   2e-57   Aspergillus fischeri NRRL 181
gb|KJB47535.1|  hypothetical protein B456_008G030900                    202   2e-57   Gossypium raimondii
ref|XP_002306122.2|  hypothetical protein POPTR_0004s166302g            201   3e-57   
ref|XP_008712970.1|  hypothetical protein HMPREF1541_10077              202   4e-57   Cyphellophora europaea CBS 101466
gb|EPQ63820.1|  hypothetical protein BGT96224_4887                      202   4e-57   Blumeria graminis f. sp. tritici 96224
ref|XP_002793028.1|  ubiquitin-activating enzyme                        202   4e-57   Paracoccidioides lutzii Pb01
ref|XP_006690724.1|  ubiquitin-activating enzyme-like protein           202   4e-57   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_003657600.1|  hypothetical protein THITE_2171547                 202   4e-57   Thielavia terrestris NRRL 8126
gb|EEH05567.1|  ubiquitin-activating enzyme                             201   4e-57   Histoplasma capsulatum G186AR
ref|XP_001797609.1|  hypothetical protein SNOG_07265                    201   4e-57   Parastagonospora nodorum SN15
gb|KFY23096.1|  hypothetical protein V493_06095                         202   5e-57   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|EMR88301.1|  putative family protein                                 202   5e-57   Botrytis cinerea BcDW1
emb|CCI48953.1|  unnamed protein product                                201   5e-57   Albugo candida
ref|XP_001555288.1|  hypothetical protein BC1G_05993                    202   5e-57   
ref|XP_008892081.1|  hypothetical protein PPTG_02637                    201   5e-57   Phytophthora parasitica INRA-310
emb|CAF89656.1|  unnamed protein product                                191   5e-57   Tetraodon nigroviridis
gb|EEH22393.2|  hypothetical protein PABG_04604                         201   6e-57   Paracoccidioides brasiliensis Pb03
gb|ETP47472.1|  hypothetical protein F442_06579                         201   6e-57   Phytophthora parasitica P10297
gb|EHK40736.1|  hypothetical protein TRIATDRAFT_148461                  202   6e-57   Trichoderma atroviride IMI 206040
gb|ETI49760.1|  hypothetical protein F443_06536                         201   6e-57   Phytophthora parasitica P1569
ref|XP_007295294.1|  ThiF family protein                                201   7e-57   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_002313776.1|  hypothetical protein POPTR_0009s12300g             202   7e-57   
ref|XP_001596160.1|  hypothetical protein SS1G_02376                    202   7e-57   Sclerotinia sclerotiorum 1980 UF-70
gb|ERZ96130.1|  hypothetical protein GLOINDRAFT_340840                  201   7e-57   
gb|EYE96412.1|  ubiquitin-like activating enzyme                        201   7e-57   Aspergillus ruber CBS 135680
gb|KHG12220.1|  SUMO-activating enzyme subunit 2 -like protein          201   7e-57   Gossypium arboreum [tree cotton]
gb|KEY64505.1|  hypothetical protein S7711_07252                        202   7e-57   Stachybotrys chartarum IBT 7711
ref|XP_007793896.1|  putative family protein                            201   8e-57   
gb|KFA47747.1|  hypothetical protein S40293_07149                       202   8e-57   Stachybotrys chartarum IBT 40293
ref|XP_008087072.1|  Activating enzyme of the ubiquitin-like protein    201   8e-57   Glarea lozoyensis ATCC 20868
ref|XP_010760227.1|  hypothetical protein PADG_05005                    201   8e-57   Paracoccidioides brasiliensis Pb18
gb|KFA81890.1|  hypothetical protein S40288_01743                       202   9e-57   Stachybotrys chartarum IBT 40288
ref|XP_008670523.1|  PREDICTED: SUMO-activating enzyme subunit 2        201   1e-56   
gb|AEE63129.1|  unknown                                                 194   1e-56   Dendroctonus ponderosae
gb|KIW06569.1|  hypothetical protein PV09_02998                         200   1e-56   Verruconis gallopava
gb|EZF27677.1|  hypothetical protein H100_00355                         197   2e-56   Trichophyton rubrum MR850
ref|XP_007702777.1|  hypothetical protein COCSADRAFT_123063             200   2e-56   Bipolaris sorokiniana ND90Pr
gb|EMD91706.1|  hypothetical protein COCHEDRAFT_1175946                 199   2e-56   Bipolaris maydis C5
gb|KHG16253.1|  SUMO-activating enzyme subunit 2 -like protein          199   2e-56   Gossypium arboreum [tree cotton]
gb|KDB18330.1|  putative ubiquitin-activating enzyme UBA2               201   2e-56   Ustilaginoidea virens
ref|XP_002847388.1|  ubiquitin-activating enzyme                        199   2e-56   Microsporum canis CBS 113480
ref|XP_003175970.1|  SUMO-activating enzyme subunit uba-2               199   3e-56   Nannizzia gypsea CBS 118893
ref|XP_008613648.1|  hypothetical protein SDRG_09489                    199   3e-56   Saprolegnia diclina VS20
gb|EPS32945.1|  hypothetical protein PDE_07906                          199   3e-56   Penicillium oxalicum 114-2
ref|XP_003666760.1|  hypothetical protein MYCTH_2311735                 199   3e-56   Thermothelomyces thermophila ATCC 42464
ref|XP_011431808.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    199   3e-56   Crassostrea gigas
gb|EXK45780.1|  ubiquitin-like 1-activating enzyme E1 B                 199   4e-56   Fusarium oxysporum f. sp. melonis 26406
gb|EWZ48441.1|  ubiquitin-like 1-activating enzyme E1 B                 199   4e-56   Fusarium oxysporum Fo47
gb|EXL53770.1|  ubiquitin-like 1-activating enzyme E1 B                 199   4e-56   Fusarium oxysporum f. sp. radicis-lycopersici 26381
ref|XP_007708023.1|  hypothetical protein COCCADRAFT_1533               199   5e-56   Bipolaris zeicola 26-R-13
gb|EUN25064.1|  hypothetical protein COCVIDRAFT_104517                  199   5e-56   Bipolaris victoriae FI3
ref|XP_008030482.1|  hypothetical protein SETTUDRAFT_165650             199   5e-56   Exserohilum turcica Et28A
ref|XP_006965352.1|  predicted protein                                  199   5e-56   Trichoderma reesei QM6a
gb|EXK45778.1|  ubiquitin-like 1-activating enzyme E1 B                 199   5e-56   Fusarium oxysporum f. sp. melonis 26406
ref|XP_001539458.1|  conserved hypothetical protein                     198   5e-56   Histoplasma capsulatum NAm1
gb|EWZ48439.1|  ubiquitin-like 1-activating enzyme E1 B                 199   5e-56   Fusarium oxysporum Fo47
gb|EXL53768.1|  ubiquitin-like 1-activating enzyme E1 B                 199   5e-56   Fusarium oxysporum f. sp. radicis-lycopersici 26381
gb|EXK45779.1|  ubiquitin-like 1-activating enzyme E1 B                 198   6e-56   Fusarium oxysporum f. sp. melonis 26406
gb|EXM07021.1|  ubiquitin-like 1-activating enzyme E1 B                 198   6e-56   Fusarium oxysporum f. sp. cubense tropical race 4 54006
ref|XP_006665443.1|  ubiquitin-like activating enzyme, putative         199   6e-56   Cordyceps militaris CM01
gb|EXM33950.1|  ubiquitin-like 1-activating enzyme E1 B                 198   6e-56   Fusarium oxysporum f. sp. vasinfectum 25433
gb|EXL53769.1|  ubiquitin-like 1-activating enzyme E1 B                 198   6e-56   Fusarium oxysporum f. sp. radicis-lycopersici 26381
ref|NP_595945.1|  SUMO E1-like activator enzyme Fub2 (predicted)        198   7e-56   Schizosaccharomyces pombe
gb|EWZ48440.1|  ubiquitin-like 1-activating enzyme E1 B                 198   7e-56   Fusarium oxysporum Fo47
dbj|GAM22192.1|  hypothetical protein SAMD00019534_053670               198   7e-56   Acytostelium subglobosum LB1
gb|EWZ02355.1|  ubiquitin-like 1-activating enzyme E1 B                 198   7e-56   Fusarium oxysporum FOSC 3-a
ref|XP_010938778.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    198   8e-56   Elaeis guineensis
ref|XP_002999118.1|  ubiquitin-activating enzyme (E1), putative         198   8e-56   Phytophthora infestans T30-4
ref|XP_009852618.1|  hypothetical protein NEUTE1DRAFT_123449            199   8e-56   Neurospora tetrasperma FGSC 2508
gb|EWZ02353.1|  ubiquitin-like 1-activating enzyme E1 B                 198   8e-56   Fusarium oxysporum FOSC 3-a
ref|XP_011393552.1|  ubiquitin-activating enzyme E1 3                   199   8e-56   Neurospora crassa OR74A
gb|KHE82261.1|  hypothetical protein GE21DRAFT_1318969                  199   8e-56   Neurospora crassa
gb|EXM33948.1|  ubiquitin-like 1-activating enzyme E1 B                 198   9e-56   Fusarium oxysporum f. sp. vasinfectum 25433
gb|EXM07020.1|  ubiquitin-like 1-activating enzyme E1 B                 198   9e-56   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EXM07019.1|  ubiquitin-like 1-activating enzyme E1 B                 198   9e-56   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EXM33949.1|  ubiquitin-like 1-activating enzyme E1 B                 198   1e-55   Fusarium oxysporum f. sp. vasinfectum 25433
ref|XP_010938777.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    198   1e-55   
gb|ESZ89787.1|  hypothetical protein SBOR_9825                          199   1e-55   Sclerotinia borealis F-4128
gb|EXK45777.1|  ubiquitin-like 1-activating enzyme E1 B                 199   1e-55   Fusarium oxysporum f. sp. melonis 26406
gb|EWZ02354.1|  ubiquitin-like 1-activating enzyme E1 B                 198   1e-55   Fusarium oxysporum FOSC 3-a
gb|EXA42006.1|  ubiquitin-like 1-activating enzyme E1 B                 197   1e-55   Fusarium oxysporum f. sp. pisi HDV247
gb|EXA42004.1|  ubiquitin-like 1-activating enzyme E1 B                 197   1e-55   Fusarium oxysporum f. sp. pisi HDV247
gb|EWZ48438.1|  ubiquitin-like 1-activating enzyme E1 B                 198   1e-55   Fusarium oxysporum Fo47
gb|EXL53767.1|  ubiquitin-like 1-activating enzyme E1 B                 198   1e-55   Fusarium oxysporum f. sp. radicis-lycopersici 26381
ref|XP_001638517.1|  predicted protein                                  197   1e-55   Nematostella vectensis
gb|KIW21474.1|  hypothetical protein PV08_02054                         198   1e-55   Exophiala spinifera
ref|XP_007683286.1|  hypothetical protein COCMIDRAFT_32498              197   1e-55   Bipolaris oryzae ATCC 44560
ref|XP_011037465.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    197   1e-55   Populus euphratica
gb|EXA42005.1|  ubiquitin-like 1-activating enzyme E1 B                 197   1e-55   Fusarium oxysporum f. sp. pisi HDV247
gb|KDO49455.1|  hypothetical protein CISIN_1g006294mg                   197   1e-55   Citrus sinensis [apfelsine]
ref|XP_008601913.1|  ThiF family protein                                199   1e-55   Beauveria bassiana ARSEF 2860
ref|XP_001660971.1|  AAEL010641-PA                                      197   1e-55   
gb|EGD95638.1|  ubiquitin-activating enzyme E1                          197   1e-55   Trichophyton tonsurans CBS 112818
dbj|GAA97515.1|  hypothetical protein E5Q_04193                         197   1e-55   Mixia osmundae IAM 14324
ref|XP_007733501.1|  ubiquitin-like 1-activating enzyme E1 B            197   2e-55   Capronia epimyces CBS 606.96
gb|KIW36807.1|  hypothetical protein PV06_10929                         197   2e-55   Exophiala oligosperma
ref|XP_001225714.1|  hypothetical protein CHGG_08058                    196   2e-55   
gb|EXM33947.1|  ubiquitin-like 1-activating enzyme E1 B                 198   2e-55   
gb|EZF30669.1|  hypothetical protein H101_05698                         197   2e-55   
gb|EMT68231.1|  Ubiquitin-activating enzyme E1-like protein             198   2e-55   
gb|EGE08007.1|  SUMO-activating enzyme subunit uba-2                    197   2e-55   
gb|EWZ02352.1|  ubiquitin-like 1-activating enzyme E1 B                 198   2e-55   
ref|XP_003025232.1|  hypothetical protein TRV_00598                     197   2e-55   
gb|ENH68682.1|  Ubiquitin-activating enzyme E1-like protein             198   2e-55   
ref|XP_003011004.1|  hypothetical protein ARB_02736                     197   2e-55   
gb|EGU88031.1|  hypothetical protein FOXB_01514                         197   2e-55   
gb|KGO39327.1|  Molybdenum cofactor biosynthesis, MoeB                  197   2e-55   
emb|CDM31363.1|  Ubiquitin-activating enzyme E1-like                    196   3e-55   
emb|CCF32438.1|  ThiF family protein                                    197   3e-55   
ref|XP_003344688.1|  hypothetical protein SMAC_07257                    197   3e-55   
gb|EYB33068.1|  hypothetical protein FG05_06030                         197   4e-55   
ref|XP_007238038.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    197   4e-55   
emb|CEF87872.1|  unnamed protein product                                197   4e-55   
gb|EZF27675.1|  hypothetical protein H100_00355                         196   4e-55   
gb|AFP23391.1|  SUMO-activating enzyme subunit 2                        196   4e-55   
ref|XP_007595322.1|  ThiF family protein                                197   4e-55   
gb|KHJ31919.1|  putative family protein                                 196   4e-55   
ref|XP_011117640.1|  hypothetical protein AOL_s00006g29                 196   4e-55   
emb|CCO33857.1|  ubiquitin-like 1-activating enzyme E1 B                197   4e-55   
ref|XP_003231193.1|  SUMO activating enzyme subunit 2                   196   4e-55   
ref|XP_007272627.1|  ubiquitin-like activating enzyme                   197   4e-55   
emb|CAB98247.1|  related to ubiquitin-activating enzyme homolog UBA2    196   4e-55   
emb|CEL54749.1|  ubiquitin-like 1-activating enzyme E1 B                197   4e-55   
ref|XP_009254336.1|  hypothetical protein FPSE_02942                    197   5e-55   
gb|EFQ31190.1|  ThiF family protein                                     197   5e-55   
gb|KGO76338.1|  Molybdenum cofactor biosynthesis, MoeB                  196   5e-55   
emb|CCA14752.1|  ubiquitinactivating enzyme (E1) putative               195   5e-55   
ref|XP_003052062.1|  predicted protein                                  196   5e-55   
gb|KEP48863.1|  ubiquitin activating enzyme E1                          196   5e-55   
gb|KIY01361.1|  hypothetical protein Z520_02913                         196   5e-55   
gb|EKV15800.1|  Ubiquitin-like activating enzyme (UbaB), putative       196   6e-55   
ref|XP_002171880.1|  SUMO E1-like activator enzyme Fub2                 196   6e-55   
emb|CCT67045.1|  related to ubiquitin-activating enzyme homolog UBA2    196   7e-55   
ref|XP_007872179.1|  hypothetical protein PNEG_00306                    195   7e-55   
gb|KIW82338.1|  hypothetical protein Z517_05365                         196   7e-55   
dbj|GAD95247.1|  ubiquitin-like activating enzyme (UbaB), putative      196   7e-55   
gb|KGQ07453.1|  Ubiquitin-activating enzyme E1-like protein             196   7e-55   
ref|XP_003285101.1|  hypothetical protein DICPUDRAFT_76062              196   8e-55   
ref|XP_003836277.1|  similar to ubiquitin-activating enzyme             195   8e-55   
emb|CCX07404.1|  Similar to Ubiquitin-activating enzyme E1-like; ...    196   8e-55   
gb|KFH43379.1|  Ubiquitin-activating enzyme E1-like protein             196   8e-55   
ref|XP_009153072.1|  ubiquitin-like 1-activating enzyme E1 B            196   8e-55   
gb|KIW60414.1|  hypothetical protein PV05_00630                         195   9e-55   
gb|ENN71609.1|  hypothetical protein YQE_11708                          195   9e-55   
ref|XP_009010030.1|  hypothetical protein HELRODRAFT_71557              195   1e-54   
gb|KIL91419.1|  ubiquitin-like 1-activating enzyme e1 b                 196   1e-54   
gb|EFX06220.1|  ubiquitin-like activating enzyme                        196   1e-54   
gb|EWG43007.1|  ubiquitin-like 1-activating enzyme E1 B                 196   1e-54   
gb|AGC75067.1|  SUMO-activating enzyme subunit 2                        195   1e-54   
ref|XP_011047920.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    195   1e-54   
ref|XP_002569011.1|  Pc21g20210                                         195   1e-54   
ref|XP_007914799.1|  putative family protein                            195   1e-54   
ref|NP_001025742.1|  SUMO-activating enzyme subunit 2                   191   1e-54   
ref|XP_007906080.1|  PREDICTED: SUMO-activating enzyme subunit 2        195   1e-54   
gb|ENH81397.1|  ubiquitin-like activating enzyme                        196   2e-54   
ref|XP_001931147.1|  ubiquitin-activating enzyme E1 3                   194   2e-54   
ref|XP_002401331.1|  ubiquitin-activating enzyme E1b, putative          193   2e-54   
ref|XP_008730096.1|  hypothetical protein G647_07560                    194   2e-54   
ref|XP_006797529.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    192   2e-54   
ref|XP_003303233.1|  hypothetical protein PTT_15364                     194   2e-54   
gb|KFM64473.1|  SUMO-activating enzyme subunit 2                        194   2e-54   
gb|KHO01854.1|  Molybdenum cofactor biosynthesis, MoeB                  195   2e-54   
ref|XP_007721724.1|  ubiquitin-like 1-activating enzyme E1 B            194   3e-54   
gb|KIW33830.1|  hypothetical protein PV07_00649                         194   3e-54   
gb|KIV87473.1|  hypothetical protein PV11_03016                         194   3e-54   
ref|NP_001017091.1|  SUMO-activating enzyme subunit 2                   194   3e-54   
ref|XP_004069788.1|  PREDICTED: SUMO-activating enzyme subunit 2        194   4e-54   
ref|XP_001849594.1|  ubiquitin-activating enzyme E1                     194   4e-54   
sp|Q7ZY60.2|SAE2B_XENLA  RecName: Full=SUMO-activating enzyme sub...    194   4e-54   
ref|NP_001083988.1|  ubiquitin-like modifier activating enzyme 2        194   4e-54   
ref|XP_005498006.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-li...    190   4e-54   
gb|EWG43008.1|  ubiquitin-like 1-activating enzyme E1 B                 193   5e-54   
gb|KEF53060.1|  ubiquitin-like 1-activating enzyme E1 B                 193   5e-54   
sp|Q7SXG4.2|SAE2_DANRE  RecName: Full=SUMO-activating enzyme subu...    193   6e-54   
ref|XP_002835647.1|  hypothetical protein                               193   6e-54   
ref|XP_003757217.1|  PREDICTED: SUMO-activating enzyme subunit 2        193   6e-54   
ref|WP_028833217.1|  hypothetical protein                               191   6e-54   
ref|NP_998528.1|  SUMO-activating enzyme subunit 2                      193   7e-54   
ref|XP_009296133.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    193   7e-54   
gb|AAI52219.1|  Uba2 protein                                            193   7e-54   
ref|XP_009296132.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    193   8e-54   
ref|NP_001135121.1|  SUMO-activating enzyme subunit 2                   193   8e-54   
ref|XP_006010426.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    192   9e-54   
ref|XP_006010427.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    192   1e-53   
ref|XP_003439482.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    193   1e-53   
gb|KIW06570.1|  hypothetical protein, variant                           192   1e-53   
ref|XP_005449438.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    193   1e-53   
ref|XP_005152234.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    192   1e-53   
gb|KDN67351.1|  putative ThiF family protein                            193   1e-53   
ref|XP_007553256.1|  PREDICTED: SUMO-activating enzyme subunit 2        192   1e-53   
ref|XP_005152235.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    192   1e-53   
ref|XP_005530190.1|  PREDICTED: SUMO-activating enzyme subunit 2        193   1e-53   
ref|XP_008410714.1|  PREDICTED: SUMO-activating enzyme subunit 2        192   1e-53   
emb|CDQ59515.1|  unnamed protein product                                192   1e-53   
ref|XP_008284749.1|  PREDICTED: SUMO-activating enzyme subunit 2        192   1e-53   
gb|KDR14472.1|  SUMO-activating enzyme subunit 2                        192   1e-53   
dbj|GAN09446.1|  ubiquitin-activating enzyme-like protein               192   1e-53   
ref|XP_003481872.2|  PREDICTED: SUMO-activating enzyme subunit 2-...    187   1e-53   
ref|XP_004439757.1|  PREDICTED: SUMO-activating enzyme subunit 2        192   1e-53   
ref|XP_009230233.1|  SUMO-activating enzyme subunit uba-2               193   1e-53   
ref|XP_005751567.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    192   1e-53   
ref|XP_004564679.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    192   1e-53   
ref|XP_004450344.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    189   2e-53   
gb|KIW64195.1|  hypothetical protein PV04_09148                         192   2e-53   
ref|XP_005751568.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    192   2e-53   
ref|XP_008165241.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    192   2e-53   
ref|XP_007760767.1|  ubiquitin-like 1-activating enzyme E1 B            192   2e-53   
emb|CAD67688.1|  putative ubiquitin activating enzyme                   192   2e-53   
gb|KIX08246.1|  hypothetical protein Z518_02902                         192   2e-53   
ref|XP_005814976.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    192   2e-53   
ref|XP_007800077.1|  hypothetical protein EPUS_02054                    192   2e-53   
ref|XP_001957576.1|  GF10481                                            192   2e-53   
ref|XP_006641254.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    192   2e-53   
ref|XP_003977790.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    191   3e-53   
ref|XP_011253684.1|  PREDICTED: SUMO-activating enzyme subunit 2        191   3e-53   
gb|EPY54243.1|  SUMO E1-like activator enzyme Fub2                      191   3e-53   
gb|EPB86380.1|  hypothetical protein HMPREF1544_06822                   189   4e-53   
ref|XP_003977791.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    191   4e-53   
ref|XP_314735.3|  AGAP008637-PA                                         191   4e-53   
ref|XP_003229749.2|  PREDICTED: SUMO-activating enzyme subunit 2        191   4e-53   
ref|XP_001362253.2|  PREDICTED: SUMO-activating enzyme subunit 2        191   4e-53   
ref|XP_010882326.1|  PREDICTED: SUMO-activating enzyme subunit 2        191   4e-53   
ref|XP_011393553.1|  ubiquitin-activating enzyme E1 3, variant          191   4e-53   
ref|XP_969731.1|  PREDICTED: SUMO-activating enzyme subunit 2           191   5e-53   
gb|KIV93591.1|  hypothetical protein PV10_04794                         191   5e-53   
ref|XP_008309250.1|  PREDICTED: SUMO-activating enzyme subunit 2        191   6e-53   
ref|XP_010750151.1|  PREDICTED: SUMO-activating enzyme subunit 2        191   6e-53   
ref|XP_002112065.1|  hypothetical protein TRIADDRAFT_24020              189   6e-53   
ref|XP_007539546.1|  PREDICTED: SUMO-activating enzyme subunit 2        190   7e-53   
ref|XP_008041526.1|  hypothetical protein TRAVEDRAFT_171877             191   8e-53   
ref|XP_003796130.1|  PREDICTED: SUMO-activating enzyme subunit 2        190   8e-53   
emb|CDI51954.1|  related to ubiquitin-like protein activating enzyme    191   9e-53   
ref|XP_001983944.1|  GH15287                                            191   1e-52   
ref|XP_001971368.1|  GG14919                                            191   1e-52   
ref|XP_007368297.1|  hypothetical protein DICSQDRAFT_109452             190   1e-52   
ref|XP_009654683.1|  SUMO-activating enzyme subunit uba-2               189   1e-52   
dbj|BAF64519.1|  Uba2                                                   190   1e-52   
ref|NP_001094049.1|  SUMO-activating enzyme subunit 2                   190   1e-52   
dbj|BAE30671.1|  unnamed protein product                                190   1e-52   
ref|XP_005176919.1|  PREDICTED: SUMO-activating enzyme subunit 2        190   1e-52   
ref|NP_057891.1|  SUMO-activating enzyme subunit 2                      190   1e-52   
ref|XP_005258460.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    189   1e-52   
ref|XP_004715881.1|  PREDICTED: SUMO-activating enzyme subunit 2        190   1e-52   
ref|XP_008572925.1|  PREDICTED: SUMO-activating enzyme subunit 2        190   1e-52   
dbj|BAE37349.1|  unnamed protein product                                190   1e-52   
ref|XP_001835059.1|  Uba2                                               190   1e-52   
ref|XP_010765042.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   1e-52   
ref|XP_007740603.1|  ubiquitin-like 1-activating enzyme E1 B            189   1e-52   
ref|XP_005588845.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    189   1e-52   
pdb|3KYD|B  Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermed...    188   2e-52   
ref|XP_002065725.1|  GK19989                                            190   2e-52   
gb|KFB46233.1|  AGAP008637-PA-like protein                              189   2e-52   
ref|XP_003004427.1|  SUMO-activating enzyme subunit uba-2               189   2e-52   
ref|XP_003416367.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   2e-52   
ref|XP_004450343.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    189   2e-52   
ref|XP_004636900.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   2e-52   
ref|XP_009269112.1|  Ubiquitin-activating enzyme -like protein          189   2e-52   
ref|XP_004365946.1|  SUMO-activating enzyme subunit 2                   189   2e-52   
dbj|GAC72771.1|  SMT3/SUMO-activating complex, catalytic componen...    189   2e-52   
gb|ETS61138.1|  hypothetical protein PaG_05089                          189   2e-52   
ref|XP_007994451.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    188   2e-52   
ref|XP_006985054.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    189   2e-52   
ref|XP_004060519.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   2e-52   
ref|XP_003698305.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    189   2e-52   
ref|XP_392715.4|  PREDICTED: SUMO-activating enzyme subunit 2 iso...    189   2e-52   
ref|XP_006985055.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    189   2e-52   
gb|KIW98083.1|  hypothetical protein Z519_01667                         189   3e-52   
gb|KIJ64071.1|  hypothetical protein HYDPIDRAFT_91418                   189   3e-52   
pdb|1Y8Q|B  Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp C...    189   3e-52   
gb|EPX74392.1|  SUMO E1-like activator enzyme Fub2                      189   3e-52   
ref|XP_005330675.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   3e-52   
ref|XP_004523822.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    189   3e-52   
ref|XP_007956141.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   3e-52   
ref|NP_005490.1|  SUMO-activating enzyme subunit 2                      189   3e-52   
ref|NP_001076850.1|  SUMO-activating enzyme subunit 2                   189   3e-52   
ref|XP_006887910.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    189   3e-52   
ref|XP_010357930.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   3e-52   
ref|XP_006564548.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    189   3e-52   
ref|XP_001091974.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    189   3e-52   
ref|XP_005588844.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    189   3e-52   
ref|XP_006613941.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    189   3e-52   
ref|XP_002094123.1|  GE20372                                            189   3e-52   
ref|XP_004600771.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   3e-52   
emb|CAB66839.1|  hypothetical protein                                   189   3e-52   
ref|XP_008255503.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    188   3e-52   
ref|XP_006926858.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   3e-52   
ref|XP_011499019.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    189   3e-52   
gb|KDN36172.1|  hypothetical protein K437DRAFT_260209                   187   3e-52   
gb|EPS98210.1|  hypothetical protein FOMPIDRAFT_1165744                 189   3e-52   
ref|XP_004810606.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   3e-52   
ref|XP_008065601.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   3e-52   
ref|XP_003280049.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    188   3e-52   
ref|XP_007126498.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   3e-52   
ref|XP_004765242.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   3e-52   
ref|XP_002008124.1|  GI11997                                            189   3e-52   
ref|XP_010987427.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   4e-52   
ref|XP_533699.3|  PREDICTED: SUMO-activating enzyme subunit 2 iso...    188   4e-52   
ref|XP_002762047.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   4e-52   
ref|XP_009192384.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   4e-52   
gb|AAD23914.1|AF079566_1  ubiquitin-like protein activating enzyme      188   4e-52   
ref|XP_006217089.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   4e-52   
ref|XP_004284202.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   4e-52   
ref|XP_005368497.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   4e-52   
ref|XP_004690601.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   4e-52   
ref|XP_008255502.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    188   4e-52   
ref|XP_001354264.1|  GA20416                                            189   4e-52   
gb|EFX90312.1|  hypothetical protein DAPPUDRAFT_300104                  188   4e-52   
ref|XP_011288288.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   4e-52   
ref|XP_007165150.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    188   4e-52   
ref|XP_008837662.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   4e-52   
ref|XP_006867382.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   4e-52   
pdb|3KYC|B  Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic       188   4e-52   
ref|XP_007471025.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   4e-52   
ref|XP_004413809.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   5e-52   
ref|XP_011195668.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   5e-52   
emb|CEP10648.1|  hypothetical protein                                   187   5e-52   
emb|CCM03477.1|  predicted protein                                      180   5e-52   



