BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF026D10

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089706.1|  PREDICTED: YTH domain-containing family prot...    167   3e-44   Sesamum indicum [beniseed]
ref|XP_011089707.1|  PREDICTED: uncharacterized protein LOC105170581    167   4e-44   Sesamum indicum [beniseed]
ref|XP_009587406.1|  PREDICTED: protein lozenge-like                    152   1e-40   Nicotiana tomentosiformis
ref|XP_007204996.1|  hypothetical protein PRUPE_ppa004220mg             152   3e-39   
ref|XP_008221460.1|  PREDICTED: uncharacterized protein LOC103321...    152   5e-39   Prunus mume [ume]
emb|CBI16561.3|  unnamed protein product                                150   2e-38   Vitis vinifera
ref|XP_002285750.1|  PREDICTED: uncharacterized protein LOC100253...    150   2e-38   Vitis vinifera
ref|XP_008221524.1|  PREDICTED: uncharacterized protein LOC103321...    149   6e-38   Prunus mume [ume]
ref|XP_009799894.1|  PREDICTED: uncharacterized protein LOC104245...    147   4e-37   Nicotiana sylvestris
ref|XP_009799895.1|  PREDICTED: uncharacterized protein LOC104245...    147   4e-37   Nicotiana sylvestris
ref|XP_010651400.1|  PREDICTED: uncharacterized protein LOC100253...    146   1e-36   Vitis vinifera
ref|XP_008366132.1|  PREDICTED: uncharacterized protein LOC103429...    145   3e-36   
gb|KHN06477.1|  YTH domain family protein 2                             144   3e-36   Glycine soja [wild soybean]
ref|XP_006580216.1|  PREDICTED: YTH domain family protein 1-like        144   4e-36   Glycine max [soybeans]
ref|XP_009376087.1|  PREDICTED: uncharacterized protein LOC103964...    143   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_008366133.1|  PREDICTED: uncharacterized protein LOC103429...    143   1e-35   
ref|XP_009339197.1|  PREDICTED: uncharacterized protein LOC103931441    143   1e-35   
ref|XP_006359197.1|  PREDICTED: uncharacterized protein LOC102583016    142   2e-35   Solanum tuberosum [potatoes]
ref|XP_007014623.1|  Evolutionarily conserved C-terminal region 2...    142   3e-35   
ref|XP_009597413.1|  PREDICTED: uncharacterized protein LOC104093...    142   4e-35   Nicotiana tomentosiformis
ref|XP_009597421.1|  PREDICTED: uncharacterized protein LOC104093...    142   4e-35   Nicotiana tomentosiformis
gb|KHN48074.1|  YTH domain family protein 2                             141   5e-35   Glycine soja [wild soybean]
ref|XP_003531272.1|  PREDICTED: uncharacterized protein LOC100819...    141   5e-35   Glycine max [soybeans]
ref|XP_006585211.1|  PREDICTED: uncharacterized protein LOC100819...    141   6e-35   
ref|XP_006585212.1|  PREDICTED: uncharacterized protein LOC100819...    140   7e-35   
ref|XP_006585213.1|  PREDICTED: uncharacterized protein LOC100819...    140   7e-35   Glycine max [soybeans]
ref|XP_002513402.1|  yth domain-containing protein, putative            140   7e-35   
ref|XP_008351953.1|  PREDICTED: uncharacterized protein LOC103415395    140   7e-35   
ref|XP_004228948.1|  PREDICTED: uncharacterized protein LOC101253713    140   2e-34   Solanum lycopersicum
ref|XP_009601164.1|  PREDICTED: uncharacterized protein LOC104096490    139   3e-34   
ref|XP_009764450.1|  PREDICTED: uncharacterized protein LOC104216...    139   3e-34   Nicotiana sylvestris
gb|EYU32828.1|  hypothetical protein MIMGU_mgv1a002229mg                138   7e-34   Erythranthe guttata [common monkey flower]
ref|XP_010103094.1|  hypothetical protein L484_005073                   136   3e-33   
gb|KDP29478.1|  hypothetical protein JCGZ_19307                         135   8e-33   Jatropha curcas
ref|XP_007014622.1|  Evolutionarily conserved C-terminal region 2...    134   2e-32   
gb|KHG09343.1|  Glutamate receptor                                      130   6e-32   Gossypium arboreum [tree cotton]
ref|XP_007159551.1|  hypothetical protein PHAVU_002G247000g             132   1e-31   Phaseolus vulgaris [French bean]
ref|XP_011461644.1|  PREDICTED: YTH domain-containing family prot...    132   2e-31   Fragaria vesca subsp. vesca
ref|XP_011461643.1|  PREDICTED: YTH domain-containing family prot...    132   2e-31   Fragaria vesca subsp. vesca
gb|EYU39279.1|  hypothetical protein MIMGU_mgv1a002515mg                130   3e-31   Erythranthe guttata [common monkey flower]
gb|KJB21909.1|  hypothetical protein B456_004G020600                    129   4e-31   Gossypium raimondii
ref|XP_004504214.1|  PREDICTED: YTH domain family protein 2-like ...    130   6e-31   Cicer arietinum [garbanzo]
ref|XP_004504212.1|  PREDICTED: YTH domain family protein 2-like ...    130   7e-31   
ref|XP_004504213.1|  PREDICTED: YTH domain family protein 2-like ...    130   7e-31   Cicer arietinum [garbanzo]
gb|KJB21907.1|  hypothetical protein B456_004G020600                    129   7e-31   Gossypium raimondii
gb|KJB21908.1|  hypothetical protein B456_004G020600                    129   8e-31   Gossypium raimondii
ref|XP_009376095.1|  PREDICTED: uncharacterized protein LOC103964...    129   8e-31   Pyrus x bretschneideri [bai li]
gb|KDP23024.1|  hypothetical protein JCGZ_01687                         125   3e-29   Jatropha curcas
ref|XP_004506479.1|  PREDICTED: uncharacterized protein LOC101499095    119   7e-29   
ref|XP_011025120.1|  PREDICTED: uncharacterized protein LOC105126076    122   1e-28   Populus euphratica
ref|XP_002304850.2|  hypothetical protein POPTR_0003s20840g             120   7e-28   Populus trichocarpa [western balsam poplar]
ref|XP_003629923.1|  YTH domain family protein                          120   2e-27   
gb|AET04399.2|  evolutionarily carboxy-terminal region protein          120   2e-27   Medicago truncatula
ref|XP_008812836.1|  PREDICTED: YTH domain-containing family prot...    118   1e-26   Phoenix dactylifera
gb|KDO54489.1|  hypothetical protein CISIN_1g005158mg                   115   2e-26   Citrus sinensis [apfelsine]
ref|XP_010932747.1|  PREDICTED: YTH domain-containing family prot...    117   3e-26   Elaeis guineensis
ref|XP_004144062.1|  PREDICTED: uncharacterized protein LOC101215929    117   3e-26   Cucumis sativus [cucumbers]
ref|XP_008451001.1|  PREDICTED: uncharacterized protein LOC103492...    117   3e-26   Cucumis melo [Oriental melon]
ref|XP_008451002.1|  PREDICTED: uncharacterized protein LOC103492...    117   3e-26   Cucumis melo [Oriental melon]
gb|KDO54494.1|  hypothetical protein CISIN_1g005158mg                   115   5e-26   Citrus sinensis [apfelsine]
gb|KDO54493.1|  hypothetical protein CISIN_1g005158mg                   115   8e-26   Citrus sinensis [apfelsine]
ref|XP_006445566.1|  hypothetical protein CICLE_v10014439mg             115   1e-25   Citrus clementina [clementine]
ref|XP_010257810.1|  PREDICTED: YTH domain-containing family prot...    113   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010917720.1|  PREDICTED: uncharacterized protein LOC105042282    113   5e-25   Elaeis guineensis