>ref|XP_009606961.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nicotiana tomentosiformis]
Length=652

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASEEQ+SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
             HVGQSKAKVAREAVLKFRP I+I PYHANVKDP+F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   KHVGQSKAKVAREAVLKFRPHIRITPYHANVKDPDFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLA+GVPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLASGVPLVESGTTGFLGQVTVH  146



>ref|XP_009765006.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nicotiana sylvestris]
Length=651

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASEEQ++AIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQLAAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
             HVGQSKAKVAREAVLKFRP I+I PYHANVKDP+F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   KHVGQSKAKVAREAVLKFRPHIRITPYHANVKDPDFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLA+GVPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLASGVPLVESGTTGFLGQVTVH  146



>ref|XP_006362029.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Solanum tuberosum]
Length=652

 Score =   281 bits (719),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASEEQ+SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
             HVGQSKAKVAREAVLKFRP IKI PYHAN KDP F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   KHVGQSKAKVAREAVLKFRPHIKITPYHANAKDPEFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLA+GVPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLASGVPLVESGTTGFLGQVTVH  146



>ref|XP_011088448.1| PREDICTED: SUMO-activating enzyme subunit 2 [Sesamum indicum]
Length=648

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASE+Q+SAIK AKVLMVGAGGIGCELLK LALSGF+D+HIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEQQLSAIKGAKVLMVGAGGIGCELLKTLALSGFKDVHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVKDP F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPNISITPYHANVKDPEFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAAGVPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAGVPLVESGTTGFLGQVTVH  146



>gb|KJB47536.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
 gb|KJB47540.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=410

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASEEQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQISAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDF+KEF+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFYKEFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_006423381.1| hypothetical protein CICLE_v100281691mg, partial [Citrus clementina]
 gb|ESR36621.1| hypothetical protein CICLE_v100281691mg, partial [Citrus clementina]
Length=176

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M SE Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MVSERQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP + I  +HANVKDP F V+FFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPQMSITAHHANVKDPKFNVEFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_010251621.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nelumbo nucifera]
Length=647

 Score =   278 bits (711),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASEEQ+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQLLAIKKAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAREAVL+FRP I I PYHANVKDP F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVAREAVLRFRPHISITPYHANVKDPEFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAANVPLVESGTTGFLGQVTVH  146



>ref|XP_004230873.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Solanum 
lycopersicum]
Length=650

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASEE +SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEHLSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
             HVGQSKAKVAR+AVL+FRP IKI PYHANVKDP F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   KHVGQSKAKVARDAVLRFRPHIKITPYHANVKDPEFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLA+GVPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLASGVPLVESGTTGFLGQVTVH  146



>gb|KJB47539.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
 gb|KJB47541.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=539

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASEEQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQISAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDF+KEF+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFYKEFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>emb|CDO97017.1| unnamed protein product [Coffea canephora]
Length=648

 Score =   275 bits (704),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MA+E+Q+SAIK +KVLMVGAGGIGCELLK LALS FQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MATEQQLSAIKGSKVLMVGAGGIGCELLKTLALSEFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVKDP+F VDFFK F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPNISITPYHANVKDPDFNVDFFKRFSVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAAGVPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAGVPLVESGTTGFLGQVTVH  146



>ref|XP_010942467.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Elaeis guineensis]
Length=644

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS  Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASWSQLEAIKTAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I P+HANVKDP F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITPHHANVKDPEFNVDFFKDFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAAGVPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAGVPLVESGTTGFLGQVTVH  146



>gb|KJB47537.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=651

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASEEQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQISAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDF+KEF+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFYKEFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>gb|KJB32554.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=523

 Score =   270 bits (690),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MA++EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MAAQEQLSAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDFFKEF+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFFKEFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA +PLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADIPLVESGTTGFLGQVTVH  146



>ref|XP_010107832.1| SUMO-activating enzyme subunit 2 [Morus notabilis]
 gb|EXC17232.1| SUMO-activating enzyme subunit 2 [Morus notabilis]
Length=601

 Score =   272 bits (695),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASE   SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASENHFSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVK P+F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITPYHANVKGPDFDVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVH  146



>ref|XP_007042098.1| SUMO-activating enzyme 2 isoform 2 [Theobroma cacao]
 gb|EOX97929.1| SUMO-activating enzyme 2 isoform 2 [Theobroma cacao]
Length=525

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS+EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASQEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+ RP I I PYHANVK+  F VDFFKEF+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRVRPNISITPYHANVKESRFNVDFFKEFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>gb|KDO49458.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=410

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M SE Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MVSERQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP + I  +HANVKDP F V+FFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPQMSITAHHANVKDPKFNVEFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>gb|KJB32553.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=648

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MA++EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MAAQEQLSAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDFFKEF+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFFKEFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA +PLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADIPLVESGTTGFLGQVTVH  146



>ref|XP_008797037.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008775121.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
Length=645

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS  Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASGSQLEAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVKDP F V+FFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITPYHANVKDPEFNVEFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVH  146



>ref|XP_007042099.1| SUMO-activating enzyme 2 isoform 3 [Theobroma cacao]
 gb|EOX97930.1| SUMO-activating enzyme 2 isoform 3 [Theobroma cacao]
Length=578

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS+EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASQEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+ RP I I PYHANVK+  F VDFFKEF+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRVRPNISITPYHANVKESRFNVDFFKEFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_007042097.1| SUMO-activating enzyme 2 isoform 1 [Theobroma cacao]
 gb|EOX97928.1| SUMO-activating enzyme 2 isoform 1 [Theobroma cacao]
Length=649

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS+EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASQEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+ RP I I PYHANVK+  F VDFFKEF+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRVRPNISITPYHANVKESRFNVDFFKEFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_008236951.1| PREDICTED: SUMO-activating enzyme subunit 2 [Prunus mume]
Length=642

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS + + A+K AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLKHLPAVKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAREAVLKFRP I I PYHANVKD +F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVAREAVLKFRPHISITPYHANVKDSDFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPL+ESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLIESGTTGFLGQVTVH  146



>ref|XP_007199741.1| hypothetical protein PRUPE_ppa002704mg [Prunus persica]
 gb|EMJ00940.1| hypothetical protein PRUPE_ppa002704mg [Prunus persica]
Length=642

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS + + A+K AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLKHLPAVKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAREAVLKFRP I I PYHANVKD +F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVAREAVLKFRPHISITPYHANVKDSDFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPL+ESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLIESGTTGFLGQVTVH  146



>ref|NP_001145407.1| uncharacterized protein LOC100278764 [Zea mays]
 gb|ACG47331.1| hypothetical protein [Zea mays]
Length=370

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 2/146 (1%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            +AS E+  A+KAAKVLMVGAGGIGCELLK LALSGF DIHIID+DTIEVSNLNRQFLFRQ
Sbjct  4    VASSEE--AVKAAKVLMVGAGGIGCELLKTLALSGFSDIHIIDLDTIEVSNLNRQFLFRQ  61

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVKD +F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  62   SHVGQSKAKVARDAVLKFRPNINITPYHANVKDSHFNVDFFKQFNVVLNGLDNLDARRHV  121

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  122  NRLCLAAEVPLVESGTTGFLGQVTVH  147



>ref|XP_004289650.1| PREDICTED: SUMO-activating enzyme subunit 2 [Fragaria vesca subsp. 
vesca]
Length=640

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MA+++   AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MATQKHSPAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I  YHANVKDP+F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITSYHANVKDPDFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPL+ESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLIESGTTGFLGQVTVH  146



>gb|KDO49457.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=563

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M SE Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MVSERQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP + I  +HANVKDP F V+FFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPQMSITAHHANVKDPKFNVEFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_009372987.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Pyrus x bretschneideri]
Length=643

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS + ++A+K AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASRKHLAAVKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAREAVLKFRP I I  YHANVKD +F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVAREAVLKFRPEISITSYHANVKDSDFNVDFFKKFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPL+ESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLIESGTTGFLGQVTVH  146



>ref|XP_010429058.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=625

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINISSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_010472141.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=628

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINISSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_008382303.1| PREDICTED: SUMO-activating enzyme subunit 2 [Malus domestica]
Length=644

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS + ++A+K AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASRKHLAAVKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAREAVLKFRP I I  YHANVKD +F VDFFK FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVAREAVLKFRPEISITSYHANVKDSDFNVDFFKNFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPL+ESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLIESGTTGFLGQVTVH  146



>ref|XP_010066186.1| PREDICTED: SUMO-activating enzyme subunit 2 [Eucalyptus grandis]
Length=650

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M S   +SAIK AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MDSPPPLSAIKDAKVLMVGAGGIGCELLKTLALSGFPDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
             HVGQSKAKVAREAVL+FRP I I PYHANVKDP+F VDFFK+F+VVLNGLDNLDARRHV
Sbjct  61   KHVGQSKAKVAREAVLRFRPNISITPYHANVKDPDFNVDFFKQFSVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_010416892.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=624

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINISSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>gb|KDO49456.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=652

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M SE Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MVSERQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP + I  +HANVKDP F V+FFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPQMSITAHHANVKDPKFNVEFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|NP_179742.2| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 dbj|BAC42380.1| putative ubiquitin activating enzyme [Arabidopsis thaliana]
 gb|ACI31306.1| At2g21470 [Arabidopsis thaliana]
 gb|AEC07181.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=625

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MA+++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MATQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPNINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_006487357.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Citrus sinensis]
Length=651

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M SE Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MVSERQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP + I  +HANVKDP F V+FFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPQMSITAHHANVKDPKFNVEFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|NP_001189570.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 gb|AEC07183.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=628

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MA+++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MATQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPNINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_006838625.1| hypothetical protein AMTR_s00002p00233990 [Amborella trichopoda]
 gb|ERN01194.1| hypothetical protein AMTR_s00002p00233990 [Amborella trichopoda]
Length=652

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASE+++ AIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEQELQAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
             HVGQSKAKVAREAVLKFRP I I  +HANVK+  F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   CHVGQSKAKVAREAVLKFRPNINITAHHANVKNSEFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAAGVPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAGVPLVESGTTGFLGQVTVH  146



>ref|XP_008357172.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Malus domestica]
Length=644

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS + ++A+K AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASRKHLAAVKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAREAVLKFRP I I  YHANVKD +F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVAREAVLKFRPEISITSYHANVKDSDFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCL A VPL+ESGTTGFLGQVTVH
Sbjct  121  NRLCLGADVPLIESGTTGFLGQVTVH  146



>ref|XP_010531451.1| PREDICTED: SUMO-activating enzyme subunit 2 [Tarenaya hassleriana]
Length=647

 Score =   265 bits (678),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            +SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQSHVGQS
Sbjct  11   LSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  70

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KAKVAR+AVL+FRP I I PYHANVKDP F VDFFK+F+VVLNGLDNLDARRHVNRLCLA
Sbjct  71   KAKVARDAVLRFRPHINITPYHANVKDPEFDVDFFKQFDVVLNGLDNLDARRHVNRLCLA  130

Query  585  AGVPLVESGTTGFLGQVTVH  644
            A VPLVESGTTGFLGQVTVH
Sbjct  131  ADVPLVESGTTGFLGQVTVH  150



>gb|KFK32895.1| hypothetical protein AALP_AA6G302000 [Arabis alpina]
Length=624

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MA++EQ SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MATQEQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F  DFFK+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINISSYHANVKNPEFDADFFKQFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA +PLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADIPLVESGTTGFLGQVTVH  146



>ref|XP_002283529.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Vitis 
vinifera]
Length=634

 Score =   265 bits (676),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS ++  AIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASHQRSPAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVKDP+F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPHISITSYHANVKDPDFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLA+ VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLASDVPLVESGTTGFLGQVTVH  146



>ref|NP_973506.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 sp|Q9SJT1.1|SAE2_ARATH RecName: Full=SUMO-activating enzyme subunit 2; AltName: Full=Protein 
EMBRYO DEFECTIVE 2764; AltName: Full=Ubiquitin-like 
1-activating enzyme E1B [Arabidopsis thaliana]
 gb|AAD23691.1| putative ubiquitin activating enzyme [Arabidopsis thaliana]
 gb|AEC07182.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=700

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MA+++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MATQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPNINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_009412808.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412809.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412810.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
Length=645

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M S+ +  AIK AKVLMVGAGGIGCELLK LALSGFQD+HIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MGSDLKEEAIKRAKVLMVGAGGIGCELLKTLALSGFQDVHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKF P I I PYHANVKDP F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFMPQINITPYHANVKDPGFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPL+ESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLIESGTTGFLGQVTVH  146



>ref|XP_002878554.1| sumo-activating enzyme 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54813.1| sumo-activating enzyme 2 [Arabidopsis lyrata subsp. lyrata]
Length=678

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MA+++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MATQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_006293831.1| hypothetical protein CARUB_v10022825mg [Capsella rubella]
 gb|EOA26729.1| hypothetical protein CARUB_v10022825mg [Capsella rubella]
Length=624

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MA+ +Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MAALQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPNINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVH  146



>ref|XP_011037464.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Populus 
euphratica]
Length=648

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS +   AIK AKVLMVGAGGIGCELLK LALS FQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLQHSQAIKGAKVLMVGAGGIGCELLKTLALSDFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I PYHAN KD NF VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPHISITPYHANAKDSNFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVH  146



>ref|XP_010690827.1| PREDICTED: SUMO-activating enzyme subunit 2 [Beta vulgaris subsp. 
vulgaris]
Length=643

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS+ Q++AIK AK+LMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASQHQLNAIKGAKILMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I  YHANVK  +F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITAYHANVKSSDFKVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NR+CLAAGVPLVESGTTGFLGQV VH
Sbjct  121  NRICLAAGVPLVESGTTGFLGQVAVH  146



>ref|XP_011047900.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Populus 
euphratica]
Length=657

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS +   AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLQHSQAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I PYHAN KD NF VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPHISITPYHANAKDSNFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTV 
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVQ  146



>ref|XP_008777005.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Phoenix 
dactylifera]
Length=655

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS  Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASGSQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
             HVGQSKAKVAR+AVLKFRP I I PYHANVKDP F V+FFK+FNVVLNGLDNLDARRHV
Sbjct  61   CHVGQSKAKVARDAVLKFRPHINITPYHANVKDPEFNVEFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQV  +
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVNCY  146



>ref|XP_011047909.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Populus 
euphratica]
Length=652

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS +   AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLQHSQAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I PYHAN KD NF VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPHISITPYHANAKDSNFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTV 
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVQ  146



>ref|XP_009399956.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=555

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M S+ +  AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MDSDSKTEAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+ VL+F P I I PYHANVKDP F VDFFK+FNV+LNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDVVLRFMPRICITPYHANVKDPEFNVDFFKKFNVILNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVH  146