ref|XP_011048156.1|  PREDICTED: uncharacterized protein LOC105142...    112   6e-25   Populus euphratica
ref|XP_010257809.1|  PREDICTED: YTH domain-containing family prot...    112   7e-25   Nelumbo nucifera [Indian lotus]
ref|XP_002299095.2|  hypothetical protein POPTR_0001s039401g            111   1e-24   
gb|ABK96645.1|  unknown                                                 111   2e-24   Populus trichocarpa x Populus deltoides
gb|KDO54495.1|  hypothetical protein CISIN_1g005158mg                   111   2e-24   Citrus sinensis [apfelsine]
ref|XP_006488954.1|  PREDICTED: uncharacterized protein LOC102626...    111   3e-24   Citrus sinensis [apfelsine]
gb|KDO54492.1|  hypothetical protein CISIN_1g005158mg                   109   9e-24   Citrus sinensis [apfelsine]
gb|KDO54490.1|  hypothetical protein CISIN_1g005158mg                   108   2e-23   Citrus sinensis [apfelsine]
ref|XP_011048157.1|  PREDICTED: uncharacterized protein LOC105142...    108   3e-23   Populus euphratica
ref|XP_008779460.1|  PREDICTED: YTH domain-containing family prot...  99.4    4e-20   Phoenix dactylifera
ref|XP_010552316.1|  PREDICTED: uncharacterized protein LOC104822...  99.0    4e-20   Tarenaya hassleriana [spider flower]
ref|XP_010552315.1|  PREDICTED: uncharacterized protein LOC104822...  99.0    4e-20   Tarenaya hassleriana [spider flower]
ref|XP_010552314.1|  PREDICTED: uncharacterized protein LOC104822...  98.2    7e-20   Tarenaya hassleriana [spider flower]
ref|XP_010552313.1|  PREDICTED: uncharacterized protein LOC104822...  98.2    7e-20   Tarenaya hassleriana [spider flower]
ref|XP_006826301.1|  hypothetical protein AMTR_s00004p00073360        98.2    8e-20   Amborella trichopoda
gb|KCW87046.1|  hypothetical protein EUGRSUZ_B03591                   95.5    9e-19   Eucalyptus grandis [rose gum]
ref|XP_010653843.1|  PREDICTED: uncharacterized protein LOC100245...  95.1    1e-18   Vitis vinifera
ref|XP_010653842.1|  PREDICTED: uncharacterized protein LOC100245...  95.1    1e-18   Vitis vinifera
emb|CAN81896.1|  hypothetical protein VITISV_009052                   93.6    3e-18   Vitis vinifera
gb|KGN66348.1|  hypothetical protein Csa_1G599420                     93.6    3e-18   Cucumis sativus [cucumbers]
ref|XP_008451003.1|  PREDICTED: uncharacterized protein LOC103492...  93.6    3e-18   Cucumis melo [Oriental melon]
ref|XP_010465188.1|  PREDICTED: uncharacterized protein LOC104745597  92.8    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010487108.1|  PREDICTED: uncharacterized protein LOC104765...  92.8    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010500586.1|  PREDICTED: uncharacterized protein LOC104777...  92.0    1e-17   Camelina sativa [gold-of-pleasure]
gb|KCW87047.1|  hypothetical protein EUGRSUZ_B03591                   91.7    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010910310.1|  PREDICTED: YTH domain-containing family prot...  91.3    2e-17   Elaeis guineensis
ref|XP_006407213.1|  hypothetical protein EUTSA_v10020224mg           91.3    2e-17   
ref|XP_010487109.1|  PREDICTED: uncharacterized protein LOC104765...  90.9    2e-17   
ref|XP_010487106.1|  PREDICTED: uncharacterized protein LOC104765...  89.4    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006407214.1|  hypothetical protein EUTSA_v10020224mg           89.0    1e-16   
ref|XP_010044923.1|  PREDICTED: uncharacterized protein LOC104433760  88.6    1e-16   Eucalyptus grandis [rose gum]
ref|XP_010500580.1|  PREDICTED: uncharacterized protein LOC104777...  88.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006297132.1|  hypothetical protein CARUB_v10013133mg           87.8    3e-16   Capsella rubella
ref|XP_010044924.1|  PREDICTED: uncharacterized protein LOC104433761  87.8    3e-16   Eucalyptus grandis [rose gum]
ref|XP_010487107.1|  PREDICTED: uncharacterized protein LOC104765...  87.4    4e-16   
ref|XP_009398525.1|  PREDICTED: YTH domain-containing family prot...  87.4    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408493.1|  PREDICTED: uncharacterized protein LOC103990...  86.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408492.1|  PREDICTED: uncharacterized protein LOC103990...  86.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001030689.1|  CIPK1 interacting protein ECT2                   84.7    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009339199.1|  PREDICTED: uncharacterized protein LOC103931...  84.0    6e-15   Pyrus x bretschneideri [bai li]
gb|AAN72190.1|  Unknown protein                                       84.0    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187955.2|  CIPK1 interacting protein ECT2                      83.6    7e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KEH20708.1|  evolutionarily carboxy-terminal region protein        83.2    8e-15   Medicago truncatula
ref|XP_009339198.1|  PREDICTED: uncharacterized protein LOC103931...  83.2    1e-14   Pyrus x bretschneideri [bai li]
ref|NP_001030690.1|  CIPK1 interacting protein ECT2                   82.8    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850578.1|  CIPK1 interacting protein ECT2                      82.8    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004985632.1|  PREDICTED: uncharacterized protein LOC101767...  82.8    1e-14   Setaria italica
ref|XP_004985630.1|  PREDICTED: uncharacterized protein LOC101767...  82.8    1e-14   Setaria italica
ref|XP_004985631.1|  PREDICTED: uncharacterized protein LOC101767...  82.8    1e-14   Setaria italica
ref|XP_004985629.1|  PREDICTED: uncharacterized protein LOC101767...  82.8    1e-14   Setaria italica
ref|XP_009399331.1|  PREDICTED: YTH domain-containing family prot...  82.8    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398364.1|  PREDICTED: YTH domain-containing family prot...  82.4    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001185240.1|  uncharacterized protein                          82.4    2e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CAN81999.1|  hypothetical protein VITISV_031582                   77.4    3e-14   Vitis vinifera
ref|NP_001280979.1|  uncharacterized LOC103446969                     81.3    4e-14   Malus domestica [apple tree]
ref|XP_009411291.1|  PREDICTED: uncharacterized protein LOC103993...  80.9    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010534849.1|  PREDICTED: uncharacterized protein LOC104810317  80.9    5e-14   Tarenaya hassleriana [spider flower]
gb|EPS72124.1|  hypothetical protein M569_02632                       80.9    5e-14   Genlisea aurea
ref|XP_009411292.1|  PREDICTED: uncharacterized protein LOC103993...  80.9    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008351306.1|  PREDICTED: uncharacterized protein LOC103414...  80.1    9e-14   