>gb|KDP41752.1| hypothetical protein JCGZ_26770 [Jatropha curcas]
Length=628

 Score =   262 bits (670),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS +  SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLQHSSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVKD  F VDF K+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITPYHANVKDTFFNVDFLKQFSVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVH  146



>ref|XP_007133804.1| hypothetical protein PHAVU_011G210500g [Phaseolus vulgaris]
 gb|ESW05798.1| hypothetical protein PHAVU_011G210500g [Phaseolus vulgaris]
Length=642

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            + +K AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQSHVGQSK
Sbjct  9    AVVKDAKVLMVGAGGIGCELLKTLALSGFPDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  68

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            AKVAR+AVLKFRP I I PYHANVKDP F VDFFK+FNVVLNGLDNLDARRHVNRLCLAA
Sbjct  69   AKVARDAVLKFRPHIDITPYHANVKDPEFNVDFFKQFNVVLNGLDNLDARRHVNRLCLAA  128

Query  588  GVPLVESGTTGFLGQVTVH  644
             VPLVESGTTGFLGQVTVH
Sbjct  129  NVPLVESGTTGFLGQVTVH  147



>gb|KHN19464.1| SUMO-activating enzyme subunit 2 [Glycine soja]
Length=636

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S IK AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQ HVGQSK
Sbjct  7    SVIKDAKVLMVGAGGIGCELLKTLALSGFPDIHIIDMDTIEVSNLNRQFLFRQFHVGQSK  66

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            AKVAR+AVLKFRP I I PYHANVKDP F VDFFK+FNVVLNGLDNLDARRHVNRLCLAA
Sbjct  67   AKVARDAVLKFRPHINITPYHANVKDPEFNVDFFKQFNVVLNGLDNLDARRHVNRLCLAA  126

Query  588  GVPLVESGTTGFLGQVTVH  644
             VPLVESGTTGFLGQVTVH
Sbjct  127  NVPLVESGTTGFLGQVTVH  145



>ref|XP_003540521.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Glycine max]
Length=636

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S IK AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQ HVGQSK
Sbjct  7    SVIKDAKVLMVGAGGIGCELLKTLALSGFPDIHIIDMDTIEVSNLNRQFLFRQFHVGQSK  66

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            AKVAR+AVLKFRP I I PYHANVKDP F VDFFK+FNVVLNGLDNLDARRHVNRLCLAA
Sbjct  67   AKVARDAVLKFRPHINITPYHANVKDPEFNVDFFKQFNVVLNGLDNLDARRHVNRLCLAA  126

Query  588  GVPLVESGTTGFLGQVTVH  644
             VPLVESGTTGFLGQVTVH
Sbjct  127  NVPLVESGTTGFLGQVTVH  145



>ref|XP_009399955.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=645

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M S+ +  AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MDSDSKTEAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+ VL+F P I I PYHANVKDP F VDFFK+FNV+LNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDVVLRFMPRICITPYHANVKDPEFNVDFFKKFNVILNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVH  146



>ref|XP_002460940.1| hypothetical protein SORBIDRAFT_02g037850 [Sorghum bicolor]
 gb|EER97461.1| hypothetical protein SORBIDRAFT_02g037850 [Sorghum bicolor]
Length=641

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +KAAKVLMVGAGGIGCELLK LALSGF DIHIID+DTIEVSNLNRQFLFRQSHVGQSKAK
Sbjct  14   VKAAKVLMVGAGGIGCELLKTLALSGFSDIHIIDLDTIEVSNLNRQFLFRQSHVGQSKAK  73

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VAR+AVLKFRP I I PYHANVKD NF VDFFK+FNVVLNGLDNLDARRHVNRLCLAA V
Sbjct  74   VARDAVLKFRPNINITPYHANVKDSNFNVDFFKQFNVVLNGLDNLDARRHVNRLCLAAEV  133

Query  594  PLVESGTTGFLGQVTVH  644
            PLVESGTTGFLGQVTVH
Sbjct  134  PLVESGTTGFLGQVTVH  150



>ref|XP_010938776.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Elaeis 
guineensis]
Length=648

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS  Q+ AIK AKVLMVGAGGIGCELLK LALSGF+DI+IIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASGSQLEAIKRAKVLMVGAGGIGCELLKTLALSGFRDIYIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I P HAN+KDP F V+FFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLKFRPHINITPCHANIKDPEFDVEFFKKFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVH  146



>ref|XP_006404595.1| hypothetical protein EUTSA_v10000089mg [Eutrema salsugineum]
 gb|ESQ46048.1| hypothetical protein EUTSA_v10000089mg [Eutrema salsugineum]
Length=626

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M ++ Q SA+KAAKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MDTQHQQSALKAAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F  DFFK+F+V+LNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINIRSYHANVKNPEFDADFFKQFDVILNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_003541605.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Glycine max]
 gb|KHN37632.1| SUMO-activating enzyme subunit 2 [Glycine soja]
Length=638

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQ HVGQSKAK
Sbjct  11   IKDAKVLMVGAGGIGCELLKTLALSGFPDIHIIDMDTIEVSNLNRQFLFRQFHVGQSKAK  70

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VAR+AVLKFRP I I PYHANVKDP F VDFFK+FNVVLNGLDNLDARRHVNRLCLAA V
Sbjct  71   VARDAVLKFRPHINITPYHANVKDPEFNVDFFKQFNVVLNGLDNLDARRHVNRLCLAANV  130

Query  594  PLVESGTTGFLGQVTVH  644
            PLVESGTTGFLGQVTVH
Sbjct  131  PLVESGTTGFLGQVTVH  147



>ref|XP_008460981.1| PREDICTED: SUMO-activating enzyme subunit 2 [Cucumis melo]
Length=641

 Score =   260 bits (664),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS++Q+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQLSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRK  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVG SKAKVAR+AVL+FRP + I  YHANVK+  F VDFFK+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGLSKAKVARDAVLRFRPHVSITSYHANVKNQEFNVDFFKQFSVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>gb|KEH19101.1| SUMO1 activating enzyme subunit 2 [Medicago truncatula]
Length=635

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S IK AKVLMVGAGGIGCELLK LALSGF +IHIIDMDTIEVSNLNRQFLFRQSHVGQSK
Sbjct  4    SIIKDAKVLMVGAGGIGCELLKTLALSGFSEIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  63

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            AKVAR+AVLKFRP I I  YHANVKDP+F VDFFK+FNVVLNGLDNLDARRHVNRLCLAA
Sbjct  64   AKVARDAVLKFRPKINITSYHANVKDPDFNVDFFKQFNVVLNGLDNLDARRHVNRLCLAA  123

Query  588  GVPLVESGTTGFLGQVTVH  644
             VPLVESGTTGFLGQVTVH
Sbjct  124  DVPLVESGTTGFLGQVTVH  142



>ref|XP_004510996.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Cicer arietinum]
Length=628

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS    S IK AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASSSS-SPIKDAKVLMVGAGGIGCELLKTLALSGFSDIHIIDMDTIEVSNLNRQFLFRQ  59

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVLKFRP I I  YHANVK P+F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  60   SHVGQSKAKVARDAVLKFRPHINITSYHANVKGPDFNVDFFKQFNVVLNGLDNLDARRHV  119

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  120  NRLCLAADVPLVESGTTGFLGQVTVH  145



>emb|CDY13814.1| BnaA09g43160D [Brassica napus]
Length=630

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S+I+ AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+SHVGQSK
Sbjct  11   SSIQGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRRSHVGQSK  70

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            AKVAR+AVLKFRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHVNRLCLAA
Sbjct  71   AKVARDAVLKFRPHINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHVNRLCLAA  130

Query  588  GVPLVESGTTGFLGQVTVH  644
             VPLVESGTTGFLGQVTVH
Sbjct  131  DVPLVESGTTGFLGQVTVH  149



>ref|NP_001060130.1| Os07g0586500 [Oryza sativa Japonica Group]
 dbj|BAF22044.1| Os07g0586500 [Oryza sativa Japonica Group]
 dbj|BAH00126.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +KAAKVLMVGAGGIGCELLK LALSGF+DIHIID+DTIEVSNLNRQFLFRQSHVGQSKA 
Sbjct  15   VKAAKVLMVGAGGIGCELLKTLALSGFRDIHIIDLDTIEVSNLNRQFLFRQSHVGQSKAH  74

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VAR+AVLKFRP I I  YHANVKD  F V+FFK+FNVVLNGLDNLDARRHVNRLCLAA V
Sbjct  75   VARDAVLKFRPNINITSYHANVKDAQFNVEFFKQFNVVLNGLDNLDARRHVNRLCLAAEV  134

Query  594  PLVESGTTGFLGQVTVH  644
            PLVESGTTGFLGQVTVH
Sbjct  135  PLVESGTTGFLGQVTVH  151



>emb|CDX99589.1| BnaC04g33460D [Brassica napus]
Length=629

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            SAI+ AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFR+SHVGQSK
Sbjct  10   SAIQGAKVLMVGAGGIGCELLKTLALSGFHDIHIIDMDTIEVSNLNRQFLFRRSHVGQSK  69

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            AKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHVNRLCLAA
Sbjct  70   AKVARDAVLRFRPHINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHVNRLCLAA  129

Query  588  GVPLVESGTTGFLGQVTVH  644
             VPLVESGTTGFLGQVTVH
Sbjct  130  DVPLVESGTTGFLGQVTVH  148



>ref|XP_009140282.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Brassica rapa]
Length=627

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            SAI+ AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFR+SHVGQSK
Sbjct  8    SAIQGAKVLMVGAGGIGCELLKTLALSGFHDIHIIDMDTIEVSNLNRQFLFRRSHVGQSK  67

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            AKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHVNRLCLAA
Sbjct  68   AKVARDAVLRFRPHINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHVNRLCLAA  127

Query  588  GVPLVESGTTGFLGQVTVH  644
             VPLVESGTTGFLGQVTVH
Sbjct  128  DVPLVESGTTGFLGQVTVH  146



>ref|XP_004150065.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Cucumis sativus]
 gb|KGN61828.1| hypothetical protein Csa_2G249830 [Cucumis sativus]
Length=641

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS++Q+S IK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQLSVIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRK  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVG SKAKVAR+AVL+FRP + I  YHANVK+  F VDF K+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGLSKAKVARDAVLRFRPQVSITSYHANVKNQEFNVDFLKQFSVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>ref|XP_004165550.1| PREDICTED: LOW QUALITY PROTEIN: SUMO-activating enzyme subunit 
2-like [Cucumis sativus]
Length=641

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS++Q+S IK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQLSVIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRK  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVG SKAKVAR+AVL+FRP + I  YHANVK+  F VDF K+F+VVLNGLDNLDARRHV
Sbjct  61   SHVGLSKAKVARDAVLRFRPQVSITSYHANVKNQEFNVDFLKQFSVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAADVPLVESGTTGFLGQVTVH  146



>emb|CDY15890.1| BnaA04g12210D [Brassica napus]
Length=627

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            SAI+ AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFR+SHVGQSK
Sbjct  8    SAIQGAKVLMVGAGGIGCELLKTLALSGFHDIHIIDMDTIEVSNLNRQFLFRRSHVGQSK  67

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            AKVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHVNRLCLAA
Sbjct  68   AKVARDAVLRFRPHINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHVNRLCLAA  127

Query  588  GVPLVESGTTGFLGQVTVH  644
             VPLVESGTTGFLGQVTVH
Sbjct  128  DVPLVESGTTGFLGQVTVH  146



>ref|XP_010236228.1| PREDICTED: SUMO-activating enzyme subunit 2 [Brachypodium distachyon]
Length=623

 Score =   254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS     A+KAAKVLMVGAGGIGCELLK LAL+GF DIH+ID+DTIEVSNLNRQFLFR+
Sbjct  1    MASAASEEAVKAAKVLMVGAGGIGCELLKTLALTGFSDIHLIDLDTIEVSNLNRQFLFRK  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKA VAR+AVLKFRP I I  YHANVKD  F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAHVARDAVLKFRPKINISSYHANVKDAQFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVH  146



>ref|XP_004958165.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Setaria italica]
Length=638

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +KAAKVLMVGAGGIGCELLK LALSGF D+HIID+DTIEVSNLNRQFLFRQSHVGQSKAK
Sbjct  11   VKAAKVLMVGAGGIGCELLKTLALSGFSDVHIIDLDTIEVSNLNRQFLFRQSHVGQSKAK  70

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VAR+AVLKFRP I I PYHANVKD  F V+FFK+F+VVLNGLDNLDARRHVNRLCLAA V
Sbjct  71   VARDAVLKFRPNINITPYHANVKDSTFNVEFFKQFSVVLNGLDNLDARRHVNRLCLAAEV  130

Query  594  PLVESGTTGFLGQVTVH  644
            PLVESGTTGFLGQVTVH
Sbjct  131  PLVESGTTGFLGQVTVH  147



>ref|XP_009117402.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Brassica rapa]
Length=630

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S I+ AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+SHVGQSK
Sbjct  11   SFIQGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRRSHVGQSK  70

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            +KVAR+AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHVNRLCLAA
Sbjct  71   SKVARDAVLRFRPHINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHVNRLCLAA  130

Query  588  GVPLVESGTTGFLGQVTVH  644
             VPLVESGTTGFLGQVTVH
Sbjct  131  DVPLVESGTTGFLGQVTVH  149



>emb|CDX82033.1| BnaC08g35680D [Brassica napus]
Length=628

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +3

Query  243  AKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR  422
            AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+SHVGQSKAKVAR
Sbjct  14   AKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRRSHVGQSKAKVAR  73

Query  423  EAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLV  602
            +AVL+FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHVNRLCLAA VPLV
Sbjct  74   DAVLRFRPQINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHVNRLCLAADVPLV  133

Query  603  ESGTTGFLGQVTVH  644
            ESGTTGFLGQVTVH
Sbjct  134  ESGTTGFLGQVTVH  147



>ref|XP_002512954.1| ubiquitin-activating enzyme E1b, putative [Ricinus communis]
 gb|EEF49457.1| ubiquitin-activating enzyme E1b, putative [Ricinus communis]
Length=644

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M+S    SA+K AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MSSLLHSSAVKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRK  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+F+P I+I  YHANVKD +F VDFFK+F+ VLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVARDAVLRFKPHIRITSYHANVKDSDFNVDFFKQFSAVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  121  NRLCLAAEVPLVESGTTGFLGQVTVH  146



>ref|XP_009347843.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=644

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS + ++A+  AKVLMVGAGGIG E    LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASRKHLAAVMGAKVLMVGAGGIGSEPFTTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAREAVLKFRP I I  YHANVKD +F VDFFK+FNVVLNGLDNLDARRHV
Sbjct  61   SHVGQSKAKVAREAVLKFRPEISITSYHANVKDSDFNVDFFKQFNVVLNGLDNLDARRHV  120

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCL A VPL+ESGTTGFLGQVTVH
Sbjct  121  NRLCLGADVPLIESGTTGFLGQVTVH  146



>gb|EYU37827.1| hypothetical protein MIMGU_mgv1a002832mg [Erythranthe guttata]
Length=633

 Score =   252 bits (644),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  255  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  434
            MVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR+AVL
Sbjct  1    MVGAGGIGCELLKTLALSGFKDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVARDAVL  60

Query  435  KFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGT  614
            KFRP I I PYHANVKDP+F VDFFK+FNVVLNGLDNLDARRHVNRLCLAAGVPLVESGT
Sbjct  61   KFRPHISITPYHANVKDPDFNVDFFKQFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGT  120

Query  615  TGFLGQ-VTVH  644
            TGFLGQ VTVH
Sbjct  121  TGFLGQVVTVH  131



>gb|EEC82353.1| hypothetical protein OsI_26664 [Oryza sativa Indica Group]
Length=634

 Score =   252 bits (643),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +KAAKVLMVGAGGIGCELLK LALSGF+DIHIID+DTIEVSNLNRQFLFRQSHVGQSKA 
Sbjct  15   VKAAKVLMVGAGGIGCELLKTLALSGFRDIHIIDLDTIEVSNLNRQFLFRQSHVGQSKAH  74

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VAR+AVLKFRP I I  YHANVKD  F V+FFK+FNVVLNGLDNLDARRHVNRLCLAA V
Sbjct  75   VARDAVLKFRPNINITSYHANVKDAQFNVEFFKQFNVVLNGLDNLDARRHVNRLCLAAEV  134

Query  594  PLVESGTTGFLGQVTVH  644
            PLVESGTTGFLGQVTVH
Sbjct  135  PLVESGTTGFLGQVTVH  151



>gb|EMT21367.1| SUMO-activating enzyme subunit 2 [Aegilops tauschii]
Length=629

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +KAAKVLMVGAGGIGCELLK LALSGF DIH+ID+DTIEVSNLNRQFLFR+SHVGQSKA 
Sbjct  14   VKAAKVLMVGAGGIGCELLKTLALSGFSDIHVIDLDTIEVSNLNRQFLFRKSHVGQSKAH  73

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VAR+A+LKFRP I IE +HANVKD  F VDFFK+FNVVLNGLDNLDARRHVNRLCLAA V
Sbjct  74   VARDAILKFRPNINIESHHANVKDAQFNVDFFKQFNVVLNGLDNLDARRHVNRLCLAAEV  133

Query  594  PLVESGTTGFLGQVTVH  644
            PLVESGTTGFLGQVTVH
Sbjct  134  PLVESGTTGFLGQVTVH  150



>gb|KJB32552.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=632

 Score =   249 bits (636),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  255  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  434
            MVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR+AVL
Sbjct  1    MVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVARDAVL  60

Query  435  KFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGT  614
            +FRP I I PYHANVK+  F VDFFKEF+VVLNGLDNLDARRHVNRLCLAA +PLVESGT
Sbjct  61   RFRPNISITPYHANVKESRFNVDFFKEFDVVLNGLDNLDARRHVNRLCLAADIPLVESGT  120

Query  615  TGFLGQVTVH  644
            TGFLGQVTVH
Sbjct  121  TGFLGQVTVH  130



>emb|CBI37697.3| unnamed protein product [Vitis vinifera]
Length=618

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  255  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  434
            MVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR+AVL
Sbjct  1    MVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVARDAVL  60

Query  435  KFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGT  614
            +FRP I I  YHANVKDP+F VDFFK+FNVVLNGLDNLDARRHVNRLCLA+ VPLVESGT
Sbjct  61   RFRPHISITSYHANVKDPDFNVDFFKQFNVVLNGLDNLDARRHVNRLCLASDVPLVESGT  120

Query  615  TGFLGQVTVH  644
            TGFLGQVTVH
Sbjct  121  TGFLGQVTVH  130



>gb|EEE67493.1| hypothetical protein OsJ_24922 [Oryza sativa Japonica Group]
Length=634

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +KAAKVLMVGAGGIGCELLK L +SGF+DI IID+DTIEVSNLNRQFLFRQSHVGQSKA 
Sbjct  15   VKAAKVLMVGAGGIGCELLKTLGVSGFRDIQIIDLDTIEVSNLNRQFLFRQSHVGQSKAH  74

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VAR+AVLKFRP I I  YHANVKD  F V+FFK+FNVVLNGLDNLDARRHVNRLCLAA V
Sbjct  75   VARDAVLKFRPNINITSYHANVKDAQFNVEFFKQFNVVLNGLDNLDARRHVNRLCLAAEV  134

Query  594  PLVESGTTGFLGQVTVH  644
            PLVESGTTGFLGQVTVH
Sbjct  135  PLVESGTTGFLGQVTVH  151



>gb|AAN03851.1| SUMO activating enzyme 2 [Arabidopsis thaliana]
Length=599

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  255  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  434
            MVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+SHVGQSKAKVAR+AVL
Sbjct  1    MVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRRSHVGQSKAKVARDAVL  60

Query  435  KFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGT  614
            +FRP I I  YHANVK+P F VDFFK+F+VVLNGLDNLDARRHVNRLCLAA VPLVESGT
Sbjct  61   RFRPNINIRSYHANVKNPEFDVDFFKQFDVVLNGLDNLDARRHVNRLCLAADVPLVESGT  120

Query  615  TGFLGQVTVH  644
            TGFLGQVTVH
Sbjct  121  TGFLGQVTVH  130



>ref|XP_006657898.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Oryza brachyantha]
Length=613

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  255  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  434
            MVGAGGIGCELLK LALSGF+DIHIID+DTIEVSNLNRQFLFRQSHVGQSKA VAR+AVL
Sbjct  1    MVGAGGIGCELLKTLALSGFRDIHIIDLDTIEVSNLNRQFLFRQSHVGQSKAHVARDAVL  60

Query  435  KFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGT  614
            KFRP I I  YHANVKD  F VDFFK+FNVVLNGLDNLDARRHVNRLCLAA VPLVESGT
Sbjct  61   KFRPNINITSYHANVKDAQFNVDFFKQFNVVLNGLDNLDARRHVNRLCLAAEVPLVESGT  120

Query  615  TGFLGQVTVH  644
            TGFLGQVTVH
Sbjct  121  TGFLGQVTVH  130



>gb|EMS58354.1| SUMO-activating enzyme subunit 2 [Triticum urartu]
Length=639

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 133/160 (83%), Gaps = 9/160 (6%)
 Frame = +3

Query  180  VSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSN  359
            +SLF  +  +    Q    +AAKVLMVGAGGIGCELLK LALSGF DIH+ID+DTIEVSN
Sbjct  5    LSLFTRTSAVTKPRQ----EAAKVLMVGAGGIGCELLKTLALSGFSDIHVIDLDTIEVSN  60

Query  360  LNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGL  539
            LNRQFLFR+SHVGQSKA VAR+A+LKFRP I IE +HANVKD  F VDFFK+FNVVLNGL
Sbjct  61   LNRQFLFRKSHVGQSKAHVARDAILKFRPNINIESHHANVKDAQFNVDFFKQFNVVLNGL  120

Query  540  DNLDARRHVNRLCLAAGVPLVESGTTGFLGQ-----VTVH  644
            DNLDARRHVNRLCLAA VPLVESGTTGFLGQ     VTVH
Sbjct  121  DNLDARRHVNRLCLAAEVPLVESGTTGFLGQYSCYKVTVH  160



>ref|XP_001762389.1| predicted protein [Physcomitrella patens]
 gb|EDQ72856.1| predicted protein [Physcomitrella patens]
Length=524

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  255  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  434
            MVGAGGIGCELLK L L+GF+ IH+IDMDTIEVSNLNRQFLFR+SHVGQSKAKVAREAVL
Sbjct  1    MVGAGGIGCELLKTLVLTGFKHIHLIDMDTIEVSNLNRQFLFRKSHVGQSKAKVAREAVL  60

Query  435  KFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGT  614
            KFRPG++I  +HANVK+  F +DFFK+F+VVLNGLDNLDARRHVNR+CLAAGVPLVESGT
Sbjct  61   KFRPGVEIVAHHANVKNQEFDIDFFKQFSVVLNGLDNLDARRHVNRMCLAAGVPLVESGT  120

Query  615  TGFLGQVTVH  644
            TG+LGQVTVH
Sbjct  121  TGYLGQVTVH  130



>gb|EPS74543.1| hypothetical protein M569_00206 [Genlisea aurea]
Length=600

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  255  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  434
            MVGAGGIGCELLK L LSGF+DIHIIDMDTIEVSNLNRQFLFRQSHVG+SKAKVA +AVL
Sbjct  1    MVGAGGIGCELLKTLVLSGFKDIHIIDMDTIEVSNLNRQFLFRQSHVGKSKAKVACDAVL  60

Query  435  KFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGT  614
            +FRP + I PYHANVKD  F VDFF++F+VVLNGLDNLDARRHVNRLCLA+GVPL+ESGT
Sbjct  61   RFRPHVSIVPYHANVKDSQFNVDFFRQFHVVLNGLDNLDARRHVNRLCLASGVPLIESGT  120

Query  615  TGFLGQVTVH  644
            TGFLGQVTVH
Sbjct  121  TGFLGQVTVH  130



>ref|XP_002990197.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
 gb|EFJ08757.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
Length=590

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +3

Query  237  KAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKV  416
            + ++VLMVGAGGIGCELLK L L+GF +I IIDMDTIEVSNLNRQFLFR+ HVGQSKAKV
Sbjct  7    QKSRVLMVGAGGIGCELLKTLVLTGFHNIDIIDMDTIEVSNLNRQFLFRKRHVGQSKAKV  66

Query  417  AREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVP  596
            AREAVLKFRP   +  YHANVKD  F VDF+++F VVLNGLDNLDARRHVNRLCLAAGVP
Sbjct  67   AREAVLKFRPDANVTSYHANVKDEQFNVDFYQQFQVVLNGLDNLDARRHVNRLCLAAGVP  126

Query  597  LVESGTTGFLGQVTVH  644
            L+ESGTTG+LGQVTVH
Sbjct  127  LIESGTTGYLGQVTVH  142



>ref|XP_002992493.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
 gb|EFJ06431.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
Length=590

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +3

Query  237  KAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKV  416
            + ++VLMVGAGGIGCELLK L L+GF +I IIDMDTIEVSNLNRQFLFR+ HVGQSKAKV
Sbjct  7    QKSRVLMVGAGGIGCELLKTLVLTGFHNIDIIDMDTIEVSNLNRQFLFRKRHVGQSKAKV  66

Query  417  AREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVP  596
            AREAVLKFRP   +  YHANVKD  F VDF+++F VVLNGLDNLDARRHVNRLCLAAGVP
Sbjct  67   AREAVLKFRPDANVTSYHANVKDEQFNVDFYQQFQVVLNGLDNLDARRHVNRLCLAAGVP  126

Query  597  LVESGTTGFLGQVTVH  644
            L+ESGTTG+LGQVTVH
Sbjct  127  LIESGTTGYLGQVTVH  142



>ref|XP_001775802.1| predicted protein [Physcomitrella patens]
 gb|EDQ59341.1| predicted protein, partial [Physcomitrella patens]
Length=618

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 125/147 (85%), Gaps = 14/147 (10%)
 Frame = +3

Query  246  KVLMVGAGGIGCELLKNLALSGFQDIHI--------------IDMDTIEVSNLNRQFLFR  383
            KVLMVGAGGIGCELLK L L+GF+ IH+              IDMDTIEVSNLNRQFLFR
Sbjct  1    KVLMVGAGGIGCELLKTLVLTGFKHIHLVNFWSCTCGSPLPQIDMDTIEVSNLNRQFLFR  60

Query  384  QSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRH  563
            +SHVGQSKA+VAREAVLKFRPG++I  +HANVK+  F +DFFK+F+VVLNGLDNLDARRH
Sbjct  61   KSHVGQSKARVAREAVLKFRPGVEIVAHHANVKNQEFDIDFFKQFSVVLNGLDNLDARRH  120

Query  564  VNRLCLAAGVPLVESGTTGFLGQVTVH  644
            VNR+CLAAGVPLVESGTTG+LGQVTVH
Sbjct  121  VNRMCLAAGVPLVESGTTGYLGQVTVH  147



>ref|XP_003063899.1| SUMO1 activating enzyme subunit 2 [Micromonas pusilla CCMP1545]
 gb|EEH52272.1| SUMO1 activating enzyme subunit 2 [Micromonas pusilla CCMP1545]
Length=623

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +3

Query  210  ASEEQMSAI---KAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLF  380
            A+ E+M+ +   +A+KVLMVGAGGIGCELLK LALSGF D+ +ID+DTI+VSNLNRQFLF
Sbjct  9    ATVEKMTDLDIARASKVLMVGAGGIGCELLKTLALSGFADVELIDLDTIDVSNLNRQFLF  68

Query  381  RQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARR  560
            R+ HVG SKAKVARE+VL FRP  KI  +H NVKD  F VDF   F+V LNGLDNLDARR
Sbjct  69   RRRHVGMSKAKVARESVLAFRPDAKITAHHGNVKDAAFDVDFVSRFDVCLNGLDNLDARR  128

Query  561  HVNRLCLAAGVPLVESGTTGFLGQVTVH  644
            HVNRLCLAA VPLVESGTTG+LGQVT H
Sbjct  129  HVNRLCLAASVPLVESGTTGYLGQVTTH  156



>ref|XP_002505850.1| SUMO1 activating enzyme subunit 2 [Micromonas sp. RCC299]
 gb|ACO67108.1| SUMO1 activating enzyme subunit 2 [Micromonas sp. RCC299]
Length=644

 Score =   220 bits (560),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +3

Query  237  KAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKV  416
            K++KVLMVGAGGIGCELLK L LSGF+DI +ID+DTI+VSNLNRQFLFR+ HVG SKAKV
Sbjct  12   KSSKVLMVGAGGIGCELLKTLVLSGFEDIEMIDLDTIDVSNLNRQFLFRKRHVGMSKAKV  71

Query  417  AREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVP  596
            ARE VLKFRP  +I  +H NVKD +F VDF + F+VVLNGLDNL+AR+HVNRLCLAA VP
Sbjct  72   ARETVLKFRPDARIVAHHGNVKDSSFDVDFVRTFDVVLNGLDNLEARKHVNRLCLAAEVP  131

Query  597  LVESGTTGFLGQVTVH  644
            L+ESGTTG+LGQVT H
Sbjct  132  LIESGTTGYLGQVTAH  147



>gb|KFX51507.1| Ubiquitin-activating enzyme E1-like, partial [Talaromyces marneffei 
PM1]
Length=223

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRNSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KFRP  K+E YHAN+KD  F +D+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  87   VAKEVAQKFRPDSKLEAYHANIKDAQFNIDWFATFDVVFNALDNLDARRHVNRMCLAANV  146

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  147  PLVESGTTGFNGQVQV  162



>gb|KFX51510.1| Ubiquitin-activating enzyme E1-like [Talaromyces marneffei PM1]
Length=264

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRNSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KFRP  K+E YHAN+KD  F +D+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  87   VAKEVAQKFRPDSKLEAYHANIKDAQFNIDWFATFDVVFNALDNLDARRHVNRMCLAANV  146

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  147  PLVESGTTGFNGQVQV  162



>gb|KEQ66215.1| putative ubiquitin-like activating enzyme [Aureobasidium melanogenum 
CBS 110374]
Length=622

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +3

Query  222  QMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQ  401
            Q + IK A++L+VGAGGIGCELLKNL  +GF +IH++D+DTI++SNLNRQFLFR +H+ +
Sbjct  14   QFTNIKNARILVVGAGGIGCELLKNLVCTGFGEIHLVDLDTIDLSNLNRQFLFRHAHIKK  73

Query  402  SKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCL  581
            SKA VAREA  KF P +KIE YHAN+KDP F VD+F++F +V N LDNLDARRHVNR+CL
Sbjct  74   SKALVAREAASKFNPNVKIEAYHANIKDPQFNVDWFRDFVIVFNALDNLDARRHVNRMCL  133

Query  582  AAGVPLVESGTTGFLGQV  635
            AA VPL+ESGTTGF GQV
Sbjct  134  AADVPLIESGTTGFNGQV  151



>gb|KEQ95428.1| hypothetical protein AUEXF2481DRAFT_5033 [Aureobasidium subglaciale 
EXF-2481]
Length=623

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +3

Query  222  QMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQ  401
            Q + IK A++L+VGAGGIGCELLKNL  +GF +IH++D+DTI++SNLNRQFLFR +H+ +
Sbjct  14   QFANIKQARILVVGAGGIGCELLKNLVCTGFGEIHVVDLDTIDLSNLNRQFLFRHAHIKK  73

Query  402  SKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCL  581
            SKA VAREA  KF P +KIE +HAN+KDP F VD+F+EF +V N LDNLDARRHVNR+CL
Sbjct  74   SKALVAREAASKFNPNVKIEAHHANIKDPQFNVDWFREFVIVFNALDNLDARRHVNRMCL  133

Query  582  AAGVPLVESGTTGFLGQV  635
            AA VPL+ESGTTGF GQV
Sbjct  134  AADVPLIESGTTGFNGQV  151



>gb|KEQ72622.1| ThiF family protein [Aureobasidium pullulans var. namibiae CBS 
147.97]
Length=623

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +3

Query  222  QMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQ  401
            Q + IK A++L+VGAGGIGCELLKNL  +GF +IH++D+DTI++SNLNRQFLFR +H+ +
Sbjct  14   QFANIKNARILVVGAGGIGCELLKNLVCTGFGEIHLVDLDTIDLSNLNRQFLFRHAHIKK  73

Query  402  SKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCL  581
            SKA VAREA  KF P +KIE +HAN+KDP F VD+F+EF +V N LDNLDARRHVNR+CL
Sbjct  74   SKALVAREAASKFNPNVKIEAHHANIKDPQFNVDWFREFVIVFNALDNLDARRHVNRMCL  133

Query  582  AAGVPLVESGTTGFLGQV  635
            AA VPL+ESGTTGF GQV
Sbjct  134  AADVPLIESGTTGFNGQV  151



>ref|XP_005844208.1| hypothetical protein CHLNCDRAFT_27175 [Chlorella variabilis]
 gb|EFN52106.1| hypothetical protein CHLNCDRAFT_27175 [Chlorella variabilis]
Length=638

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  213  SEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSH  392
            S E   A++ A+VL VGAGGIGCELLK L  SGF+ I +IDMDTIE+SNLNRQFLFR+ H
Sbjct  14   SRELKRAVREARVLTVGAGGIGCELLKTLVTSGFRHIEVIDMDTIEMSNLNRQFLFRKRH  73

Query  393  VGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNR  572
            VG SK+ VA EA    RPGI I  +  NVK+P FGVDFF+ F+ VLNGLDNL+ARRH+NR
Sbjct  74   VGMSKSVVAAEAAKHMRPGIDITAWLGNVKEPRFGVDFFRRFDCVLNGLDNLEARRHINR  133

Query  573  LCLAAGVPLVESGTTGFLGQVTVH  644
            LCLAAGVPLVESGT G+LGQV+VH
Sbjct  134  LCLAAGVPLVESGTAGYLGQVSVH  157



>gb|KEQ89414.1| hypothetical protein M438DRAFT_401525 [Aureobasidium pullulans 
EXF-150]
Length=621

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +3

Query  222  QMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQ  401
            Q + IK A++L+VGAGGIGCELLKNL  +GF +IH++D+DTI++SNLNRQFLFR +H+ +
Sbjct  14   QFANIKNARILVVGAGGIGCELLKNLVCTGFGEIHVVDLDTIDLSNLNRQFLFRHAHIKK  73

Query  402  SKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCL  581
            SKA VAREA  KF P +KIE +HAN+KDP F VD+F+ F +V N LDNLDARRHVNR+CL
Sbjct  74   SKALVAREAASKFNPNVKIEAHHANIKDPQFNVDWFRSFVIVFNALDNLDARRHVNRMCL  133

Query  582  AAGVPLVESGTTGFLGQV  635
            AA VPL+ESGTTGF GQV
Sbjct  134  AADVPLIESGTTGFNGQV  151



>ref|XP_007776555.1| ubiquitin-like 1-activating enzyme E1 B [Coniosporium apollinis 
CBS 100218]
 gb|EON61238.1| ubiquitin-like 1-activating enzyme E1 B [Coniosporium apollinis 
CBS 100218]
Length=624

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S IK +++LMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  16   SRIKQSRILMVGAGGIGCELLKNLVLTGFGEIHVVDLDTIDLSNLNRQFLFRHEHIKKSK  75

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+E+  KF P +KIE +HAN+KDP F VD+FK F +V N LDNLDARRHVNR+CLAA
Sbjct  76   ALVAKESAGKFNPNVKIEAHHANIKDPQFNVDWFKTFAIVFNALDNLDARRHVNRMCLAA  135

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  136  DVPLIESGTTGFNGQVQV  153



>ref|XP_002545122.1| hypothetical protein UREG_04639 [Uncinocarpus reesii 1704]
 gb|EEP79793.1| hypothetical protein UREG_04639 [Uncinocarpus reesii 1704]
Length=627

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +3

Query  210  ASEEQMSAI-KAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            AS +Q +AI   ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR 
Sbjct  29   ASWKQNTAIVSTSRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRH  88

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
             H+ +SKA VA+EA  KFRP  K+E YHAN+KD  F V++F+ F++V N LDNLDARRHV
Sbjct  89   EHIKKSKALVAKEAATKFRPQAKLEAYHANIKDNQFNVEWFESFDIVFNALDNLDARRHV  148

Query  567  NRLCLAAGVPLVESGTTGFLGQVTV  641
            NR+CLAA VPL+ESGTTGF GQV V
Sbjct  149  NRMCLAANVPLIESGTTGFNGQVQV  173



>gb|AHG26147.1| ubiquitin-activating enzyme E1-like protein [Shiraia sp. slf14]
Length=624

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKDARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRNEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+  KF P +KIE YH N+KDP F + +FK F +V N LDNLDARRHVNR+CLAA V
Sbjct  79   VAKESAGKFNPNVKIEAYHDNIKDPRFNIAWFKTFEIVFNALDNLDARRHVNRMCLAANV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>emb|CDP27100.1| Putative Ubiquitin-activating enzyme E1-like [Podospora anserina 
S mat+]
Length=625

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++  K ++VLMVGAGGIGCELLKNL L+GF + HI+D+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTEAKKSRVLMVGAGGIGCELLKNLVLTGFGETHIVDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA EA  KF P +KI PYHAN+KDP F +++F  F +V N LDNL+ARRHVN++CLA
Sbjct  73   KALVATEAAQKFNPNVKIVPYHANIKDPQFNIEWFSSFRIVFNALDNLEARRHVNKMCLA  132

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  133  ADVPLIESGTTGFNGQVQV  151



>gb|EKG19357.1| hypothetical protein MPH_03220 [Macrophomina phaseolina MS6]
Length=620

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKQSRVLMVGAGGIGCELLKNLVLTGFGNIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+  +F P + IE +HAN+KDP F VD+FK FN+V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKESAGRFNPHVNIEAHHANIKDPQFNVDWFKSFNLVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>ref|XP_001417248.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95541.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=518

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            ++ AKVLMVGAGGIGCELLK L L GF+D+  ID+DTI+VSNLNRQFLFR+ HVG +K++
Sbjct  1    VENAKVLMVGAGGIGCELLKTLVLHGFRDVTAIDLDTIDVSNLNRQFLFRRRHVGMAKSE  60

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VARE+VLKFRP  KI    ANVK+  F  ++FK F+VVLNGLDNL+ARRHVNRLCLAA V
Sbjct  61   VARESVLKFRPEAKISALRANVKEARFDKEYFKGFDVVLNGLDNLEARRHVNRLCLAAEV  120

Query  594  PLVESGTTGFLGQVTVH  644
            PLVESGTTG+ GQVTVH
Sbjct  121  PLVESGTTGYKGQVTVH  137



>gb|KFY98743.1| hypothetical protein V498_01273 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=636

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL LSG+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLSGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQKFNPAVKLESYHANIKDAQFNIDWFKTFKIVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>ref|XP_001909380.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP70512.1| unnamed protein product [Podospora anserina S mat+]
Length=677

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++  K ++VLMVGAGGIGCELLKNL L+GF + HI+D+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTEAKKSRVLMVGAGGIGCELLKNLVLTGFGETHIVDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA EA  KF P +KI PYHAN+KDP F +++F  F +V N LDNL+ARRHVN++CLA
Sbjct  73   KALVATEAAQKFNPNVKIVPYHANIKDPQFNIEWFSSFRIVFNALDNLEARRHVNKMCLA  132

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  133  ADVPLIESGTTGFNGQVQV  151



>gb|KDO17056.1| hypothetical protein SPRG_17525, partial [Saprolegnia parasitica 
CBS 223.65]
Length=375

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I A+K+L+VGAGGIGCELLKNL LSGF DI I+D+DTI+VSNLNRQFLFR  HVG SKA 
Sbjct  16   IHASKILVVGAGGIGCELLKNLVLSGFVDITIVDLDTIDVSNLNRQFLFRSQHVGMSKAI  75

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VARE  L+F P  KI  +H N+K   + +++F++F +VLN LDN+DAR+HVNRLCLAA V
Sbjct  76   VAREVALQFNPSAKITAHHENIKSSRYAIEYFEQFALVLNALDNVDARKHVNRLCLAANV  135

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTG+LGQV+V
Sbjct  136  PLIESGTTGYLGQVSV  151



>ref|XP_009844967.1| hypothetical protein H257_17773 [Aphanomyces astaci]
 gb|ETV65479.1| hypothetical protein H257_17773 [Aphanomyces astaci]
Length=572

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  AIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKA  410
             I+ AK+L+VGAGGIGCELLKNL LSGF+DI ++D+DTI+VSNLNRQFLFR  HVG SKA
Sbjct  15   TIQEAKILVVGAGGIGCELLKNLVLSGFEDITVVDLDTIDVSNLNRQFLFRSQHVGHSKA  74

Query  411  KVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAG  590
            +VA+   L+F P +KI  YH N+K   + +++FK+F+VV+N LDN+DAR+HVNR+CLAA 
Sbjct  75   EVAKAVALQFNPRVKITAYHENIKSSRYSIEYFKQFSVVMNALDNVDARKHVNRICLAAQ  134

Query  591  VPLVESGTTGFLGQVTV  641
            VPLVESGTTG+LGQV+V
Sbjct  135  VPLVESGTTGYLGQVSV  151



>emb|CBJ28586.1| conserved unknown protein [Ectocarpus siliculosus]
Length=293

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 119/150 (79%), Gaps = 2/150 (1%)
 Frame = +3

Query  198  SHLMAS--EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQ  371
            SHL AS   E    ++ AK+L+VGAGGIGCELLKNL  +GFQDI ++D+DTI+ SNLNRQ
Sbjct  5    SHLRASMGTELFDKVQKAKLLVVGAGGIGCELLKNLVQTGFQDIEVVDLDTIDKSNLNRQ  64

Query  372  FLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLD  551
            FLFR  HV +SK+ +AREAVLKF P  +I  +H NVK+  FG+ F ++F++VLN LDN+D
Sbjct  65   FLFRPHHVDKSKSLMAREAVLKFNPEARIVAHHGNVKEAKFGMAFIRKFDLVLNALDNID  124

Query  552  ARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            ARRHVNRLCLA   PL+ESGTTG+LGQVTV
Sbjct  125  ARRHVNRLCLAVEKPLIESGTTGYLGQVTV  154



>gb|KFY06738.1| hypothetical protein V492_07786 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=634

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQKFNPAVKLESYHANIKDAQFNIDWFKTFTIVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>ref|XP_007584112.1| putative ubiquitin-like activating enzyme protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD48423.1| putative ubiquitin-like activating enzyme protein [Neofusicoccum 
parvum UCRNP2]
Length=619

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKESRVLMVGAGGIGCELLKNLVLTGFGNIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+  KF P + IE +HAN+KDP F VD+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKESAGKFNPHVNIEAHHANIKDPEFNVDWFKSFRLVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  139  PLVESGTTGFNGQVQV  154



>gb|KFX85719.1| hypothetical protein V490_09456 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=635

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQKFNPTVKLESYHANIKDAQFNIDWFKTFTIVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>gb|KFZ11212.1| hypothetical protein V502_07664 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=635

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  17   SDVKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  76

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+E   +F P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA
Sbjct  77   ALVAKEVAQRFNPAVKLESYHANIKDAQFNIDWFKTFTIVFNALDNLDARRHVNKMCLAA  136

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  137  DVPLIESGTTGFNGQVQV  154



>gb|KFY45166.1| hypothetical protein V495_03087 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY60889.1| hypothetical protein V497_03283 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=635

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQKFNPTVKLESYHANIKDAQFNIDWFKTFTIVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>gb|KFY09724.1| hypothetical protein V491_08009 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=635

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQKFNPAVKLESYHANIKDAQFNIDWFKSFTMVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>ref|XP_008869322.1| hypothetical protein H310_06150 [Aphanomyces invadans]
 gb|ETW02717.1| hypothetical protein H310_06150 [Aphanomyces invadans]
Length=569