ref|XP_009398365.1|  PREDICTED: YTH domain-containing family prot...  80.1    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001169286.1|  hypothetical protein                             80.1    1e-13   Zea mays [maize]
ref|XP_010542475.1|  PREDICTED: uncharacterized protein LOC104815674  80.1    1e-13   Tarenaya hassleriana [spider flower]
gb|AFW89696.1|  hypothetical protein ZEAMMB73_168477                  80.1    1e-13   
ref|XP_002884968.1|  hypothetical protein ARALYDRAFT_478733           79.7    1e-13   
ref|XP_008351300.1|  PREDICTED: YTH domain-containing family prot...  79.3    2e-13   
ref|XP_008384358.1|  PREDICTED: uncharacterized protein LOC103446...  79.0    2e-13   
ref|XP_006445565.1|  hypothetical protein CICLE_v10014439mg           78.2    4e-13   
ref|XP_008366130.1|  PREDICTED: uncharacterized protein LOC103429...  78.2    4e-13   
ref|XP_009124755.1|  PREDICTED: uncharacterized protein LOC103849773  77.4    7e-13   Brassica rapa
gb|KFK38676.1|  hypothetical protein AALP_AA3G146000                  77.4    8e-13   Arabis alpina [alpine rockcress]
emb|CDY07089.1|  BnaCnng01040D                                        76.3    2e-12   
ref|XP_008645292.1|  PREDICTED: uncharacterized protein LOC100383...  76.3    2e-12   Zea mays [maize]
ref|NP_001169717.1|  uncharacterized protein LOC100383598             75.9    2e-12   Zea mays [maize]
ref|XP_008645285.1|  PREDICTED: uncharacterized protein LOC100383...  75.9    2e-12   Zea mays [maize]
ref|NP_001280968.1|  YTH domain-containing family protein 2-like      75.5    3e-12   Malus domestica [apple tree]
ref|XP_009603414.1|  PREDICTED: YTH domain-containing family prot...  75.1    4e-12   Nicotiana tomentosiformis
ref|XP_009146490.1|  PREDICTED: uncharacterized protein LOC103870130  74.7    5e-12   Brassica rapa
emb|CDY43989.1|  BnaA05g25840D                                        74.7    5e-12   Brassica napus [oilseed rape]
ref|XP_010229176.1|  PREDICTED: uncharacterized protein LOC100841...  74.7    7e-12   Brachypodium distachyon [annual false brome]
ref|XP_003558773.1|  PREDICTED: uncharacterized protein LOC100841...  74.7    7e-12   Brachypodium distachyon [annual false brome]
emb|CDY24182.1|  BnaC01g37620D                                        73.9    8e-12   Brassica napus [oilseed rape]
ref|XP_010229175.1|  PREDICTED: uncharacterized protein LOC100841...  73.2    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_009797483.1|  PREDICTED: uncharacterized protein LOC104243...  72.4    3e-11   Nicotiana sylvestris
gb|AAY44715.1|  unknown                                               72.4    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049022.1|  Os03g0158500                                     72.4    3e-11   
gb|ABF94073.1|  YT521-B-like family protein, expressed                72.4    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74554.1|  hypothetical protein OsI_10095                        72.4    4e-11   Oryza sativa Indica Group [Indian rice]
gb|ABF94076.1|  YT521-B-like family protein, expressed                72.0    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KDP39708.1|  hypothetical protein JCGZ_02728                       72.0    4e-11   Jatropha curcas
gb|AAD10646.1|  Hypothetical protein                                  71.2    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009797480.1|  PREDICTED: YTH domain-containing family prot...  71.2    7e-11   Nicotiana sylvestris
ref|NP_001185241.1|  uncharacterized protein                          71.2    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006651059.1|  PREDICTED: uncharacterized protein LOC102715747  70.9    9e-11   Oryza brachyantha
gb|AAN06837.1|  Putative RNA-binding protein                          69.3    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008805376.1|  PREDICTED: YTH domain-containing family prot...  68.6    5e-10   
dbj|BAK04671.1|  predicted protein                                    66.6    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25443.1|  hypothetical protein F775_28207                       66.6    2e-09   
dbj|BAJ96028.1|  predicted protein                                    66.6    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX82538.1|  BnaA03g32830D                                        66.6    2e-09   
emb|CDX75712.1|  BnaC03g37950D                                        66.2    3e-09   
gb|EMS56337.1|  YTH domain family protein 2                           66.2    3e-09   Triticum urartu
gb|KDO54496.1|  hypothetical protein CISIN_1g005158mg                 58.9    8e-09   Citrus sinensis [apfelsine]
emb|CDY23602.1|  BnaC05g39920D                                        63.5    2e-08   Brassica napus [oilseed rape]
gb|ABF94074.1|  YT521-B-like family protein, expressed                63.2    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003553331.1|  PREDICTED: uncharacterized protein LOC100818...  62.4    6e-08   Glycine max [soybeans]
ref|XP_009397705.1|  PREDICTED: uncharacterized protein LOC103982492  61.6    9e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003624620.1|  YTH domain family protein                        60.5    2e-07   
ref|XP_009135306.1|  PREDICTED: uncharacterized protein LOC103859518  60.5    2e-07   Brassica rapa
ref|XP_003624622.1|  YTH domain family protein                        60.1    3e-07   Medicago truncatula
ref|XP_003624619.1|  YTH domain family protein                        60.1    3e-07   
gb|KHN34709.1|  YTH domain family protein 1                           60.1    3e-07   Glycine soja [wild soybean]
ref|XP_002891837.1|  hypothetical protein ARALYDRAFT_337630           58.9    6e-07   
ref|XP_006650583.1|  PREDICTED: probable ATP-dependent RNA helica...  57.4    2e-06   
ref|XP_004493150.1|  PREDICTED: uncharacterized protein LOC101504...  57.0    3e-06   Cicer arietinum [garbanzo]
ref|XP_009764452.1|  PREDICTED: uncharacterized protein LOC104216...  56.6    4e-06   Nicotiana sylvestris
ref|NP_564692.1|  uncharacterized protein                             56.6    4e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDP14325.1|  unnamed protein product                              55.5    1e-05   Coffea canephora [robusta coffee]
gb|EPS63062.1|  hypothetical protein M569_11723                       55.1    2e-05   Genlisea aurea
ref|XP_009597426.1|  PREDICTED: uncharacterized protein LOC104093...  54.3    2e-05   Nicotiana tomentosiformis
ref|XP_010652548.1|  PREDICTED: uncharacterized protein LOC100249721  53.9    3e-05   
ref|XP_006604223.1|  PREDICTED: uncharacterized protein LOC100818...  53.5    4e-05   Glycine max [soybeans]
ref|XP_010652549.1|  PREDICTED: uncharacterized protein LOC104879848  52.8    6e-05   Vitis vinifera
ref|XP_008351313.1|  PREDICTED: uncharacterized protein LOC103414...  52.4    1e-04   
ref|NP_001051264.1|  Os03g0748000                                     49.7    0.001   