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I+ AK+L+VGAGGIGCELLKNL LSGF DI ++D+DTI+VSNLNRQFLFR  HVGQSKA+
Sbjct  16   IEEAKILVVGAGGIGCELLKNLVLSGFGDITVVDLDTIDVSNLNRQFLFRSHHVGQSKAE  75

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E  L+F P +KI  YH N+K   + +++FK+F++V+N LDN+DAR+HVNR+CLAA +
Sbjct  76   VAKEVALQFNPRVKITAYHENIKSSRYSIEYFKQFSLVMNALDNVDARKHVNRICLAAHI  135

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTG+LGQV+V
Sbjct  136  PLIESGTTGYLGQVSV  151



>gb|KFX98161.1| hypothetical protein O988_04493 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=635

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQKFNPTVKLESYHANIKDAQFNIDWFKTFTIVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>gb|KFY85661.1| hypothetical protein V500_08228 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=635

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  17   SDVKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  76

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+E   +F P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA
Sbjct  77   ALVAKEVAQRFNPAVKLESYHANIKDAQFNIDWFKTFTIVFNALDNLDARRHVNKMCLAA  136

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  137  DVPLIESGTTGFNGQVQV  154



>dbj|GAA84113.1| ubiquitin-like activating enzyme [Aspergillus kawachii IFO 4308]
Length=616

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  18   IKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKPKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF+PG K+E YHAN+KD  F VD+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  78   VAKEVAHKFQPGAKLEAYHANIKDDQFNVDWFATFDVVFNALDNLDARRHVNRMCLAANV  137

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  138  PLVESGTTGFNGQVQV  153



>gb|KID76746.1| Molybdenum cofactor biosynthesis, MoeB, partial [Metarhizium 
brunneum ARSEF 3297]
Length=736

 Score =   208 bits (529),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  156  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  335
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  336  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKE  515
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +F++
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFNVSWFRK  198

Query  516  FNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            F++V N LDNL+ARRHVN++CLAA VPL+ESGTTGF GQV V
Sbjct  199  FSIVFNALDNLEARRHVNKMCLAADVPLIESGTTGFNGQVQV  240



>gb|KFZ12488.1| hypothetical protein V501_04200 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=635

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   +F P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQRFNPAVKLESYHANIKDAQFNIDWFKTFTIVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>gb|EXU99576.1| ubiquitin activating enzyme (E1) subunit UBA2 family protein 
[Metarhizium robertsii]
Length=705

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  156  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  335
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  336  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKE  515
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +F++
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFTVSWFRK  198

Query  516  FNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            F++V N LDNL+ARRHVN++CLAA VPL+ESGTTGF GQV V
Sbjct  199  FSIVFNALDNLEARRHVNKMCLAADVPLIESGTTGFNGQVQV  240



>gb|KFY75005.1| hypothetical protein V499_05024 [Pseudogymnoascus pannorum VKM 
F-103]
Length=635

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   +F P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQRFNPAVKLESYHANIKDAQFNIDWFKTFTIVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>gb|KFX51509.1| Ubiquitin-activating enzyme E1-like [Talaromyces marneffei PM1]
Length=604

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRNSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KFRP  K+E YHAN+KD  F +D+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  87   VAKEVAQKFRPDSKLEAYHANIKDAQFNIDWFATFDVVFNALDNLDARRHVNRMCLAANV  146

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  147  PLVESGTTGFNGQVQV  162



>gb|KFY62206.1| hypothetical protein V496_04690 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=631

 Score =   206 bits (525),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCEL+KNL LSG+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELVKNLLLSGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +K+E YHAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQKFNPKVKLESYHANIKDAQFNIDWFKTFKIVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>gb|KID88908.1| Molybdenum cofactor biosynthesis, MoeB [Metarhizium guizhouense 
ARSEF 977]
Length=736

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  156  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  335
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  336  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKE  515
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +F++
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFTVSWFRK  198

Query  516  FNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            F++V N LDNL+ARRHVN++CLAA VPL+ESGTTGF GQV V
Sbjct  199  FSIVFNALDNLEARRHVNKMCLAADVPLIESGTTGFNGQVQV  240



>gb|KIE02655.1| Molybdenum cofactor biosynthesis, MoeB, partial [Metarhizium 
majus ARSEF 297]
Length=738

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  156  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  335
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  336  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKE  515
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +F++
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFTVSWFRK  198

Query  516  FNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            F++V N LDNL+ARRHVN++CLAA VPL+ESGTTGF GQV V
Sbjct  199  FSIVFNALDNLEARRHVNKMCLAADVPLIESGTTGFNGQVQV  240



>ref|XP_003709447.1| SUMO-activating enzyme subunit uba-2 [Magnaporthe oryzae 70-15]
 gb|EHA56835.1| SUMO-activating enzyme subunit uba-2 [Magnaporthe oryzae 70-15]
Length=684

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +3

Query  219  EQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVG  398
            E  + +K A+VLMVGAGGIGCELLKNLAL+GF +IH +D+DTI++SNLNRQFLFR  H+ 
Sbjct  61   ETNARVKQARVLMVGAGGIGCELLKNLALAGFGEIHAVDLDTIDLSNLNRQFLFRHEHIK  120

Query  399  QSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLC  578
            +SKAKVA+EA  KF P +KIE + AN+K P F V++F+ F VV N LDNLDARRHVNR+C
Sbjct  121  KSKAKVAKEAAQKFNPNVKIEAHEANIKSPQFNVEWFRSFAVVFNALDNLDARRHVNRMC  180

Query  579  LAAGVPLVESGTTGFLGQVTV  641
            LAA VPL++SGTTGF GQV V
Sbjct  181  LAADVPLIDSGTTGFNGQVQV  201



>gb|KFG79382.1| putative ubiquitin-activating enzyme UBA2 [Metarhizium anisopliae]
 gb|KID71909.1| Molybdenum cofactor biosynthesis, MoeB, partial [Metarhizium 
anisopliae ARSEF 549]
Length=736

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  156  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  335
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  336  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKE  515
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +F++
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFTVSWFRK  198

Query  516  FNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            F++V N LDNL+ARRHVN++CLAA VPL+ESGTTGF GQV V
Sbjct  199  FSIVFNALDNLEARRHVNKMCLAADVPLIESGTTGFNGQVQV  240



>ref|XP_007809976.1| putative ubiquitin-activating enzyme UBA2 [Metarhizium acridum 
CQMa 102]
 gb|EFY90390.1| putative ubiquitin-activating enzyme UBA2 [Metarhizium acridum 
CQMa 102]
Length=738

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  106  SSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVDLDTIDLSNLNRQFLFRQEHIKKSK  165

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+E   KF P +KI  +HAN+KD NF V +F++F++V N LDNL+ARRHVN++CLAA
Sbjct  166  ALVAKEVAEKFNPTVKIVAHHANIKDGNFTVSWFRQFSIVFNALDNLEARRHVNKMCLAA  225

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  226  DVPLIESGTTGFNGQVQV  243



>ref|XP_007818741.1| Ubiquitin-activating enzyme, E1, active site protein [Metarhizium 
robertsii ARSEF 23]
 gb|EFZ01323.1| Ubiquitin-activating enzyme, E1, active site protein [Metarhizium 
robertsii ARSEF 23]
Length=736

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  156  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  335
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  336  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKE  515
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +F++
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFTVSWFRK  198

Query  516  FNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            F++V N LDNL+ARRHVN++CLAA VPL+ESGTTGF GQV V
Sbjct  199  FSIVFNALDNLEARRHVNKMCLAADVPLIESGTTGFNGQVQV  240



>ref|XP_001268153.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
clavatus NRRL 1]
 gb|EAW06727.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
clavatus NRRL 1]
Length=616

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VL+VGAGGIGCELLK+L LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   IKESRVLLVGAGGIGCELLKDLLLSGFGEIHIIDLDTIDLSNLNRQFLFRYEHIKKSKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF+P  K+E YHAN+KD  F VD+F  F++V N LDNLDARRHVNR+CLAA V
Sbjct  78   VAKEVARKFQPSAKLEAYHANIKDSQFNVDWFATFDIVFNALDNLDARRHVNRMCLAANV  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>ref|XP_002145297.1| ubiquitin-like activating enzyme (UbaB), putative [Talaromyces 
marneffei ATCC 18224]
 gb|EEA28782.1| ubiquitin-like activating enzyme (UbaB), putative [Talaromyces 
marneffei ATCC 18224]
Length=622

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRNSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KFRP  K+E YHAN+KD  F +D+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  87   VAKEVAQKFRPDSKLEAYHANIKDAQFNIDWFATFDVVFNALDNLDARRHVNRMCLAANV  146

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  147  PLVESGTTGFNGQVQV  162



>gb|EQL34861.1| ubiquitin-like 1-activating enzyme E1 B [Blastomyces dermatitidis 
ATCC 26199]
Length=619

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++ IK ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTKIKKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA+E   KFR    +  YHAN+KDP F ++FF+ F++V N LDNLDARRHVNR+CLA
Sbjct  73   KALVAKEVASKFRRDASLHAYHANIKDPQFNIEFFESFDIVFNALDNLDARRHVNRMCLA  132

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  133  ANVPLIESGTTGFNGQVQV  151



>gb|KCW64020.1| hypothetical protein EUGRSUZ_G016992, partial [Eucalyptus grandis]
Length=521

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +3

Query  330  IDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  509
            IDMDTIEVSNLNRQFLFRQ HVGQSKAKVAREAVL+FRP I I PYHANVKDP+F VDFF
Sbjct  1    IDMDTIEVSNLNRQFLFRQKHVGQSKAKVAREAVLRFRPNISITPYHANVKDPDFNVDFF  60

Query  510  KEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTVH  644
            K+F+VVLNGLDNLDARRHVNRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  61   KQFSVVLNGLDNLDARRHVNRLCLAADVPLVESGTTGFLGQVTVH  105



>ref|XP_002621726.1| ubiquitin-like activating enzyme UbaB [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ73730.1| ubiquitin-like activating enzyme UbaB [Blastomyces dermatitidis 
SLH14081]
Length=619

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++ IK ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTKIKKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA+E   KFR    +  YHAN+KDP F ++FF+ F++V N LDNLDARRHVNR+CLA
Sbjct  73   KALVAKEVASKFRRDASLHAYHANIKDPQFNIEFFESFDIVFNALDNLDARRHVNRMCLA  132

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  133  ANVPLIESGTTGFNGQVQV  151



>gb|EGE81131.1| ubiquitin-activating enzyme [Blastomyces dermatitidis ATCC 18188]
Length=619

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++ IK ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTKIKKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA+E   KFR    +  YHAN+KDP F ++FF+ F++V N LDNLDARRHVNR+CLA
Sbjct  73   KALVAKEVASKFRRDASLHAYHANIKDPQFNIEFFESFDIVFNALDNLDARRHVNRMCLA  132

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  133  ANVPLIESGTTGFNGQVQV  151



>ref|XP_001820796.2| ubiquitin-activating enzyme E1-like protein [Aspergillus oryzae 
RIB40]
Length=614

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   LKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKSKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF+P  K+E YHAN+KD  F VD+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  78   VAKEVAQKFQPSAKLEAYHANIKDSRFNVDWFATFDVVFNALDNLDARRHVNRMCLAADV  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>dbj|GAM85103.1| hypothetical protein ANO11243_031060 [fungal sp. No.11243]
Length=609

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I+ A++L+VGAGGIGCELLKNL  +GF +IH++D+DTI++SNLNRQFLFR SH+ +SKA 
Sbjct  18   IRQARILVVGAGGIGCELLKNLVTTGFHEIHVVDLDTIDLSNLNRQFLFRHSHIKKSKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +KIE YHAN+KDP F + +FK F +V N LDNLDARRHVNR+C+AA V
Sbjct  78   VAKETAGKFNPEVKIEAYHANIKDPQFNIQWFKSFEIVFNALDNLDARRHVNRMCVAAEV  137

Query  594  PLVESGTTGFLGQV  635
            PL+ESGTTGF GQV
Sbjct  138  PLIESGTTGFNGQV  151



>ref|XP_007512390.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16990.1| predicted protein [Bathycoccus prasinos]
Length=631

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 118/136 (87%), Gaps = 4/136 (3%)
 Frame = +3

Query  249  VLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREA  428
            +LMVGAGGIGCEL+K LAL+GF++I IID+DTI++SNLNRQFLFR+ HVG SK++VA+E+
Sbjct  39   ILMVGAGGIGCELIKTLALTGFRNISIIDLDTIDISNLNRQFLFRKKHVGMSKSQVAKES  98

Query  429  VLKF----RPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVP  596
            V KF    + GI IE Y  N+K+  FG+DFFK+F++VLNGLDNL+ARRHVNRLCL+A VP
Sbjct  99   VEKFAGSKQTGINIEAYTGNIKEERFGLDFFKKFDIVLNGLDNLEARRHVNRLCLSANVP  158

Query  597  LVESGTTGFLGQVTVH  644
            LVESGTTG+ GQVTVH
Sbjct  159  LVESGTTGYKGQVTVH  174



>gb|KIN01521.1| hypothetical protein OIDMADRAFT_104066 [Oidiodendron maius Zn]
Length=645

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            + +K A++LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  17   TMVKEARILMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRQEHIKKSK  76

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA++A  KF P +K+E +HAN+KDP F V++F+ F +V N LDNLDARRHVN++CLAA
Sbjct  77   ALVAKDAAHKFNPRLKLEAHHANIKDPQFNVNWFRGFTMVFNALDNLDARRHVNKMCLAA  136

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  137  DVPLIESGTTGFNGQVQV  154



>gb|EEQ91823.1| ubiquitin-activating enzyme [Blastomyces dermatitidis ER-3]
Length=619

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++ IK ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTKIKKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA+E   KFR    +  YHAN+KDP F ++FF+ F++V N LDNLDARRHVNR+CLA
Sbjct  73   KALVAKEVASKFRRDASLHAYHANIKDPQFNIEFFESFDIVFNALDNLDARRHVNRMCLA  132

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  133  ANVPLIESGTTGFNGQVQV  151



>ref|XP_002376522.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
flavus NRRL3357]
 gb|EED53276.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
flavus NRRL3357]
Length=624

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   LKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKSKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF+P  K+E YHAN+KD  F VD+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  78   VAKEVAQKFQPSAKLEAYHANIKDSRFNVDWFATFDVVFNALDNLDARRHVNRMCLAADV  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>gb|EIT74958.1| SMT3/SUMO-activating complex, catalytic component UBA2 [Aspergillus 
oryzae 3.042]
 gb|KDE81437.1| SMT3/SUMO-activating complex, catalytic component UBA2 [Aspergillus 
oryzae 100-8]
Length=614

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   LKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKSKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF+P  K+E YHAN+KD  F VD+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  78   VAKEVAQKFQPSAKLEAYHANIKDSRFNVDWFATFDVVFNALDNLDARRHVNRMCLAADV  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>gb|ELQ38550.1| SUMO-activating enzyme subunit uba-2 [Magnaporthe oryzae Y34]
 gb|ELQ69255.1| SUMO-activating enzyme subunit uba-2 [Magnaporthe oryzae P131]
Length=728

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +3

Query  219  EQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVG  398
            E  + +K A+VLMVGAGGIGCELLKNLAL+GF +IH +D+DTI++SNLNRQFLFR  H+ 
Sbjct  61   ETNARVKQARVLMVGAGGIGCELLKNLALAGFGEIHAVDLDTIDLSNLNRQFLFRHEHIK  120

Query  399  QSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLC  578
            +SKAKVA+EA  KF P +KIE + AN+K P F V++F+ F VV N LDNLDARRHVNR+C
Sbjct  121  KSKAKVAKEAAQKFNPNVKIEAHEANIKSPQFNVEWFRSFAVVFNALDNLDARRHVNRMC  180

Query  579  LAAGVPLVESGTTGFLGQVTV  641
            LAA VPL++SGTTGF GQV V
Sbjct  181  LAADVPLIDSGTTGFNGQVQV  201



>gb|KFY38951.1| hypothetical protein V494_04157 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=634

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +K+E YHAN+KD  F +D+FK F +V N LDNL+ARRHVN++CLAA V
Sbjct  79   VAKEVAQKFNPAVKLESYHANIKDAQFNIDWFKTFTIVFNALDNLEARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>ref|XP_002487254.1| ubiquitin-like activating enzyme (UbaB), putative [Talaromyces 
stipitatus ATCC 10500]
 gb|EED13143.1| ubiquitin-like activating enzyme (UbaB), putative [Talaromyces 
stipitatus ATCC 10500]
Length=623

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRKSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KFRP  K+E YHAN+KD  F  D+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  87   VAKEVAHKFRPDSKLEAYHANIKDSQFNTDWFSTFDVVFNALDNLDARRHVNRMCLAANV  146

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  147  PLVESGTTGFNGQVQV  162



>emb|CEJ79950.1| hypothetical protein VHEMI00161 [Torrubiella hemipterigena]
Length=700

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +A+K A+VLMVGAGGIGCELLKNL LSGF DIHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  94   TAVKKARVLMVGAGGIGCELLKNLVLSGFGDIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  153

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA L F P + I  +HAN+KD  F V +F++F +V N LDNLDARRHVNR+CLAA
Sbjct  154  ALVAKEAALIFNPQVNITAHHANIKDSEFTVSWFRQFGIVFNALDNLDARRHVNRMCLAA  213

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  214  DVPLIESGTTGFNGQVQV  231



>ref|XP_011108689.1| hypothetical protein H072_2702 [Dactylellina haptotyla CBS 200.50]
 gb|EPS43290.1| hypothetical protein H072_2702 [Dactylellina haptotyla CBS 200.50]
Length=611

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK +K+LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLF++ H+ +SKA 
Sbjct  23   IKQSKILMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFQRQHIKKSKAL  82

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +K+  YHAN+K+P F V++FK F++V N LDNLDARRHVN++CLAA +
Sbjct  83   VAKETASKFNPNVKLTAYHANIKEPTFNVEWFKTFSLVFNALDNLDARRHVNKMCLAADI  142

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  143  PLVESGTTGFNGQVQV  158



>gb|EZG00032.1| ubiquitin-activating enzyme E1-like protein [Trichophyton rubrum 
MR1459]
 gb|EZG10989.1| ubiquitin-activating enzyme E1-like protein [Trichophyton rubrum 
CBS 735.88]
 gb|KFL63001.1| ubiquitin-activating enzyme E1-like [Trichophyton rubrum CBS 
118892]
Length=236

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +  ++VL+VGAGGIGCELLKNL LSGF  IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  24   VHESRVLLVGAGGIGCELLKNLLLSGFGTIHIIDLDTIDLSNLNRQFLFRHEHIKKPKAL  83

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KFRP   IE YHAN+K+  F VD+F  F++V N LDNLDARRHVNR+CLAA V
Sbjct  84   VAKEVAQKFRPQSIIEAYHANIKESRFNVDWFASFDLVFNALDNLDARRHVNRMCLAANV  143

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTG+ GQV V
Sbjct  144  PLIESGTTGYNGQVQV  159



>emb|CEJ79951.1| hypothetical protein VHEMI00161 [Torrubiella hemipterigena]
Length=718

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +A+K A+VLMVGAGGIGCELLKNL LSGF DIHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  94   TAVKKARVLMVGAGGIGCELLKNLVLSGFGDIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  153

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA L F P + I  +HAN+KD  F V +F++F +V N LDNLDARRHVNR+CLAA
Sbjct  154  ALVAKEAALIFNPQVNITAHHANIKDSEFTVSWFRQFGIVFNALDNLDARRHVNRMCLAA  213

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  214  DVPLIESGTTGFNGQVQV  231



>ref|XP_001211541.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU37325.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=582

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I+ ++VL+VGAGGIGCELLK+L LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   IRESRVLLVGAGGIGCELLKDLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKSKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF+PG K+E YHAN+KD  F VD+F +F+VV N LDNLDARRHVN++CLAA V
Sbjct  78   VAKEVAHKFQPGAKLEAYHANIKDSQFNVDWFSKFDVVFNALDNLDARRHVNKMCLAADV  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>gb|ELR05791.1| hypothetical protein GMDG_01869 [Pseudogymnoascus destructans 
20631-21]
Length=635

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   +F P +K+E YH N+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQRFNPAVKLESYHTNIKDAQFNIDWFKTFTIVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>ref|XP_004991968.1| hypothetical protein PTSG_06582 [Salpingoeca rosetta]
 gb|EGD75511.1| hypothetical protein PTSG_06582 [Salpingoeca rosetta]
Length=629

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK  K+L+VGAGGIGCELLKN+AL+GFQDIH+ID+DTIE++NLNRQFLF+Q HVGQSKAK
Sbjct  20   IKQCKLLVVGAGGIGCELLKNVALAGFQDIHVIDLDTIELTNLNRQFLFQQQHVGQSKAK  79

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VARE+VL+F P + I  +HAN+ +  F + FF++F++V+N LDNL AR HVNR+CLAA  
Sbjct  80   VARESVLRFNPSLSITAHHANIFEDKFSLGFFEQFDLVMNALDNLKARNHVNRMCLAANK  139

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESG+ G+LGQVTV
Sbjct  140  PLIESGSAGYLGQVTV  155



>gb|KFX51511.1| Ubiquitin-activating enzyme E1-like [Talaromyces marneffei PM1]
Length=701

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  124  IRNSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  183

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KFRP  K+E YHAN+KD  F +D+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  184  VAKEVAQKFRPDSKLEAYHANIKDAQFNIDWFATFDVVFNALDNLDARRHVNRMCLAANV  243

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  244  PLVESGTTGFNGQVQV  259



>ref|XP_002594236.1| hypothetical protein BRAFLDRAFT_65085 [Branchiostoma floridae]
 gb|EEN50247.1| hypothetical protein BRAFLDRAFT_65085 [Branchiostoma floridae]
Length=189

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            ++ +KVL+VGAGGIGCELLKNL L+ F+ I +ID+DTI+VSNLNRQFLF++ HVG+SKA+
Sbjct  16   VENSKVLVVGAGGIGCELLKNLVLTNFKYIEVIDLDTIDVSNLNRQFLFQKQHVGKSKAQ  75