>ref|XP_011089706.1| PREDICTED: YTH domain-containing family protein 1-like [Sesamum 
indicum]
Length=703

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 145/175 (83%), Gaps = 8/175 (5%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  342
            AAVAP ADQ ++LLQ LSLDSQ K +EIP+ TKK S+DS++ ANG IQ +DRS +PL+PD
Sbjct  2    AAVAPPADQAADLLQKLSLDSQAKTIEIPDATKKPSIDSSNVANG-IQ-SDRSVTPLLPD  59

Query  343  FMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHg  510
            FMDPT+CYLPN      YYYGGYDG+ NEWE Y RYVN +GVEM PGVYGDN SL+Y HG
Sbjct  60   FMDPTMCYLPNGYPSTAYYYGGYDGSANEWEDYTRYVNQDGVEMTPGVYGDNGSLMYHHG  119

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPYPTPAAPA  669
            YGY PY PYSPATSPVPT+GHDGQ+YGAQHYQYPTPYFQ L  TSGPYPTPAAP 
Sbjct  120  YGYAPYAPYSPATSPVPTLGHDGQIYGAQHYQYPTPYFQSLTPTSGPYPTPAAPG  174



>ref|XP_011089707.1| PREDICTED: uncharacterized protein LOC105170581 [Sesamum indicum]
Length=696

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 145/175 (83%), Gaps = 8/175 (5%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  342
            AAVAP +DQ ++LLQ LSLDSQ K +EIP+ TKK S+DS++  NG IQ +DRS +PL+PD
Sbjct  2    AAVAPPSDQAADLLQKLSLDSQAKTIEIPDATKKPSIDSSNVPNG-IQ-SDRSVTPLLPD  59

Query  343  FMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHg  510
            FMDPT+CYLPN      YYY GYDG+ NEWE Y RYVN +GVEM PGVYGDN SL+Y HG
Sbjct  60   FMDPTMCYLPNGYPSTAYYYSGYDGSANEWEDYTRYVNQDGVEMTPGVYGDNGSLMYHHG  119

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPYPTPAAPA  669
            YGY PYGPYSPATSPVPTVGHDGQLYGAQHYQYPTPYFQ L  TSGPYPTPAAPA
Sbjct  120  YGYAPYGPYSPATSPVPTVGHDGQLYGAQHYQYPTPYFQSLTPTSGPYPTPAAPA  174



>ref|XP_009587406.1| PREDICTED: protein lozenge-like [Nicotiana tomentosiformis]
Length=304

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 128/155 (83%), Gaps = 3/155 (2%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  342
            AAVAP+ADQ ++LLQ LSLDSQ K+LEI EP KK  VDS    NGQIQP DRS +PL+PD
Sbjct  2    AAVAPSADQAADLLQKLSLDSQNKSLEIAEPKKK-PVDSKDVGNGQIQPVDRSVTPLLPD  60

Query  343  FMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygyt  522
            FMDPTLCY+PNGYP YY GYDG+GNEWE Y RYVN EGVEM G YGDN S +YQHGYGY 
Sbjct  61   FMDPTLCYVPNGYPSYYYGYDGSGNEWEDYTRYVNPEGVEMTGAYGDNGSFMYQHGYGYA  120

Query  523  pygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQ  627
            PY PYSPATSPVPTVGHDGQLYGAQHY Y  PYFQ
Sbjct  121  PYSPYSPATSPVPTVGHDGQLYGAQHYHY--PYFQ  153



>ref|XP_007204996.1| hypothetical protein PRUPE_ppa004220mg [Prunus persica]
 gb|EMJ06195.1| hypothetical protein PRUPE_ppa004220mg [Prunus persica]
Length=522

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 146/180 (81%), Gaps = 14/180 (8%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  324
            A VAP ADQ ++LLQ LSLDSQTK LEIPEPTKK       S+DS +AANGQIQ ++RS 
Sbjct  2    ATVAPPADQAADLLQKLSLDSQTKTLEIPEPTKKPSVNQYGSIDSGNAANGQIQ-SERSV  60

Query  325  SPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSL  495
            +PL+PDFMDP+LCYLPN     YYYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN SL
Sbjct  61   TPLLPDFMDPSLCYLPNAYPSAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGSL  120

Query  496  VYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAAP  666
            +Y HGYGY PYGPYSPA SPVPT+G+DGQLYG QHYQYP PYFQPL  TSGPY P+PAAP
Sbjct  121  LYHHGYGYAPYGPYSPAGSPVPTMGNDGQLYGPQHYQYP-PYFQPLTPTSGPYTPSPAAP  179



>ref|XP_008221460.1| PREDICTED: uncharacterized protein LOC103321408 isoform X1 [Prunus 
mume]
Length=704

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 146/180 (81%), Gaps = 14/180 (8%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  324
            A VAP ADQ ++LLQ LSLDSQTK LEIPEPTKK       S+DS +AANGQIQ ++RS 
Sbjct  2    ATVAPPADQAADLLQKLSLDSQTKTLEIPEPTKKPSVNQYGSIDSGNAANGQIQ-SERSV  60

Query  325  SPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSL  495
            +PL+PDFMDP+LCYLPN     YYYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN SL
Sbjct  61   TPLLPDFMDPSLCYLPNAYPSAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGSL  120

Query  496  VYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAAP  666
            +Y HGYGY PYGPYSPA SPVPT+G+DGQLYG QHYQYP PYFQPL  TSGPY P+PAAP
Sbjct  121  LYHHGYGYAPYGPYSPAGSPVPTMGNDGQLYGPQHYQYP-PYFQPLTPTSGPYTPSPAAP  179



>emb|CBI16561.3| unnamed protein product [Vitis vinifera]
Length=675

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 136/179 (76%), Gaps = 11/179 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS------VDSTHAANGQIQPADRSF  324
            AAVAP ADQ +ELLQ LSLDSQTK LEIPEPTKK S      VD   AANGQ Q  +RS 
Sbjct  2    AAVAPPADQAAELLQKLSLDSQTKTLEIPEPTKKPSGNQFGAVDGGDAANGQNQSCERSV  61

Query  325  SPLIPDFMDPTLCYLPNgypyyyggydg-tgNEWEGYPRYVNAEGVEMP-GVYGDNSSLV  498
            +PL+ +FMDP++CY+PNGY  YY G    T NEWE Y RY+N EGVEMP GVYGDN SL+
Sbjct  62   TPLLQEFMDPSVCYVPNGYSSYYYGGYDGTTNEWEDYSRYMNPEGVEMPAGVYGDNGSLM  121

Query  499  YQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP--LTSGPY-PTPAAP  666
            Y HGYGY PYGPY PA SPVPTVGHDGQLYG QHYQYP PYFQP   TSGPY P+P AP
Sbjct  122  YHHGYGYAPYGPYPPAGSPVPTVGHDGQLYGPQHYQYPAPYFQPPTPTSGPYNPSPGAP  180



>ref|XP_002285750.1| PREDICTED: uncharacterized protein LOC100253534 isoform X1 [Vitis 
vinifera]
Length=705

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 136/179 (76%), Gaps = 11/179 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS------VDSTHAANGQIQPADRSF  324
            AAVAP ADQ +ELLQ LSLDSQTK LEIPEPTKK S      VD   AANGQ Q  +RS 
Sbjct  2    AAVAPPADQAAELLQKLSLDSQTKTLEIPEPTKKPSGNQFGAVDGGDAANGQNQSCERSV  61

Query  325  SPLIPDFMDPTLCYLPNgypyyyggydg-tgNEWEGYPRYVNAEGVEMP-GVYGDNSSLV  498
            +PL+ +FMDP++CY+PNGY  YY G    T NEWE Y RY+N EGVEMP GVYGDN SL+
Sbjct  62   TPLLQEFMDPSVCYVPNGYSSYYYGGYDGTTNEWEDYSRYMNPEGVEMPAGVYGDNGSLM  121

Query  499  YQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP--LTSGPY-PTPAAP  666
            Y HGYGY PYGPY PA SPVPTVGHDGQLYG QHYQYP PYFQP   TSGPY P+P AP
Sbjct  122  YHHGYGYAPYGPYPPAGSPVPTVGHDGQLYGPQHYQYPAPYFQPPTPTSGPYNPSPGAP  180



>ref|XP_008221524.1| PREDICTED: uncharacterized protein LOC103321408 isoform X2 [Prunus 
mume]
Length=703

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 127/157 (81%), Gaps = 14/157 (9%)
 Frame = +1

Query  232  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNg--ypy  387
            K LEIPEPTKK       S+DS +AANGQIQ ++RS +PL+PDFMDP+LCYLPN     Y
Sbjct  24   KTLEIPEPTKKPSVNQYGSIDSGNAANGQIQ-SERSVTPLLPDFMDPSLCYLPNAYPSAY  82

Query  388  yyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPT  564
            YYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVPT
Sbjct  83   YYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVPT  142

Query  565  VGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAAP  666
            +G+DGQLYG QHYQYP PYFQPL  TSGPY P+PAAP
Sbjct  143  MGNDGQLYGPQHYQYP-PYFQPLTPTSGPYTPSPAAP  178



>ref|XP_009799894.1| PREDICTED: uncharacterized protein LOC104245894 isoform X1 [Nicotiana 
sylvestris]
Length=701

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  342
            AAVAP ADQ ++LLQ LSLDSQ K LEI EP KK  VDS    NGQIQ  DRS +PL+PD
Sbjct  2    AAVAPPADQAADLLQKLSLDSQNKTLEIAEPKKK-PVDSKDVGNGQIQSLDRSVTPLLPD  60

Query  343  FMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygyt  522
            FMDPTLCY+PNGYP YY GYDG+GNEWE Y RYVN EGVEM G YGDN S +YQHGYGY 
Sbjct  61   FMDPTLCYVPNGYPSYYYGYDGSGNEWEDYTRYVNPEGVEMTGAYGDNGSFMYQHGYGYA  120

Query  523  pygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQ  627
            PY PYSPATSPVPTVGHDGQLYGAQHY Y  PYFQ
Sbjct  121  PYSPYSPATSPVPTVGHDGQLYGAQHYHY--PYFQ  153



>ref|XP_009799895.1| PREDICTED: uncharacterized protein LOC104245894 isoform X2 [Nicotiana 
sylvestris]
Length=699

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  342
            AAVAP ADQ ++LLQ LSLDSQ K LEI EP KK  VDS    NGQIQ  DRS +PL+PD
Sbjct  2    AAVAPPADQAADLLQKLSLDSQNKTLEIAEPKKK-PVDSKDVGNGQIQSLDRSVTPLLPD  60

Query  343  FMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygyt  522
            FMDPTLCY+PNGYP YY GYDG+GNEWE Y RYVN EGVEM G YGDN S +YQHGYGY 
Sbjct  61   FMDPTLCYVPNGYPSYYYGYDGSGNEWEDYTRYVNPEGVEMTGAYGDNGSFMYQHGYGYA  120