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+ L+F P   I  YH ++ +P++GV+FFK+F +VLN LDN  AR HVNR+CLAA V
Sbjct  76   VAKESALRFNPDCNIIAYHDSITNPDYGVNFFKKFTLVLNALDNRAARNHVNRMCLAADV  135

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGT G+LGQVTV
Sbjct  136  PLVESGTAGYLGQVTV  151



>emb|CCU82288.1| NEDD8-activating enzyme E1 catalytic subunit/ubiquitin-like activating 
enzyme [Blumeria graminis f. sp. hordei DH14]
Length=634

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S+IKAA+VL+VGAGGIGCELLKNLAL+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  17   SSIKAARVLLVGAGGIGCELLKNLALAGFGEIHIVDLDTIDISNLNRQFLFRHEHIKKSK  76

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +K+E Y AN+ D  F +D+FK FNVV N LDNL ARRHVN++C+AA
Sbjct  77   ALVAKEAACQFNPNVKLEAYMANIHDSKFDIDWFKGFNVVFNALDNLQARRHVNKMCIAA  136

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGT GF GQV V
Sbjct  137  DVPLIESGTMGFNGQVQV  154



>ref|XP_001394085.1| ubiquitin-activating enzyme E1-like protein [Aspergillus niger 
CBS 513.88]
 emb|CAK40551.1| unnamed protein product [Aspergillus niger]
 gb|EHA19336.1| hypothetical protein ASPNIDRAFT_178271 [Aspergillus niger ATCC 
1015]
Length=615

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  18   IKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKPKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF+P  K+E YHAN+KD  F VD+F  F+VV N LDNLDARRHVNR+CLAA V
Sbjct  78   VAKEVAHKFQPSAKLEAYHANIKDDQFNVDWFATFDVVFNALDNLDARRHVNRMCLAANV  137

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  138  PLVESGTTGFNGQVQV  153



>gb|KCW64019.1| hypothetical protein EUGRSUZ_G016992, partial [Eucalyptus grandis]
Length=609

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +3

Query  330  IDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  509
            IDMDTIEVSNLNRQFLFRQ HVGQSKAKVAREAVL+FRP I I PYHANVKDP+F VDFF
Sbjct  1    IDMDTIEVSNLNRQFLFRQKHVGQSKAKVAREAVLRFRPNISITPYHANVKDPDFNVDFF  60

Query  510  KEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTVH  644
            K+F+VVLNGLDNLDARRHVNRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  61   KQFSVVLNGLDNLDARRHVNRLCLAADVPLVESGTTGFLGQVTVH  105



>gb|EHK15498.1| hypothetical protein TRIVIDRAFT_38683 [Trichoderma virens Gv29-8]
Length=672

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  66   SSVKHARVLMVGAGGIGCELLKNLVLNGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  125

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            + VA+EA  +F P +KI  +HAN+KDP F V +F++F +V N LDNLDARRHVN++CLAA
Sbjct  126  SLVAKEAAQRFNPNVKIVAHHANIKDPEFSVPWFRDFKIVFNALDNLDARRHVNKMCLAA  185

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  186  DVPLIESGTTGFNGQVQV  203



>emb|CEJ00366.1| hypothetical protein RMCBS344292_14423 [Rhizopus microsporus]
Length=589

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  395
            EE  + +  ++VL+VGAGGIGCELLKNL LSGF+DI +ID+DTI++SNLNRQFLF++ HV
Sbjct  14   EELYNKVSNSRVLLVGAGGIGCELLKNLVLSGFRDIEVIDLDTIDISNLNRQFLFQRQHV  73

Query  396  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRL  575
             ++KA VA+E+ LKF P +KI    AN+KDP F V +FK+F +VLN LDNLDARRHVN +
Sbjct  74   KKAKAHVAKESALKFNPSVKINSTQANIKDPQFNVQWFKQFTLVLNALDNLDARRHVNAM  133

Query  576  CLAAGVPLVESGTTGFLGQVTV  641
            CLAA +PLVESGT G+LGQ  V
Sbjct  134  CLAANIPLVESGTQGYLGQAYV  155



>dbj|GAM34770.1| SUMO E1-like activator [Talaromyces cellulolyticus]
Length=615

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRESRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA++   KFRP  K+E YHAN+KD  F VD+F  FNVV N LDNLDARRHVNR+CLAA V
Sbjct  87   VAKDVAQKFRPDSKLEAYHANIKDAQFNVDWFATFNVVFNALDNLDARRHVNRMCLAANV  146

Query  594  PLVESGTTGFLGQ  632
            PLVESGTTGF GQ
Sbjct  147  PLVESGTTGFNGQ  159



>ref|XP_009519056.1| hypothetical protein PHYSODRAFT_349758 [Phytophthora sojae]
 gb|EGZ23768.1| hypothetical protein PHYSODRAFT_349758 [Phytophthora sojae]
Length=626

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  395
            E+    +++AK+L+VGAGGIGCELLKNL LSGF DIH+ID+DTI+VSNLNRQFLFR  HV
Sbjct  11   EDLRGKVQSAKILVVGAGGIGCELLKNLVLSGFVDIHLIDLDTIDVSNLNRQFLFRSQHV  70

Query  396  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRL  575
            GQSKA VARE  ++F P  +I  +H N+K   F +D+F++F +VLN LDN+DAR+HVNRL
Sbjct  71   GQSKALVAREIAMEFNPKAQITAHHGNIKSSQFDIDYFQQFALVLNALDNVDARKHVNRL  130

Query  576  CLAAGVPLVESGTTGFLGQVTV  641
            CLA   PL+ESGTTG+LGQV+V
Sbjct  131  CLATNTPLIESGTTGYLGQVSV  152



>ref|XP_750939.1| ubiquitin-like activating enzyme (UbaB) [Aspergillus fumigatus 
Af293]
 gb|EAL88901.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
fumigatus Af293]
 gb|EDP49626.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
fumigatus A1163]
Length=644

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  18   IKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRYEHIKKPKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF+P  K+E YHAN+KD  F VD+F  F++V N LDNLDARRHVNR+CLAA V
Sbjct  78   VAKEVAHKFQPNAKLEAYHANIKDSQFNVDWFATFDLVFNALDNLDARRHVNRMCLAANV  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>gb|KFH63366.1| ubiquitin-like 1-activating enzyme E1 B [Mortierella verticillata 
NRRL 6337]
Length=632

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            +S I  AKVLMVGAGGIGCELLKNL +SGF++I IID+DTI++SNLNRQFLF++ H+ +S
Sbjct  17   VSTIADAKVLMVGAGGIGCELLKNLVMSGFKNIEIIDLDTIDLSNLNRQFLFQKQHIKKS  76

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KAKVARE+ L F P + I   H N+K+  F VD+FK F++V+N LDNLDARRHVN++CL+
Sbjct  77   KAKVARESALAFNPNVNIHARHQNIKEQEFSVDWFKGFDLVMNALDNLDARRHVNKMCLS  136

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGT G+LGQVTV
Sbjct  137  ANVPLIESGTAGYLGQVTV  155



>emb|CEJ03477.1| hypothetical protein RMCBS344292_17459 [Rhizopus microsporus]
Length=589

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  395
            EE  + +  ++VL+VGAGGIGCELLKNL LSGF+DI +ID+DTI++SNLNRQFLF++ HV
Sbjct  14   EELYNKVANSRVLLVGAGGIGCELLKNLVLSGFRDIEVIDLDTIDISNLNRQFLFQRQHV  73

Query  396  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRL  575
             ++KA VA+E+ LKF P +KI    AN+KDP F V +FK+F +VLN LDNLDARRHVN +
Sbjct  74   KKAKAHVAKESALKFNPSVKINSTQANIKDPQFNVQWFKQFTLVLNALDNLDARRHVNAM  133

Query  576  CLAAGVPLVESGTTGFLGQVTV  641
            CLAA +PLVESGT G+LGQ  V
Sbjct  134  CLAANIPLVESGTQGYLGQAYV  155



>emb|CEG80759.1| hypothetical protein RMATCC62417_15055 [Rhizopus microsporus]
Length=589

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  395
            EE  + +  ++VL+VGAGGIGCELLKNL LSGF+DI +ID+DTI++SNLNRQFLF++ HV
Sbjct  14   EELYNKVANSRVLLVGAGGIGCELLKNLVLSGFRDIEVIDLDTIDISNLNRQFLFQRQHV  73

Query  396  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRL  575
             ++KA VA+E+ LKF P +KI    AN+KDP F V +FK+F +VLN LDNLDARRHVN +
Sbjct  74   KKAKAHVAKESALKFNPSVKINSTQANIKDPQFNVQWFKQFTLVLNALDNLDARRHVNAM  133

Query  576  CLAAGVPLVESGTTGFLGQVTV  641
            CLAA +PLVESGT G+LGQ  V
Sbjct  134  CLAANIPLVESGTQGYLGQAYV  155



>ref|XP_660054.1| hypothetical protein AN2450.2 [Aspergillus nidulans FGSC A4]
 gb|EAA64156.1| hypothetical protein AN2450.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF86880.1| TPA: ubiquitin-like activating enzyme (UbaB), putative (AFU_orthologue; 
AFUA_6G10510) [Aspergillus nidulans FGSC A4]
Length=610

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  QMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQ  401
            Q + I+ ++VL+VGAGGIGCELLKNL L+GF +IH+ID+DTI++SNLNRQFLFR  H+ +
Sbjct  14   QANRIRESRVLLVGAGGIGCELLKNLLLTGFGEIHVIDLDTIDLSNLNRQFLFRHEHIKK  73

Query  402  SKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCL  581
             KA VA+E   KF+P  +IE YHAN+KD  F VD+F  FNVV N LDNLDARRHVN +CL
Sbjct  74   PKAIVAKEVAQKFQPSARIEAYHANIKDSKFDVDWFATFNVVFNALDNLDARRHVNMMCL  133

Query  582  AAGVPLVESGTTGFLGQVTV  641
            AA VPL+ESGTTGF GQV V
Sbjct  134  AADVPLIESGTTGFNGQVQV  153



>gb|EER43692.1| ubiquitin-activating enzyme [Histoplasma capsulatum H143]
Length=610

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++ I+ ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ + 
Sbjct  13   LTKIRKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKP  72

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA+E   KFR  + +  YHA++KDP F V+FF+ F++V N LDNLDARRHVNR+CLA
Sbjct  73   KALVAKEVARKFRRDVSLHAYHADIKDPQFNVEFFESFDIVFNALDNLDARRHVNRMCLA  132

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  133  ANVPLIESGTTGFNGQVQV  151



>gb|EGC50026.1| ubiquitin-activating enzyme [Histoplasma capsulatum H88]
Length=616

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++ I+ ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ + 
Sbjct  13   LTKIRKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKP  72

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA+E   KFR  + +  YHA++KDP F V+FF+ F++V N LDNLDARRHVNR+CLA
Sbjct  73   KALVAKEVARKFRRDVSLHAYHADIKDPQFNVEFFESFDIVFNALDNLDARRHVNRMCLA  132

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  133  ANVPLIESGTTGFNGQVQV  151



>ref|XP_002679801.1| ubiquitin-like 1 activating enzyme E1B [Naegleria gruberi]
 gb|EFC47057.1| ubiquitin-like 1 activating enzyme E1B [Naegleria gruberi]
Length=632

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  204  LMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFR  383
            L+  E  +  I+ +K+L+VGAGGIGCELLKNL LSGF++I IID+DTI++SNLNRQFLFR
Sbjct  14   LIYGEGLIEFIRTSKILVVGAGGIGCELLKNLVLSGFENIEIIDLDTIDISNLNRQFLFR  73

Query  384  QSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRH  563
            Q HVG+SK+K+A+E  L F P   I  +H N+K  ++G+DFFK+F +V+N LDN+DARRH
Sbjct  74   QKHVGESKSKIAKETALTFNPACNIIAHHGNIKHSDYGLDFFKQFKIVINALDNIDARRH  133

Query  564  VNRLCLAAGVPLVESGTTGFLGQVTVH  644
            VNRLCLAA VPL + GT G+LGQ  V+
Sbjct  134  VNRLCLAANVPLFDGGTAGYLGQAKVY  160



>ref|XP_003069148.1| ThiF family protein [Coccidioides posadasii C735 delta SOWgp]
 gb|EER27003.1| ThiF family protein [Coccidioides posadasii C735 delta SOWgp]
 gb|EFW21119.1| NEDD8-activating enzyme E1 catalytic subunit [Coccidioides posadasii 
str. Silveira]
Length=619

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S I+ ++VL+VGAGGIGCELLKNL L+GF ++HIID+DTI++SNLNRQFLFR  H+ + K
Sbjct  24   SNIRKSRVLLVGAGGIGCELLKNLLLTGFGEVHIIDLDTIDLSNLNRQFLFRHEHIKKPK  83

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+E   KFRP  K+E YHAN+KD  F V++F  F++V N LDNLDARRHVNR+CLAA
Sbjct  84   ALVAKEVASKFRPQAKLEAYHANIKDSRFNVEWFTSFDIVFNALDNLDARRHVNRMCLAA  143

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTG+ GQV V
Sbjct  144  DVPLIESGTTGYNGQVQV  161



>dbj|BAE58794.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=639

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 125/173 (72%), Gaps = 6/173 (3%)
 Frame = +3

Query  123  LSM*YTTWCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLA  302
            LS  +T   Y    ++ L   +  S+ L  S E  S     +VL+VGAGGIGCELLKNL 
Sbjct  12   LSCEWTNLLYNACLYTVLPPQI-PSNVLFPSREATS-----RVLLVGAGGIGCELLKNLL  65

Query  303  LSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVK  482
            LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA VA+E   KF+P  K+E YHAN+K
Sbjct  66   LSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKSKALVAKEVAQKFQPSAKLEAYHANIK  125

Query  483  DPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            D  F VD+F  F+VV N LDNLDARRHVNR+CLAA VPL+ESGTTGF GQV V
Sbjct  126  DSRFNVDWFATFDVVFNALDNLDARRHVNRMCLAADVPLIESGTTGFNGQVQV  178



>ref|XP_001240084.1| hypothetical protein CIMG_09705 [Coccidioides immitis RS]
 gb|EAS28501.3| ubiquitin-activating enzyme E1-like protein [Coccidioides immitis 
RS]
Length=619

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S I+ ++VL+VGAGGIGCELLKNL L+GF ++HIID+DTI++SNLNRQFLFR  H+ + K
Sbjct  24   SNIRKSRVLLVGAGGIGCELLKNLLLTGFGEVHIIDLDTIDLSNLNRQFLFRHEHIKKPK  83

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+E   KFRP  K+E YHAN+KD  F V++F  F++V N LDNLDARRHVNR+CLAA
Sbjct  84   ALVAKEVASKFRPQAKLEAYHANIKDSRFNVEWFTSFDIVFNALDNLDARRHVNRMCLAA  143

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTG+ GQV V
Sbjct  144  DVPLIESGTTGYNGQVQV  161



>ref|XP_009050922.1| hypothetical protein LOTGIDRAFT_178117 [Lottia gigantea]
 gb|ESO98215.1| hypothetical protein LOTGIDRAFT_178117 [Lottia gigantea]
Length=587

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +   KVL+VGAGGIGCELLKNL L+GF DI +ID+DTI+VSNLNRQFLFR+ HVG+SK++
Sbjct  13   VSNCKVLVVGAGGIGCELLKNLVLTGFSDIQVIDLDTIDVSNLNRQFLFRKEHVGKSKSQ  72

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+ LKF P + I  YH +V +P++G DFFK+F +V+N LDN  AR HVNR+CLAA V
Sbjct  73   VAKESALKFNPNVNIVAYHDSVMNPDYGADFFKQFKLVMNALDNRAARNHVNRMCLAADV  132

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGT G+LGQVTV
Sbjct  133  PLVESGTAGYLGQVTV  148



>emb|CEF97583.1| Molybdenum cofactor biosynthesis, MoeB [Ostreococcus tauri]
Length=582

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +  A+VL VGAGGIGCELLK LAL GF++I  +D+DTI+VSNLNRQFLFR+ HVG SKA+
Sbjct  8    VARARVLAVGAGGIGCELLKTLALHGFENITTMDLDTIDVSNLNRQFLFRKRHVGMSKAE  67

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VARE+V+KF+P   I+   ANVK+  F  ++FK F+VVLNGLDNL+ARRHVNRLCLAA V
Sbjct  68   VARESVMKFQPRATIDATRANVKEARFDKEYFKSFDVVLNGLDNLEARRHVNRLCLAAEV  127

Query  594  PLVESGTTGFLGQVTVH  644
            PLVESGTTG+ GQVTVH
Sbjct  128  PLVESGTTGYKGQVTVH  144



>gb|KFA63748.1| hypothetical protein S40285_01953 [Stachybotrys chlorohalonata 
IBT 40285]
Length=671

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S++K A+VLMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  66   SSVKQARVLMVGAGGIGCELLKNLVLAGFGEIHVVDLDTIDLSNLNRQFLFRHEHIKKSK  125

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA++A  +F P +KI  +HAN+KD  F V +F+EFN+V N LDNL+ARRHVN++CLAA
Sbjct  126  ALVAKDAAQRFNPNVKIVSHHANIKDTEFNVPWFREFNIVFNALDNLEARRHVNKMCLAA  185

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  186  DVPLIESGTTGFNGQVQV  203



>ref|XP_004359730.1| sumo-activating enzyme subunit 2 [Dictyostelium fasciculatum]
 gb|EGG21879.1| sumo-activating enzyme subunit 2 [Dictyostelium fasciculatum]
Length=639

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            ++ AKVL+VGAGGIGCELLKNL LSGF+DIHIID+DTI++SNLNRQFLFR+ H+G SKAK
Sbjct  38   VQKAKVLVVGAGGIGCELLKNLVLSGFKDIHIIDLDTIDLSNLNRQFLFRKHHIGMSKAK  97

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            +AREAVLK+ P + IE +  ++K+  +G  +F+ F++V+N LDNL AR+HVNR+CL+ GV
Sbjct  98   IAREAVLKYNPDVNIEAHEGDIKNQQYGHQYFQRFDLVMNALDNLSARKHVNRMCLSVGV  157

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGT G+LGQ TV
Sbjct  158  PLVESGTAGYLGQATV  173



>emb|CCE26846.1| related to ubiquitin-activating enzyme homolog UBA2 [Claviceps 
purpurea 20.1]
Length=712

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            SA+K A+VLMVGAGGIGCELLKNL L+GF ++HI+D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  109  SAVKQARVLMVGAGGIGCELLKNLVLTGFGEVHIVDLDTIDLSNLNRQFLFRQEHIKKSK  168

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  KF P +KI  +HAN+KD  F V +FK+F++V N LDNLDARRHVN++CLAA
Sbjct  169  ALVAKEAASKFNPHVKIVAHHANIKDDEFTVSWFKQFSIVFNALDNLDARRHVNKMCLAA  228

Query  588  GVPLVESGTTGFLGQVTV  641
             V L+ESGTTGF GQV V
Sbjct  229  DVSLIESGTTGFNGQVQV  246



>gb|KEZ46093.1| hypothetical protein SAPIO_CDS0942 [Scedosporium apiospermum]
Length=627

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +3

Query  243  AKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR  422
            +K+LMVGAGGIGCELLKNL LSGF+D+HI+D+DTI++SNLNRQFLFR  H+ +SK+ VA+
Sbjct  24   SKILMVGAGGIGCELLKNLVLSGFRDVHIVDLDTIDLSNLNRQFLFRHEHIKKSKSLVAK  83

Query  423  EAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLV  602
            E   KF P  +I  YHAN+KD  FGV++F+ FN+V N LDNLDARRHVN++CLAA VPL+
Sbjct  84   EVAQKFNPDAQIIAYHANIKDSQFGVEWFRGFNLVFNALDNLDARRHVNKMCLAADVPLI  143

Query  603  ESGTTGFLGQVTV  641
            ESGTTGF GQV V
Sbjct  144  ESGTTGFNGQVQV  156



>gb|EFA83622.1| sumo-activating enzyme subunit 2 [Polysphondylium pallidum PN500]
Length=627

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 120/144 (83%), Gaps = 3/144 (2%)
 Frame = +3

Query  219  EQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVG  398
            +    I++AKVL+VGAGGIGCELLKNL LSGF+DIHIID+DTI++SNLNRQFLFR+ H+G
Sbjct  16   DTFEKIRSAKVLVVGAGGIGCELLKNLVLSGFRDIHIIDLDTIDLSNLNRQFLFRKHHIG  75

Query  399  QSKAKVAREAVLKF---RPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVN  569
             SKAK+ARE+VLK+      IKI  +HA++K   FG ++FK+FN+V+N LDNL ARRHVN
Sbjct  76   MSKAKIARESVLKYCNNSDDIKIVAHHADIKTHEFGPNYFKQFNLVMNALDNLSARRHVN  135

Query  570  RLCLAAGVPLVESGTTGFLGQVTV  641
            R+CL+  +PL+ESGT GFLGQV+V
Sbjct  136  RICLSVDIPLIESGTAGFLGQVSV  159



>ref|XP_010315319.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Solanum 
lycopersicum]
Length=607

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKE  515
            MDTIEVSNLNRQFLFRQ HVGQSKAKVAR+AVL+FRP IKI PYHANVKDP F VDFFK+
Sbjct  1    MDTIEVSNLNRQFLFRQKHVGQSKAKVARDAVLRFRPHIKITPYHANVKDPEFNVDFFKQ  60

Query  516  FNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTVH  644
            FNVVLNGLDNLDARRHVNRLCLA+GVPLVESGTTGFLGQVTVH
Sbjct  61   FNVVLNGLDNLDARRHVNRLCLASGVPLVESGTTGFLGQVTVH  103



>gb|KDO27496.1| hypothetical protein SPRG_07085 [Saprolegnia parasitica CBS 223.65]
Length=585

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 120/151 (79%), Gaps = 2/151 (1%)
 Frame = +3

Query  189  FISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNR  368
            F+S+ L   ++    I A+K+L+VGAGGIGCELLKNL LSGF DI I+D+DTI+VSNLNR
Sbjct  3    FLSAAL--GDDLTRQIHASKILVVGAGGIGCELLKNLVLSGFVDITIVDLDTIDVSNLNR  60