Query  523  pygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQ  627
            PY PYSPATSPVPTVGHDGQLYGAQHY Y  PYFQ
Sbjct  121  PYSPYSPATSPVPTVGHDGQLYGAQHYHY--PYFQ  153



>ref|XP_010651400.1| PREDICTED: uncharacterized protein LOC100253534 isoform X2 [Vitis 
vinifera]
Length=704

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 116/156 (74%), Gaps = 11/156 (7%)
 Frame = +1

Query  232  KALEIPEPTKKVS------VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyy  393
            K LEIPEPTKK S      VD   AANGQ Q  +RS +PL+ +FMDP++CY+PNGY  YY
Sbjct  24   KTLEIPEPTKKPSGNQFGAVDGGDAANGQNQSCERSVTPLLQEFMDPSVCYVPNGYSSYY  83

Query  394  ggydg-tgNEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQHgygytpygpyspatspVPTV  567
             G    T NEWE Y RY+N EGVEMP GVYGDN SL+Y HGYGY PYGPY PA SPVPTV
Sbjct  84   YGGYDGTTNEWEDYSRYMNPEGVEMPAGVYGDNGSLMYHHGYGYAPYGPYPPAGSPVPTV  143

Query  568  GHDGQLYGAQHYQYPTPYFQP--LTSGPY-PTPAAP  666
            GHDGQLYG QHYQYP PYFQP   TSGPY P+P AP
Sbjct  144  GHDGQLYGPQHYQYPAPYFQPPTPTSGPYNPSPGAP  179



>ref|XP_008366132.1| PREDICTED: uncharacterized protein LOC103429778 isoform X1 [Malus 
domestica]
Length=704

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 141/181 (78%), Gaps = 15/181 (8%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  324
            A VAP  +Q ++LLQ +SLDSQTK LEIPEPTKK       S+DS +AANGQI PA+RS 
Sbjct  2    ATVAPPVEQAADLLQKMSLDSQTKTLEIPEPTKKPSGNQYGSIDSGNAANGQI-PAERSV  60

Query  325  SPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  492
            +PL+PDF DP++CYLPN      YYYGGYDGTG+EW+ Y RYVN EGVEM  GVYGDN S
Sbjct  61   TPLLPDFTDPSMCYLPNSYPSTAYYYGGYDGTGSEWDDYSRYVNHEGVEMTSGVYGDNGS  120

Query  493  LVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAA  663
            L+Y HGYGY PY PYSPA SPVPT+G+DGQLYG Q YQYP PYFQPL  TSGPY P PAA
Sbjct  121  LIYHHGYGYAPYAPYSPAGSPVPTMGNDGQLYGPQQYQYP-PYFQPLTPTSGPYTPNPAA  179

Query  664  P  666
            P
Sbjct  180  P  180



>gb|KHN06477.1| YTH domain family protein 2 [Glycine soja]
Length=708

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 123/156 (79%), Gaps = 14/156 (9%)
 Frame = +1

Query  232  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            K LEIPEPTKK       SVDS +AANGQIQ  DRS +P++ DF+DPT+CYLPN      
Sbjct  25   KPLEIPEPTKKATGNQYGSVDSGNAANGQIQSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  84

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  85   YYYGGYDGTGNEWDEYSRYVNSEGVEMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVP  144

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPA  660
            T+G+DGQLYG QHYQYP PYFQPL  TS P+ PTPA
Sbjct  145  TMGNDGQLYGPQHYQYP-PYFQPLTPTSAPFTPTPA  179



>ref|XP_006580216.1| PREDICTED: YTH domain family protein 1-like [Glycine max]
Length=679

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 123/156 (79%), Gaps = 14/156 (9%)
 Frame = +1

Query  232  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            K LEIPEPTKK       SVDS +AANGQIQ  DRS +P++ DF+DPT+CYLPN      
Sbjct  25   KPLEIPEPTKKATGNQYGSVDSGNAANGQIQSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  84

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  85   YYYGGYDGTGNEWDEYSRYVNSEGVEMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVP  144

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPA  660
            T+G+DGQLYG QHYQYP PYFQPL  TS P+ PTPA
Sbjct  145  TMGNDGQLYGPQHYQYP-PYFQPLTPTSAPFTPTPA  179



>ref|XP_009376087.1| PREDICTED: uncharacterized protein LOC103964826 isoform X1 [Pyrus 
x bretschneideri]
Length=704

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 143/181 (79%), Gaps = 15/181 (8%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  324
            A VAP  +Q ++LLQ +SLDSQTK LEIPEPTKK       S+DS +AANGQI P++RS 
Sbjct  2    ATVAPPVEQAADLLQKMSLDSQTKTLEIPEPTKKPSVNQYGSIDSGNAANGQI-PSERSV  60

Query  325  SPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  492
            +PL+ DF+DP++CYLPN      YYYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN S
Sbjct  61   TPLLSDFVDPSMCYLPNGYPSTAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGS  120

Query  493  LVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAA  663
            L+Y HGYGY PYGPYSPA SPVPT+G+DGQLYG Q YQYP PYFQPL  TSGPY P+PAA
Sbjct  121  LLYHHGYGYAPYGPYSPAGSPVPTMGNDGQLYGPQQYQYP-PYFQPLTPTSGPYTPSPAA  179

Query  664  P  666
            P
Sbjct  180  P  180



>ref|XP_008366133.1| PREDICTED: uncharacterized protein LOC103429778 isoform X2 [Malus 
domestica]
Length=703

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 123/158 (78%), Gaps = 15/158 (9%)
 Frame = +1

Query  232  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            K LEIPEPTKK       S+DS +AANGQI PA+RS +PL+PDF DP++CYLPN      
Sbjct  24   KTLEIPEPTKKPSGNQYGSIDSGNAANGQI-PAERSVTPLLPDFTDPSMCYLPNSYPSTA  82

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYGGYDGTG+EW+ Y RYVN EGVEM  GVYGDN SL+Y HGYGY PY PYSPA SPVP
Sbjct  83   YYYGGYDGTGSEWDDYSRYVNHEGVEMTSGVYGDNGSLIYHHGYGYAPYAPYSPAGSPVP  142

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAAP  666
            T+G+DGQLYG Q YQYP PYFQPL  TSGPY P PAAP
Sbjct  143  TMGNDGQLYGPQQYQYP-PYFQPLTPTSGPYTPNPAAP  179



>ref|XP_009339197.1| PREDICTED: uncharacterized protein LOC103931441 [Pyrus x bretschneideri]
Length=704

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 139/181 (77%), Gaps = 15/181 (8%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  324
            A VAP  +Q ++LLQ +SLDSQTK LEIPEPTKK       S+DS +AANGQI P DRS 
Sbjct  2    ATVAPPVEQAADLLQKMSLDSQTKTLEIPEPTKKPSVNQYGSIDSGNAANGQI-PEDRSV  60