Query  369  QFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNL  548
            QFLFR  HVG SKA VARE  L+F P  KI  +H N+K   + +++F++F +VLN LDN+
Sbjct  61   QFLFRSQHVGMSKAIVAREVALQFNPSAKITAHHENIKSSRYAIEYFEQFALVLNALDNV  120

Query  549  DARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            DAR+HVNRLCLAA VPL+ESGTTG+LGQV+V
Sbjct  121  DARKHVNRLCLAANVPLIESGTTGYLGQVSV  151



>ref|XP_001258177.1| ubiquitin-like activating enzyme (UbaB), putative [Neosartorya 
fischeri NRRL 181]
 gb|EAW16280.1| ubiquitin-like activating enzyme (UbaB), putative [Neosartorya 
fischeri NRRL 181]
Length=612

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VL+VGAGGIGCEL KNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  18   IKESRVLLVGAGGIGCELFKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRYEHIKKPKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF+P  K+E YHAN+KD  F VD+F  F++V N LDNLDARRHVNR+CLAA V
Sbjct  78   VAKEVAHKFQPSAKLEAYHANIKDSQFNVDWFATFDLVFNALDNLDARRHVNRMCLAANV  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>gb|KJB47535.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=621

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 109/146 (75%), Gaps = 30/146 (21%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MASEEQ+SAIK                              IDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQISAIK------------------------------IDMDTIEVSNLNRQFLFRQ  30

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDF+KEF+VVLNGLDNLDARRHV
Sbjct  31   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFYKEFDVVLNGLDNLDARRHV  90

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  91   NRLCLAADVPLVESGTTGFLGQVTVH  116



>ref|XP_002306122.2| hypothetical protein POPTR_0004s166302g, partial [Populus trichocarpa]
 gb|EEE86633.2| hypothetical protein POPTR_0004s166302g, partial [Populus trichocarpa]
Length=589

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +3

Query  330  IDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  509
            IDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR+AVL+FRP I I PYHAN KD NF VDFF
Sbjct  1    IDMDTIEVSNLNRQFLFRQSHVGQSKAKVARDAVLRFRPHINITPYHANAKDSNFNVDFF  60

Query  510  KEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTVH  644
            K+FNVVLNGLDNLDARRHVNRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  61   KQFNVVLNGLDNLDARRHVNRLCLAAEVPLVESGTTGFLGQVTVH  105



>ref|XP_008712970.1| hypothetical protein HMPREF1541_10077 [Cyphellophora europaea 
CBS 101466]
 gb|ETN45200.1| hypothetical protein HMPREF1541_10077 [Cyphellophora europaea 
CBS 101466]
Length=637

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +3

Query  243  AKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR  422
            +KVL+VGAGGIGCELLKNL L+GF ++HIID+DTI++SNLNRQFLFR  H+ +SKA VA+
Sbjct  21   SKVLLVGAGGIGCELLKNLVLTGFGEVHIIDLDTIDLSNLNRQFLFRHEHIKKSKALVAK  80

Query  423  EAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLV  602
            EA  KF P IK+E YHAN+KD  F + +F +F VV N LDNL+ARRHVN++CLAA VPL+
Sbjct  81   EAAQKFNPNIKLEAYHANIKDSQFNIAWFSQFTVVFNALDNLEARRHVNKMCLAADVPLI  140

Query  603  ESGTTGFLGQVTV  641
            ESGTTGF GQV V
Sbjct  141  ESGTTGFNGQVQV  153



>gb|EPQ63820.1| hypothetical protein BGT96224_4887 [Blumeria graminis f. sp. 
tritici 96224]
Length=634

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IKAA+VL+VGAGGIGCELLKNLAL+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKAARVLLVGAGGIGCELLKNLALAGFGEIHIVDLDTIDISNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+EA  +F P +K+E Y AN+ D  F +D+FK FN+V N LDNL ARRHVN++C+AA V
Sbjct  79   VAKEAACQFNPNVKLEAYMANIHDSKFDIDWFKGFNIVFNALDNLQARRHVNKMCIAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGT GF GQV V
Sbjct  139  PLIESGTMGFNGQVQV  154



>ref|XP_002793028.1| ubiquitin-activating enzyme [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH34115.1| ubiquitin-activating enzyme [Paracoccidioides sp. 'lutzii' Pb01]
Length=624

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            + I+ ++V +VGAGGIGCELLKNL L+ F +IHIID+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  14   TKIRKSRVFLVGAGGIGCELLKNLVLTSFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKSK  73

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A +A+E   KFRP + +  YHAN+KD  F V FF+ F++V N LDNLDARRHVNR+CLAA
Sbjct  74   ALIAKEVASKFRPDVSLHAYHANIKDSQFNVSFFETFDIVFNALDNLDARRHVNRMCLAA  133

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  134  NVPLIESGTTGFNGQVQV  151



>ref|XP_006690724.1| ubiquitin-activating enzyme-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS23482.1| ubiquitin-activating enzyme-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=662

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K +KVL+VGAGGIGCELLKNL L+GF ++H++D+DTI++SNLNRQFLFRQ H+ +SKA 
Sbjct  38   VKQSKVLLVGAGGIGCELLKNLVLTGFGEVHVVDLDTIDLSNLNRQFLFRQEHIKKSKAL  97

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +KI  +HAN+KD  FG+D+F  F +V N LDNLDARRHVN++CLAA V
Sbjct  98   VAKEVADKFNPAVKIVAHHANIKDAQFGIDWFASFTLVFNALDNLDARRHVNKMCLAADV  157

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  158  PLIESGTTGFNGQVQV  173



>ref|XP_003657600.1| hypothetical protein THITE_2171547 [Thielavia terrestris NRRL 
8126]
 gb|AEO71264.1| hypothetical protein THITE_2171547 [Thielavia terrestris NRRL 
8126]
Length=659

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K ++VLMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFRQ H+ +SKA 
Sbjct  45   VKQSRVLMVGAGGIGCELLKNLVLTGFGEIHVVDLDTIDLSNLNRQFLFRQEHIKKSKAL  104

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +KI  YHAN+KDP F +++F  F +V N LDNL+ARRHVN++CLAA V
Sbjct  105  VAKEVAQKFNPAVKIVAYHANIKDPRFSIEWFGGFRLVFNALDNLEARRHVNKMCLAADV  164

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  165  PLIESGTTGFNGQVQV  180



>gb|EEH05567.1| ubiquitin-activating enzyme [Histoplasma capsulatum G186AR]
Length=616

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++ I+ ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ + 
Sbjct  13   LTKIRKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKP  72

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA+E   KFR  + +  YHA++KDP F V+FF+ F++V N LDNLDARRHVNR+CL 
Sbjct  73   KALVAKEVARKFRRDVSLHAYHADIKDPQFNVEFFESFDIVFNALDNLDARRHVNRMCLT  132

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  133  ADVPLIESGTTGFNGQVQV  151



>ref|XP_001797609.1| hypothetical protein SNOG_07265 [Phaeosphaeria nodorum SN15]
 gb|EAT85916.2| hypothetical protein SNOG_07265 [Phaeosphaeria nodorum SN15]
Length=583

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +3

Query  255  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  434
            MVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA VA+++ L
Sbjct  1    MVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRNEHIKKSKALVAKDSAL  60

Query  435  KFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGT  614
            KF P +KIE YH N+KD  F V +FK FN+V N LDNLDARRHVN++CLAA VPL+ESGT
Sbjct  61   KFNPNVKIEAYHDNIKDSQFNVAWFKTFNIVFNALDNLDARRHVNKMCLAANVPLIESGT  120

Query  615  TGFLGQVTV  641
            TGF GQV V
Sbjct  121  TGFNGQVQV  129



>gb|KFY23096.1| hypothetical protein V493_06095 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=635

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF P +K+  +HAN+KD  F +D+FK F +V N LDNLDARRHVN++CLAA V
Sbjct  79   VAKEVAQKFNPAVKLVSHHANIKDAQFNIDWFKTFTIVFNALDNLDARRHVNKMCLAADV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>gb|EMR88301.1| putative family protein [Botrytis cinerea BcDW1]
Length=661

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   VKEARILMVGAGGIGCELLKNLVLAGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA++A  KF P +K+E +HAN+KD  F VD+FK F +V N LDNL+ARRHVN++CLAA +
Sbjct  78   VAKDAAHKFNPKVKLEAHHANIKDSQFNVDWFKGFTMVFNALDNLEARRHVNKMCLAADI  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>emb|CCI48953.1| unnamed protein product [Albugo candida]
Length=579

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = +3

Query  192  ISSHLMAS--EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLN  365
            +++HL  +  EE  + I+ AK+L+VGAGGIGCELLKNL  SGF ++HIID+DTI+VSNLN
Sbjct  1    MTAHLKQALGEETYNTIQNAKILVVGAGGIGCELLKNLVHSGFVNLHIIDLDTIDVSNLN  60

Query  366  RQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDN  545
            RQFLFR  HV +SKA +A+E V  F P  KI+ ++ N+K   FG+ FFKEF++V N LDN
Sbjct  61   RQFLFRSKHVTKSKAMIAKEVVNSFNPNAKIQAHYKNIKSSEFGISFFKEFSLVFNALDN  120

Query  546  LDARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            +DAR+HVNRLCL+  VPL+ESGTTG+LGQV+V
Sbjct  121  IDARKHVNRLCLSTNVPLIESGTTGYLGQVSV  152



>ref|XP_001555288.1| hypothetical protein BC1G_05993 [Botrytis cinerea B05.10]
Length=661

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   VKEARILMVGAGGIGCELLKNLVLAGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA++A  KF P +K+E +HAN+KD  F VD+FK F +V N LDNL+ARRHVN++CLAA +
Sbjct  78   VAKDAAHKFNPKVKLEAHHANIKDSQFNVDWFKGFTMVFNALDNLEARRHVNKMCLAADI  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>ref|XP_008892081.1| hypothetical protein PPTG_02637 [Phytophthora parasitica INRA-310]
 gb|ETN22861.1| hypothetical protein PPTG_02637 [Phytophthora parasitica INRA-310]
Length=624

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  395
            E+  S ++ AK+L+VGAGGIGCELLKNL LSGF+DI +ID+DTI+VSNLNRQFLFR  HV
Sbjct  11   EDLRSKVQNAKILVVGAGGIGCELLKNLVLSGFEDIELIDLDTIDVSNLNRQFLFRSHHV  70

Query  396  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRL  575
            G+SKA VA+E    F P  KI+ +H N+K   FG+++F++F++VLN LDN+DAR+HVNRL
Sbjct  71   GKSKALVAKEIATTFNPRAKIKAHHGNIKSSQFGLEYFQQFSLVLNALDNVDARKHVNRL  130

Query  576  CLAAGVPLVESGTTGFLGQVTV  641
            CLA  +PL+ESGTTG+LGQV V
Sbjct  131  CLATNIPLIESGTTGYLGQVFV  152



>emb|CAF89656.1| unnamed protein product [Tetraodon nigroviridis]
Length=213

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  395
            +E + ++   KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELVDSLATCKVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  396  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRL  575
            G SKA+VA+E+ L+F P   I  YH +V +P++ V+FF++F +V+N LDN  AR HVNR+
Sbjct  70   GLSKAQVAKESALQFCPAANITAYHDSVMNPDYNVEFFRKFVLVMNALDNRAARNHVNRM  129

Query  576  CLAAGVPLVESGTTGFLGQVTV  641
            CLAA +PL+ESGT G+LGQVTV
Sbjct  130  CLAADIPLIESGTAGYLGQVTV  151



>gb|EEH22393.2| hypothetical protein PABG_04604 [Paracoccidioides brasiliensis 
Pb03]
Length=626

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            + I+ ++V +VGAGGIGCELLKNL L+ F +IHIID+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  14   TKIRKSRVFLVGAGGIGCELLKNLVLTSFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKSK  73

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A +A+E   KFRP I +  YHAN+KD  F V FF+ F++V N LDNL+ARRHVNR+CLAA
Sbjct  74   ALIAKEVASKFRPDISLHAYHANIKDSQFNVSFFESFDIVFNALDNLEARRHVNRMCLAA  133

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  134  NVPLIESGTTGFNGQVQV  151



>gb|ETP47472.1| hypothetical protein F442_06579 [Phytophthora parasitica P10297]
Length=627

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  395
            E+  S ++ AK+L+VGAGGIGCELLKNL LSGF+DI +ID+DTI+VSNLNRQFLFR  HV
Sbjct  14   EDLRSKVQNAKILVVGAGGIGCELLKNLVLSGFEDIELIDLDTIDVSNLNRQFLFRSHHV  73

Query  396  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRL  575
            G+SKA VA+E    F P  KI+ +H N+K   FG+++F++F++VLN LDN+DAR+HVNRL
Sbjct  74   GKSKALVAKEIATTFNPRAKIKAHHGNIKSSQFGLEYFQQFSLVLNALDNVDARKHVNRL  133

Query  576  CLAAGVPLVESGTTGFLGQVTV  641
            CLA  +PL+ESGTTG+LGQV V
Sbjct  134  CLATNIPLIESGTTGYLGQVFV  155



>gb|EHK40736.1| hypothetical protein TRIATDRAFT_148461 [Trichoderma atroviride 
IMI 206040]
Length=673

 Score =   202 bits (513),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  65   SSVKHARVLMVGAGGIGCELLKNLVLNGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  124

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +K+  +HAN+KD  F V +F++F +V N LDNLDARRHVN++CLAA
Sbjct  125  ALVAKEAAQRFNPNVKLVAHHANIKDSEFSVPWFRDFKIVFNALDNLDARRHVNKMCLAA  184

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  185  DVPLIESGTTGFNGQVQV  202



>gb|ETI49760.1| hypothetical protein F443_06536 [Phytophthora parasitica P1569]
 gb|ETK89645.1| hypothetical protein L915_06403 [Phytophthora parasitica]
 gb|ETL43047.1| hypothetical protein L916_06349 [Phytophthora parasitica]
 gb|ETL96222.1| hypothetical protein L917_06215 [Phytophthora parasitica]
 gb|ETM49391.1| hypothetical protein L914_06330 [Phytophthora parasitica]
 gb|ETO78472.1| hypothetical protein F444_06600 [Phytophthora parasitica P1976]
 gb|ETP19532.1| hypothetical protein F441_06540 [Phytophthora parasitica CJ01A1]
Length=624

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  395
            E+  S ++ AK+L+VGAGGIGCELLKNL LSGF+DI +ID+DTI+VSNLNRQFLFR  HV
Sbjct  11   EDLRSKVQNAKILVVGAGGIGCELLKNLVLSGFEDIELIDLDTIDVSNLNRQFLFRSHHV  70

Query  396  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRL  575
            G+SKA VA+E    F P  KI+ +H N+K   FG+++F++F++VLN LDN+DAR+HVNRL
Sbjct  71   GKSKALVAKEIATTFNPRAKIKAHHGNIKSSQFGLEYFQQFSLVLNALDNVDARKHVNRL  130

Query  576  CLAAGVPLVESGTTGFLGQVTV  641
            CLA  +PL+ESGTTG+LGQV V
Sbjct  131  CLATNIPLIESGTTGYLGQVFV  152



>ref|XP_007295294.1| ThiF family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD14684.1| ThiF family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=633

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            + +K AK+LMVGAGGIGCELLKNL LSGF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  21   TMVKEAKILMVGAGGIGCELLKNLVLSGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  80

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA++A  KF P +K+E + AN+KD  F VD+FK F +V N LDNLDARRHVN++CLAA
Sbjct  81   ALVAKDAAHKFNPSVKLEAHFANIKDAQFNVDWFKGFAMVFNALDNLDARRHVNKMCLAA  140

Query  588  GVPLVESGTTGFLGQVTV  641
             +PL+ESGTTGF GQ+ V
Sbjct  141  DIPLIESGTTGFNGQIQV  158



>ref|XP_002313776.1| hypothetical protein POPTR_0009s12300g [Populus trichocarpa]
 gb|EEE87731.1| hypothetical protein POPTR_0009s12300g [Populus trichocarpa]
Length=662

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 118/158 (75%), Gaps = 13/158 (8%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNR--QFLF  380
            MAS +   AIK AKVLMVGAGGIGCELLK LALSGFQDIHI+    +EV  L +  Q +F
Sbjct  1    MASLQHSQAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHILS-GALEVKGLAQWLQGVF  59

Query  381  RQSHVGQSKA----------KVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVL  530
                 G  K           +VAR+AVL+FRP I I PYHANVKD NF VDFFK+FNVVL
Sbjct  60   HVRDGGDDKECRYKIDMDTIEVARDAVLRFRPHISITPYHANVKDSNFNVDFFKQFNVVL  119

Query  531  NGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTVH  644
            NGLDNLDARRHVNRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  120  NGLDNLDARRHVNRLCLAAEVPLVESGTTGFLGQVTVH  157



>ref|XP_001596160.1| hypothetical protein SS1G_02376 [Sclerotinia sclerotiorum 1980]
 gb|EDN99522.1| hypothetical protein SS1G_02376 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=670

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  22   VKEARILMVGAGGIGCELLKNLVLAGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  81

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA++A  KF P +K+E +HAN+KD  F VD+FK F +V N LDNL+ARRHVN++CLAA +
Sbjct  82   VAKDAAHKFNPKVKLEAHHANIKDSQFNVDWFKGFTMVFNALDNLEARRHVNKMCLAADI  141

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  142  PLIESGTTGFNGQVQV  157



>gb|ERZ96130.1| hypothetical protein GLOINDRAFT_340840 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX75169.1| E1 ubiquitin-activating protein UBA2 [Rhizophagus irregularis 
DAOM 197198w]
Length=612

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I   +VLMVGAGGIGCELLKNLA+SGF+ I ++D+DTI++SNLNRQFLF++ H+ +SKA+
Sbjct  19   ISNCRVLMVGAGGIGCELLKNLAMSGFRQIELVDLDTIDLSNLNRQFLFQKQHIMKSKAE  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VARE+ LKF P I I  +HAN+K P F V++FK F++V+N LDNLDARRHVN +CL A V
Sbjct  79   VARESALKFNPNINIIAHHANIKSPRFNVEWFKSFDIVMNALDNLDARRHVNMMCLVANV  138

Query  594  PLVESGTTGFLGQVT  638
            PL+ESGT G+LGQVT
Sbjct  139  PLIESGTEGYLGQVT  153



>gb|EYE96412.1| ubiquitin-like activating enzyme [Aspergillus ruber CBS 135680]
Length=616

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  18   IKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKPKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KF+P  K+E YHAN+KD  F VD+F  F++V N LDNLDARR+VNR+CLAAGV
Sbjct  78   VAKEVAHKFQPRAKLEAYHANIKDSQFNVDWFGGFDLVFNALDNLDARRYVNRMCLAAGV  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>gb|KHG12220.1| SUMO-activating enzyme subunit 2 -like protein [Gossypium arboreum]
Length=620

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 109/146 (75%), Gaps = 28/146 (19%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            MAS+EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHI                   
Sbjct  1    MASQEQLSAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHI-------------------  41

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
                     VAR+AVL+FRP I I PYHANVK+  F VDFFKEF+VVLNGLDNLDARRHV
Sbjct  42   ---------VARDAVLRFRPNISITPYHANVKESRFNVDFFKEFDVVLNGLDNLDARRHV  92

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLAA +PLVESGTTGFLGQVTVH
Sbjct  93   NRLCLAADIPLVESGTTGFLGQVTVH  118



>gb|KEY64505.1| hypothetical protein S7711_07252 [Stachybotrys chartarum IBT 
7711]
Length=693

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S++K A+VLMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  70   SSVKQARVLMVGAGGIGCELLKNLVLAGFGEIHVVDLDTIDLSNLNRQFLFRHEHIKKSK  129

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA++A  +F P  KI  +HAN+KD  F V +F+EFN+V N LDNL+ARRHVN++CLAA
Sbjct  130  ALVAKDAAQRFNPNAKIVSHHANIKDTEFNVPWFREFNIVFNALDNLEARRHVNKMCLAA  189

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  190  DVPLIESGTTGFNGQVQV  207



>ref|XP_007793896.1| putative family protein [Eutypa lata UCREL1]
 gb|EMR67006.1| putative family protein [Eutypa lata UCREL1]
Length=615

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            +++ + A+VLMVGAGGIGCELLKNL L+G+ ++HI+D+DTI++SNLNRQFLFR  H+ +S
Sbjct  2    LTSARQARVLMVGAGGIGCELLKNLVLTGYHEVHIVDLDTIDLSNLNRQFLFRHEHIKKS  61

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA+EA  KF P ++I  +HAN+KD  F V++F+ F +VLN LDNL+ARRHVNR+CLA
Sbjct  62   KALVAKEAAQKFNPNVEIVAHHANIKDAQFNVEWFRGFKIVLNALDNLEARRHVNRMCLA  121

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  122  ADVPLIESGTTGFNGQVQV  140



>gb|KFA47747.1| hypothetical protein S40293_07149 [Stachybotrys chartarum IBT 
40293]
Length=692

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S++K A+VLMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  69   SSVKQARVLMVGAGGIGCELLKNLVLAGFGEIHVVDLDTIDLSNLNRQFLFRHEHIKKSK  128

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA++A  +F P  KI  +HAN+KD  F V +F+EFN+V N LDNL+ARRHVN++CLAA
Sbjct  129  ALVAKDAAQRFNPNAKIVSHHANIKDTEFNVPWFREFNIVFNALDNLEARRHVNKMCLAA  188

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  189  DVPLIESGTTGFNGQVQV  206



>ref|XP_008087072.1| Activating enzyme of the ubiquitin-like protein [Glarea lozoyensis 
ATCC 20868]
 gb|EPE25753.1| Activating enzyme of the ubiquitin-like protein [Glarea lozoyensis 
ATCC 20868]
Length=597

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A++LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFRQ H+ +SKA 
Sbjct  2    VKEARILMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRQEHIKKSKAL  61

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+EA   F P +K+E +HAN+KD  F V +FK F +V N LDNL+ARRHVN++CLAA V
Sbjct  62   VAKEAAHVFNPNVKLEAHHANIKDAQFNVAWFKGFTIVFNALDNLEARRHVNKMCLAADV  121

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  122  PLIESGTTGFNGQVQV  137



>ref|XP_010760227.1| hypothetical protein PADG_05005 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH48926.2| hypothetical protein PADG_05005 [Paracoccidioides brasiliensis 
Pb18]
Length=626

 Score =   201 bits (511),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            + I+ ++V +VGAGGIGCELLKNL L+ F +IHIID+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  14   TKIRKSRVFLVGAGGIGCELLKNLVLTSFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKSK  73

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A +A+E   KFRP I +  YHAN+KD  F V FF+ F++V N LDNL+ARRHVNR+CLAA
Sbjct  74   ALIAKEVASKFRPDISLHAYHANIKDSQFNVSFFESFDIVFNALDNLEARRHVNRMCLAA  133

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  134  NVPLIESGTTGFNGQVQV  151



>gb|KFA81890.1| hypothetical protein S40288_01743 [Stachybotrys chartarum IBT 
40288]
Length=692

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S++K A+VLMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  69   SSVKQARVLMVGAGGIGCELLKNLVLAGFGEIHVVDLDTIDLSNLNRQFLFRHEHIKKSK  128

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA++A  +F P  KI  +HAN+KD  F V +F+EFN+V N LDNL+ARRHVN++CLAA
Sbjct  129  ALVAKDAAQRFNPNAKIVSHHANIKDTEFNVPWFREFNIVFNALDNLEARRHVNKMCLAA  188

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  189  DVPLIESGTTGFNGQVQV  206



>ref|XP_008670523.1| PREDICTED: SUMO-activating enzyme subunit 2 [Zea mays]
Length=671

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +3

Query  330  IDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  509
            ID+DTIEVSNLNRQFLFRQSHVGQSKAKVAR+AVLKFRP I I PYHANVKD +F VDFF
Sbjct  76   IDLDTIEVSNLNRQFLFRQSHVGQSKAKVARDAVLKFRPNININPYHANVKDSHFNVDFF  135

Query  510  KEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTVH  644
            K+FNVVLNGLDNLDARRHVNRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  136  KQFNVVLNGLDNLDARRHVNRLCLAADVPLVESGTTGFLGQVTVH  180



>gb|AEE63129.1| unknown [Dendroctonus ponderosae]
Length=360

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I  +KVL+VGAGGIGCE+LKNLALSGF+DI IID+DTI+VSNLNRQFLFR+ HVG+ KA 
Sbjct  20   IPKSKVLLVGAGGIGCEVLKNLALSGFRDIEIIDLDTIDVSNLNRQFLFRKEHVGKPKAV  79

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VARE++L   P +KI+ YH ++   ++G++FFK FN+VLN LDN  AR HVNR+CLAA +
Sbjct  80   VARESILAHNPNVKIKAYHDSILSSDYGLNFFKRFNLVLNALDNRTARNHVNRMCLAADI  139

Query  594  PLVESGTTGFLGQV  635
            PL+ESGT+G+ GQV
Sbjct  140  PLIESGTSGYSGQV  153



>gb|KIW06569.1| hypothetical protein PV09_02998 [Verruconis gallopava]
Length=621

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +K A+VLMVGAGGIGCELLKNL L+GF ++H++D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   VKQARVLMVGAGGIGCELLKNLVLTGFGEVHVVDLDTIDLSNLNRQFLFRHEHIKKSKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+  +F P + IE YHAN+KD  F +D++K+F+VV N LDN DARRHVNR+C+AA V
Sbjct  78   VAKESAGRFNPAVTIEAYHANIKDAQFNIDWYKQFDVVFNALDNADARRHVNRMCIAADV  137

Query  594  PLVESGTTGFLGQV  635
            PLV+ GTTGFLG V
Sbjct  138  PLVDGGTTGFLGNV  151



>gb|EZF27677.1| hypothetical protein H100_00355 [Trichophyton rubrum MR850]
 gb|EZF46657.1| hypothetical protein H102_00354 [Trichophyton rubrum CBS 100081]
 gb|EZF57322.1| hypothetical protein H103_00353 [Trichophyton rubrum CBS 288.86]
 gb|EZF68009.1| hypothetical protein H104_00353 [Trichophyton rubrum CBS 289.86]
 gb|EZF78632.1| hypothetical protein H105_00349 [Trichophyton soudanense CBS 
452.61]
 gb|EZF89257.1| hypothetical protein H110_00357 [Trichophyton rubrum MR1448]
 gb|EZG21647.1| hypothetical protein H107_00391 [Trichophyton rubrum CBS 202.88]
 gb|KDB38459.1| hypothetical protein H112_00354 [Trichophyton rubrum D6]
Length=460

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +  ++VL+VGAGGIGCELLKNL LSGF  IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  24   VHESRVLLVGAGGIGCELLKNLLLSGFGTIHIIDLDTIDLSNLNRQFLFRHEHIKKPKAL  83

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KFRP   IE YHAN+K+  F VD+F  F++V N LDNLDARRHVNR+CLAA V
Sbjct  84   VAKEVAQKFRPQSIIEAYHANIKESRFNVDWFASFDLVFNALDNLDARRHVNRMCLAANV  143

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTG+ GQV V
Sbjct  144  PLIESGTTGYNGQVQV  159



>ref|XP_007702777.1| hypothetical protein COCSADRAFT_123063 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD61425.1| hypothetical protein COCSADRAFT_123063 [Bipolaris sorokiniana 
ND90Pr]
Length=626

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKESRVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRTEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+  KF P I I  YH N+KD  F V +FK F +V N LDN+DARRHVN++CLAAGV
Sbjct  79   VAKESASKFNPNIDIIAYHDNIKDTQFNVAWFKTFRLVFNALDNVDARRHVNKMCLAAGV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>gb|EMD91706.1| hypothetical protein COCHEDRAFT_1175946 [Bipolaris maydis C5]
 gb|ENI08536.1| hypothetical protein COCC4DRAFT_69206 [Bipolaris maydis ATCC 
48331]
Length=626

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKESRVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRTEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+  KF P + I  YH N+KD  F V +FK F +V N LDN+DARRHVN++CLAAGV
Sbjct  79   VAKESAAKFNPNVDIIAYHDNIKDTQFNVAWFKTFRLVFNALDNVDARRHVNKMCLAAGV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>gb|KHG16253.1| SUMO-activating enzyme subunit 2 -like protein [Gossypium arboreum]
Length=623

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 108/146 (74%), Gaps = 28/146 (19%)
 Frame = +3

Query  207  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  386
            M+SEEQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHI                   
Sbjct  1    MSSEEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHI-------------------  41

Query  387  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHV  566
                     VAR+AVL+FRP I I PYHANVK+  F VDF+KEF+VVLNGLDNLDARRHV
Sbjct  42   ---------VARDAVLRFRPNISITPYHANVKESRFNVDFYKEFDVVLNGLDNLDARRHV  92

Query  567  NRLCLAAGVPLVESGTTGFLGQVTVH  644
            NRLCLA  VPLVESGTTGFLGQVTVH
Sbjct  93   NRLCLAVDVPLVESGTTGFLGQVTVH  118



>gb|KDB18330.1| putative ubiquitin-activating enzyme UBA2 [Ustilaginoidea virens]
Length=727

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S++K A+VL+VGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  116  SSVKQARVLLVGAGGIGCELLKNLVLTGFAEIHVVDLDTIDLSNLNRQFLFRQEHIKKSK  175

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA++A  +F P + I  +HAN+KD NF V +FKEF++V N LDNL+ARRHVN++CLAA
Sbjct  176  ALVAKDAAERFNPNVNIVAHHANIKDENFIVAWFKEFSIVFNALDNLEARRHVNKMCLAA  235

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQ+ V
Sbjct  236  DVPLIESGTTGFNGQMQV  253



>ref|XP_002847388.1| ubiquitin-activating enzyme [Arthroderma otae CBS 113480]
 gb|EEQ30075.1| ubiquitin-activating enzyme [Arthroderma otae CBS 113480]
Length=619

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 114/153 (75%), Gaps = 6/153 (4%)
 Frame = +3

Query  183  SLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNL  362
            SL    H  A  +Q      ++VL+VGAGGIGCELLKNL LSGF  IHIID+DTI++SNL
Sbjct  19   SLLPKVHEYADPQQ------SRVLLVGAGGIGCELLKNLLLSGFGTIHIIDLDTIDLSNL  72

Query  363  NRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLD  542
            NRQFLFR  H+ + KA VA+E   KFRP   IE YHAN+K+  F VD+F  F++V N LD
Sbjct  73   NRQFLFRHEHIKKPKALVAKEVAQKFRPQSTIEAYHANIKESRFNVDWFSSFDLVFNALD  132

Query  543  NLDARRHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            NLDARRHVNR+CLAA VPLVESGTTG+ GQV V
Sbjct  133  NLDARRHVNRMCLAANVPLVESGTTGYNGQVQV  165



>ref|XP_003175970.1| SUMO-activating enzyme subunit uba-2 [Microsporum gypseum CBS 
118893]
 gb|EFQ97018.1| SUMO-activating enzyme subunit uba-2 [Microsporum gypseum CBS 
118893]
Length=618

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            +  ++VL+VGAGGIGCELLKNL LSGF  IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  24   VNESRVLLVGAGGIGCELLKNLLLSGFGTIHIIDLDTIDLSNLNRQFLFRHEHIKKPKAL  83

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E   KFRP   IE YHAN+K+  F VD+F  F++V N LDNLDARRHVNR+CLAA V
Sbjct  84   VAKEVAQKFRPQSTIEAYHANIKETRFNVDWFASFDLVFNALDNLDARRHVNRMCLAANV  143

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  144  PLIESGTTGFNGQVQV  159



>ref|XP_008613648.1| hypothetical protein SDRG_09489 [Saprolegnia diclina VS20]
 gb|EQC32962.1| hypothetical protein SDRG_09489 [Saprolegnia diclina VS20]
Length=587

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            I A+K+L+VGAGGIGCELLKNL LSGF DI I+D+DTI+VSNLNRQFLFR  HVG SKA 
Sbjct  16   IHASKILVVGAGGIGCELLKNLVLSGFVDITIVDLDTIDVSNLNRQFLFRSQHVGMSKAI  75

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VARE  L+F P   I  +H N+K   + +++F++F +VLN LDN+DAR+HVNRLCLAA V
Sbjct  76   VAREVALQFNPSATITAHHENIKTSRYSIEYFEQFALVLNALDNVDARKHVNRLCLAANV  135

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTG+LGQV+V
Sbjct  136  PLIESGTTGYLGQVSV  151



>gb|EPS32945.1| hypothetical protein PDE_07906 [Penicillium oxalicum 114-2]
Length=634

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VL+VGAGGIGCELLKNL L+GF ++HIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  18   IKESRVLLVGAGGIGCELLKNLVLTGFGEVHIIDLDTIDLSNLNRQFLFRHEHIKKPKAL  77

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA++    FRP +K+E YHAN+ D  F V +FK FN+V N LDNL ARRHVN +CLAAGV
Sbjct  78   VAKDVAHNFRPDVKLEAYHANIMDSQFSVGWFKSFNIVFNALDNLAARRHVNSMCLAAGV  137

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  138  PLIESGTTGFNGQVQV  153



>ref|XP_003666760.1| hypothetical protein MYCTH_2311735 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO61515.1| hypothetical protein MYCTH_2311735 [Myceliophthora thermophila 
ATCC 42464]
Length=624

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++  K ++VLMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFRQ H+ +S
Sbjct  9    LTQTKQSRVLMVGAGGIGCELLKNLVLTGFGEIHVVDLDTIDLSNLNRQFLFRQEHIKKS  68

Query  405  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLA  584
            KA VA+E   KF P +KI  +HAN+KD  F +D+F  F +V N LDNL+ARRHVN++CLA
Sbjct  69   KALVAKEVAEKFNPAVKIVAHHANIKDAQFSIDWFGSFRIVFNALDNLEARRHVNKMCLA  128

Query  585  AGVPLVESGTTGFLGQVTV  641
            A VPL+ESGTTGF GQV V
Sbjct  129  ADVPLIESGTTGFNGQVQV  147



>ref|XP_011431808.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Crassostrea 
gigas]
 gb|EKC24155.1| SUMO-activating enzyme subunit 2 [Crassostrea gigas]
Length=615

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  240  AAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVA  419
            + K+L+VGAGGIGCELLKNL L+GF DI +ID+DTI+VSNLNRQFLFR+ HVG+SKA+VA
Sbjct  18   SCKLLVVGAGGIGCELLKNLVLTGFHDIVVIDLDTIDVSNLNRQFLFRKEHVGKSKAQVA  77

Query  420  REAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGVPL  599
            +E+ L F P  KI  YH ++  P++GVDFFK+F +V+N LDN  AR HVNR+CLAA +PL
Sbjct  78   KESALNFNPNAKITAYHDSIMSPDYGVDFFKKFTMVMNALDNRAARNHVNRMCLAADIPL  137

Query  600  VESGTTGFLGQVTV  641
            +ESGT G+LGQVTV
Sbjct  138  IESGTAGYLGQVTV  151



>gb|EXK45780.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. melonis 26406]
Length=609

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>gb|EWZ48441.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum Fo47]
 gb|EWZ93507.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. lycopersici MN25]
Length=609

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>gb|EXL53770.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. radicis-lycopersici 26381]
Length=609

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>ref|XP_007708023.1| hypothetical protein COCCADRAFT_1533 [Bipolaris zeicola 26-R-13]
 gb|EUC37670.1| hypothetical protein COCCADRAFT_1533 [Bipolaris zeicola 26-R-13]
Length=626

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKESRVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRNEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+  KF P + I  YH N+KD  F V +FK F +V N LDN+DARRHVN++CLAAGV
Sbjct  79   VAKESAAKFNPNVDIIAYHNNIKDTQFNVVWFKTFRLVFNALDNVDARRHVNKMCLAAGV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>gb|EUN25064.1| hypothetical protein COCVIDRAFT_104517 [Bipolaris victoriae FI3]
Length=626

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK ++VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKESRVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRNEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+  KF P + I  YH N+KD  F V +FK F +V N LDN+DARRHVN++CLAAGV
Sbjct  79   VAKESAAKFNPNVDIIAYHNNIKDTQFNVVWFKTFRLVFNALDNVDARRHVNKMCLAAGV  138

Query  594  PLVESGTTGFLGQVTV  641
            PL+ESGTTGF GQV V
Sbjct  139  PLIESGTTGFNGQVQV  154



>ref|XP_008030482.1| hypothetical protein SETTUDRAFT_165650 [Setosphaeria turcica 
Et28A]
 gb|EOA82209.1| hypothetical protein SETTUDRAFT_165650 [Setosphaeria turcica 
Et28A]
Length=627

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  234  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  413
            IK +++LMVGAGGIGCELLKNLAL+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKESRILMVGAGGIGCELLKNLALTGFGEIHIVDLDTIDLSNLNRQFLFRNEHIKKSKAL  78

Query  414  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAAGV  593
            VA+E+  KF P ++I  YH N+K+  F V +F+ F +V N LDNLDARRHVNR+CLAA V
Sbjct  79   VAKESASKFNPNVRIIAYHDNIKNDQFNVAWFQSFRLVFNALDNLDARRHVNRMCLAANV  138

Query  594  PLVESGTTGFLGQVTV  641
            PLVESGTTGF GQV V
Sbjct  139  PLVESGTTGFNGQVQV  154



>ref|XP_006965352.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR48605.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS01528.1| hypothetical protein M419DRAFT_81048 [Trichoderma reesei RUT 
C-30]
Length=668

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S +K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  61   SLVKHARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  120

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            + VA+EA  +F P +KI  +HAN+KD  F V +F++F +V N LDNLDARRHVN++CLAA
Sbjct  121  SLVAKEAAQRFNPNVKIVAHHANIKDLEFSVPWFRDFKIVFNALDNLDARRHVNKMCLAA  180

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  181  DVPLIESGTTGFNGQVQV  198



>gb|EXK45778.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. melonis 26406]
Length=620

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>ref|XP_001539458.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN08426.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=580

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 9/148 (6%)
 Frame = +3

Query  225  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  404
            ++ I+ ++V +VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFRQ H+ + 
Sbjct  13   LTKIRKSRVFLVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRQEHIKKP  72

Query  405  KA---------KVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDAR  557
            KA         +VA+E   KFR  + +  YHAN+KDP F V+FF+ F++V N LDNLDAR
Sbjct  73   KALLTFYFLAIQVAKEVASKFRRDVSLHAYHANIKDPQFNVEFFESFDIVFNALDNLDAR  132

Query  558  RHVNRLCLAAGVPLVESGTTGFLGQVTV  641
            RHVNR+CLAA VPL+ESGTTGF GQV V
Sbjct  133  RHVNRMCLAANVPLIESGTTGFNGQVQV  160



>gb|EWZ48439.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum Fo47]
 gb|EWZ93505.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. lycopersici MN25]
Length=620

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>gb|EXL53768.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. radicis-lycopersici 26381]
Length=620

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>gb|EXK45779.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. melonis 26406]
Length=619

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>gb|EXM07021.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. cubense tropical race 4 54006]
Length=605

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  73   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  132

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  133  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQQFRIAFNALDNLEARRHVNKMCLAA  192

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  193  DVPLIESGTTGFNGQVQV  210



>ref|XP_006665443.1| ubiquitin-like activating enzyme, putative [Cordyceps militaris 
CM01]
 gb|EGX95566.1| ubiquitin-like activating enzyme, putative [Cordyceps militaris 
CM01]
Length=700

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            S +K ++VLMVGAGGIGCELLKNL L GF  IHI+D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  97   SKVKQSRVLMVGAGGIGCELLKNLVLMGFGQIHIVDLDTIDLSNLNRQFLFRQEHIKKSK  156

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F VV N LDNL+ARRHVN++CLAA
Sbjct  157  ALVAKEAAERFNPNVKISAHHANIKDEEFTVAWFRDFTVVFNALDNLEARRHVNKMCLAA  216

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQ  V
Sbjct  217  QVPLIESGTTGFNGQTQV  234



>gb|EXM33950.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. vasinfectum 25433]
Length=609

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>gb|EXL53769.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. radicis-lycopersici 26381]
Length=619

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>ref|NP_595945.1| SUMO E1-like activator enzyme Fub2 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|O42939.1|UBA2_SCHPO RecName: Full=Ubiquitin-activating enzyme E1-like; AltName: Full=Pmt3-activating 
enzyme subunit 2 [Schizosaccharomyces pombe 
972h-]
 emb|CAA17901.1| SUMO E1-like activator enzyme Fub2 (predicted) [Schizosaccharomyces 
pombe]
Length=628

 Score =   198 bits (504),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +3

Query  219  EQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVG  398
            E +   K+AKVL+VGAGGIGCELLKNL +SG +++HIID+DTI++SNLNRQFLFR+ HV 
Sbjct  18   EALRNFKSAKVLLVGAGGIGCELLKNLLMSGVKEVHIIDLDTIDLSNLNRQFLFRKKHVK  77

Query  399  QSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLC  578
            Q KA VA +    F P +K+E YHAN+K+  F V +F++F++V N LDNLDARRHVN+ C
Sbjct  78   QPKAIVAAKTASSFNPNVKLEAYHANIKEDRFNVAWFRQFDLVFNALDNLDARRHVNKQC  137

Query  579  LAAGVPLVESGTTGFLGQVTV  641
            L A VPL+ESGTTGFLGQV V
Sbjct  138  LLASVPLIESGTTGFLGQVQV  158



>gb|EWZ48440.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum Fo47]
 gb|EWZ93506.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. lycopersici MN25]
Length=619

 Score =   198 bits (504),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>dbj|GAM22192.1| hypothetical protein SAMD00019534_053670, partial [Acytostelium 
subglobosum LB1]
Length=636

 Score =   198 bits (504),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 120/143 (84%), Gaps = 2/143 (1%)
 Frame = +3

Query  219  EQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVG  398
            +  + +++AKVL+VGAGGIGCELLKNL LSGF+DIHIID+DTI++SNLNRQFLFR+ H+G
Sbjct  32   DTFAKVRSAKVLVVGAGGIGCELLKNLVLSGFKDIHIIDLDTIDLSNLNRQFLFRKHHIG  91

Query  399  QSKAKVAREAVLKF--RPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNR  572
             SKAK+ARE+VLK+     + I  +HA++K   FG ++F++F++V+N LDNL ARRHVNR
Sbjct  92   MSKAKIARESVLKYANSDDVSIIAHHADIKTTEFGPNYFEQFDLVMNALDNLSARRHVNR  151

Query  573  LCLAAGVPLVESGTTGFLGQVTV  641
            +CL+  VPL+ESGT G+LGQVTV
Sbjct  152  VCLSVNVPLIESGTAGYLGQVTV  174



>gb|EWZ02355.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum FOSC 
3-a]
Length=609

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  228  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  407
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  408  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFKEFNVVLNGLDNLDARRHVNRLCLAA  587
            A VA+EA  +F P +KI  +HAN+KD  F V +F++F +  N LDNL+ARRHVN++CLAA
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQQFRIAFNALDNLEARRHVNKMCLAA  196

Query  588  GVPLVESGTTGFLGQVTV  641
             VPL+ESGTTGF GQV V
Sbjct  197  DVPLIESGTTGFNGQVQV  214



>ref|XP_010938778.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Elaeis 
guineensis]
Length=618

 Score =   198 bits (504),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +3

Query  330  IDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  509
            IDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR+AVLKFRP I I P HAN+KDP F V+FF
Sbjct  12   IDMDTIEVSNLNRQFLFRQSHVGQSKAKVARDAVLKFRPHINITPCHANIKDPEFDVEFF  71

Query  510  KEFNVVLNGLDNLDARRHVNRLCLAAGVPLVESGTTGFLGQVTVH  644
            K+FNVVLNGLDNLDARRHVNRLCLAA VPLVESGTTGFLGQVTVH
Sbjct  72   KKFNVVLNGLDNLDARRHVNRLCLAAEVPLVESGTTGFLGQVTVH  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375