Query  325  SPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  492
            +PL+PDF DP++CYLPN      YYYGGYDGTG+EW+ Y RYVN EGVEM  GVYGDN S
Sbjct  61   TPLLPDFADPSMCYLPNSYPSTAYYYGGYDGTGSEWDDYSRYVNPEGVEMTSGVYGDNGS  120

Query  493  LVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAA  663
            L+Y HGYGY PY PYSPA SPVPT+G+DGQLYG Q YQYP PYFQPL  TSGPY P P A
Sbjct  121  LIYHHGYGYAPYAPYSPAGSPVPTMGNDGQLYGPQQYQYP-PYFQPLTPTSGPYTPNPVA  179

Query  664  P  666
            P
Sbjct  180  P  180



>ref|XP_006359197.1| PREDICTED: uncharacterized protein LOC102583016 [Solanum tuberosum]
Length=704

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 127/171 (74%), Gaps = 6/171 (4%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  342
            AA AP ADQ ++LLQ+LSLDS++K LEI +  KK S + TH ANGQ+Q  DRS +P++P+
Sbjct  2    AAGAPPADQAADLLQNLSLDSRSKTLEIADAKKKPSGNPTHGANGQVQSTDRSVTPVLPE  61

Query  343  FMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgyg  516
            FMDP LCY+PN Y       GYD + NEWE Y RY N +GVEMPGVYGDNSSL+Y H YG
Sbjct  62   FMDPNLCYVPNSYTSTAYYYGYDASANEWEDYARYANPDGVEMPGVYGDNSSLIYHHAYG  121

Query  517  ytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQ--PLTSGPYPTPAA  663
            Y PY PYSPATSPVPTVGHDGQLYG+Q Y Y  PYFQ  PLTS    T AA
Sbjct  122  YAPYSPYSPATSPVPTVGHDGQLYGSQQYHY--PYFQPLPLTSTSNTTSAA  170



>ref|XP_007014623.1| Evolutionarily conserved C-terminal region 2 isoform 2 [Theobroma 
cacao]
 gb|EOY32242.1| Evolutionarily conserved C-terminal region 2 isoform 2 [Theobroma 
cacao]
Length=710

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 144/183 (79%), Gaps = 13/183 (7%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  318
            MAA VAP ADQT+ELLQ LSLDSQ K L+IPEPTKK       SVDS +A N QI   +R
Sbjct  1    MAATVAPPADQTAELLQKLSLDSQAKPLDIPEPTKKPSVYQYESVDSGNAGNTQIPSFER  60

Query  319  SFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNS  489
              +PL+PDFMDPT+CYLPNG    YYYGG++GTGN+W+ Y RYVN +GV+M  GVYGDN 
Sbjct  61   CATPLLPDFMDPTMCYLPNGYPSAYYYGGFEGTGNDWDEYSRYVNPDGVDMTSGVYGDNG  120

Query  490  SLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLT--SGPY-PTPA  660
            SL+Y HGYGY PYGPYSPA SPVPTVG+DGQLYG QHYQYP PYFQPLT  +GP+ P PA
Sbjct  121  SLMYHHGYGYAPYGPYSPAGSPVPTVGNDGQLYGPQHYQYP-PYFQPLTPSNGPFTPNPA  179

Query  661  APA  669
            AP+
Sbjct  180  APS  182



>ref|XP_009597413.1| PREDICTED: uncharacterized protein LOC104093384 isoform X1 [Nicotiana 
tomentosiformis]
Length=705

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gypyyyggy  402
            + LEI EP KK SVDS    NGQIQ  +RS +PL+P+F+DP  CYLPN       YY GY
Sbjct  25   RNLEITEPKKKPSVDSKDVGNGQIQSMNRSVTPLLPEFIDPNFCYLPNGYPSTAAYYYGY  84

Query  403  dgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQ  582
            D +GNEWE Y RY+N +GVEMPGVYGDN SL+Y HGYGY PY PYS ATSP PT+GHDGQ
Sbjct  85   DASGNEWEDYSRYLNPDGVEMPGVYGDNGSLIYHHGYGYAPYSPYSRATSPAPTLGHDGQ  144

Query  583  LYGAQHYQYPTPYFQPL--TSGPYPTPAA  663
            LYG+Q Y Y  PYFQPL  TS  Y TP A
Sbjct  145  LYGSQQYHY--PYFQPLPPTSNSYTTPVA  171



>ref|XP_009597421.1| PREDICTED: uncharacterized protein LOC104093384 isoform X2 [Nicotiana 
tomentosiformis]
Length=703

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gypyyyggy  402
            + LEI EP KK SVDS    NGQIQ  +RS +PL+P+F+DP  CYLPN       YY GY
Sbjct  25   RNLEITEPKKKPSVDSKDVGNGQIQSMNRSVTPLLPEFIDPNFCYLPNGYPSTAAYYYGY  84

Query  403  dgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQ  582
            D +GNEWE Y RY+N +GVEMPGVYGDN SL+Y HGYGY PY PYS ATSP PT+GHDGQ
Sbjct  85   DASGNEWEDYSRYLNPDGVEMPGVYGDNGSLIYHHGYGYAPYSPYSRATSPAPTLGHDGQ  144

Query  583  LYGAQHYQYPTPYFQPL--TSGPYPTPAA  663
            LYG+Q Y Y  PYFQPL  TS  Y TP A
Sbjct  145  LYGSQQYHY--PYFQPLPPTSNSYTTPVA  171



>gb|KHN48074.1| YTH domain family protein 2 [Glycine soja]
Length=707

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 122/156 (78%), Gaps = 14/156 (9%)
 Frame = +1

Query  232  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            K LEIPEPTKK       SVDS +AANGQI   DRS +P++ DF+DPT+CYLPN      
Sbjct  25   KPLEIPEPTKKATGNQYGSVDSGNAANGQIPSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  84

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  85   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVP  144

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPA  660
            T+G+DGQLYG QHYQYP PYFQPL  TS P+ PTPA
Sbjct  145  TMGNDGQLYGPQHYQYP-PYFQPLTPTSAPFTPTPA  179



>ref|XP_003531272.1| PREDICTED: uncharacterized protein LOC100819200 isoformX1 [Glycine 
max]
Length=707

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 122/156 (78%), Gaps = 14/156 (9%)
 Frame = +1

Query  232  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            K LEIPEPTKK       SVDS +AANGQI   DRS +P++ DF+DPT+CYLPN      
Sbjct  25   KPLEIPEPTKKATGNQYGSVDSGNAANGQIPSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  84

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  85   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVP  144

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPA  660
            T+G+DGQLYG QHYQYP PYFQPL  TS P+ PTPA
Sbjct  145  TMGNDGQLYGPQHYQYP-PYFQPLTPTSAPFTPTPA  179



>ref|XP_006585211.1| PREDICTED: uncharacterized protein LOC100819200 isoform X2 [Glycine 
max]
Length=709

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 122/156 (78%), Gaps = 14/156 (9%)
 Frame = +1

Query  232  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            K LEIPEPTKK       SVDS +AANGQI   DRS +P++ DF+DPT+CYLPN      
Sbjct  27   KPLEIPEPTKKATGNQYGSVDSGNAANGQIPSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  86

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  87   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVP  146

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPA  660
            T+G+DGQLYG QHYQYP PYFQPL  TS P+ PTPA
Sbjct  147  TMGNDGQLYGPQHYQYP-PYFQPLTPTSAPFTPTPA  181



>ref|XP_006585212.1| PREDICTED: uncharacterized protein LOC100819200 isoform X3 [Glycine 
max]
Length=680

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 122/157 (78%), Gaps = 14/157 (9%)
 Frame = +1

Query  232  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            K LEIPEPTKK       SVDS +AANGQI   DRS +P++ DF+DPT+CYLPN      
Sbjct  27   KPLEIPEPTKKATGNQYGSVDSGNAANGQIPSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  86

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  87   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVP  146

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAA  663
            T+G+DGQLYG QHYQYP PYFQPL  TS P+ PTPA 
Sbjct  147  TMGNDGQLYGPQHYQYP-PYFQPLTPTSAPFTPTPAV  182



>ref|XP_006585213.1| PREDICTED: uncharacterized protein LOC100819200 isoform X4 [Glycine 
max]
Length=678

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 122/156 (78%), Gaps = 14/156 (9%)
 Frame = +1

Query  232  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            K LEIPEPTKK       SVDS +AANGQI   DRS +P++ DF+DPT+CYLPN      
Sbjct  25   KPLEIPEPTKKATGNQYGSVDSGNAANGQIPSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  84

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  85   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVP  144

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPA  660
            T+G+DGQLYG QHYQYP PYFQPL  TS P+ PTPA
Sbjct  145  TMGNDGQLYGPQHYQYP-PYFQPLTPTSAPFTPTPA  179



>ref|XP_002513402.1| yth domain-containing protein, putative [Ricinus communis]
 gb|EEF48805.1| yth domain-containing protein, putative [Ricinus communis]
Length=636

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 143/180 (79%), Gaps = 14/180 (8%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  324
            A VAP+A++T++LLQ+LSLDSQTK LEIPEPTKK SV      DS  +ANGQIQP +RS 
Sbjct  2    ATVAPSAEKTADLLQNLSLDSQTKPLEIPEPTKKTSVYQYGAVDSGVSANGQIQPTERSL  61

Query  325  SPLIPDFMDPTLCYLPNgy---pyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  492
            +P +PD MDPT+CYLPNGY    YYYG Y+GTG+EW+ Y RY N EGVEM  GVYGDN S
Sbjct  62   TPFLPDLMDPTVCYLPNGYPSPAYYYGSYNGTGSEWDDYSRYANTEGVEMTSGVYGDNGS  121

Query  493  LVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPYPTPAAP  666
            +++ +GYGY PYGPYSPA SPVPT+G+DGQLYG QHYQYP PYFQPL  TSGP+ TP  P
Sbjct  122  VMFHNGYGYAPYGPYSPAASPVPTMGNDGQLYGPQHYQYP-PYFQPLNPTSGPF-TPTQP  179



>ref|XP_008351953.1| PREDICTED: uncharacterized protein LOC103415395 [Malus domestica]
Length=633

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 142/181 (78%), Gaps = 15/181 (8%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  324
            A VAP  +Q ++LLQ +SLDSQTK LE PEPTKK       S+DS +AANGQ  P++RS 
Sbjct  2    ATVAPPVEQAADLLQKMSLDSQTKTLEXPEPTKKPSVNQYGSIDSGNAANGQ-XPSERSV  60

Query  325  SPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  492
            +PL+PDF+DP++CYLPN      YYYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN S
Sbjct  61   TPLLPDFVDPSMCYLPNGYPSTAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGS  120

Query  493  LVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAA  663
            L+Y HGYGY PYGPYSPA SPVPT+G+DGQLYG Q YQYP PYFQPL  TSGPY P+PAA
Sbjct  121  LLYHHGYGYAPYGPYSPAGSPVPTMGNDGQLYGPQQYQYP-PYFQPLTPTSGPYTPSPAA  179

Query  664  P  666
            P
Sbjct  180  P  180



>ref|XP_004228948.1| PREDICTED: uncharacterized protein LOC101253713 [Solanum lycopersicum]
Length=706

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 121/159 (76%), Gaps = 4/159 (3%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  342
            AA AP ADQ ++LLQ+LSLDS+ K LEI +  KK S + T  ANGQ+Q ADRS +P++P+
Sbjct  2    AAGAPPADQAADLLQNLSLDSRNKTLEIADTKKKPSGNPTDGANGQLQSADRSVTPVLPE  61

Query  343  FMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgyg  516
            FMDP LCY+PN Y       GYD + NEWE Y RY N +GVEMPGVYGDNSSL+Y H YG
Sbjct  62   FMDPNLCYVPNSYASTAYYYGYDASANEWEDYARYTNPDGVEMPGVYGDNSSLIYHHAYG  121

Query  517  ytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL  633
            Y PY PYSPATSPVPTVGHDGQLYG+Q Y Y  PYFQPL
Sbjct  122  YAPYSPYSPATSPVPTVGHDGQLYGSQQYHY--PYFQPL  158



>ref|XP_009601164.1| PREDICTED: uncharacterized protein LOC104096490, partial [Nicotiana 
tomentosiformis]
Length=709

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 107/149 (72%), Gaps = 7/149 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gypyyyggy  402
            + LEI EP KK SVDS    NGQIQ  +RS +PL+P+F+DP  CYLPN       YY GY
Sbjct  29   RNLEITEPKKKPSVDSKDVGNGQIQSMNRSVTPLLPEFIDPNFCYLPNGYPSTAAYYYGY  88

Query  403  dgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQ  582
            D +GNEWE Y RY+N +GVEM GVYGDN SL+Y HGYGY PY PYS ATSP PT+GHDGQ
Sbjct  89   DASGNEWEDYSRYLNPDGVEMAGVYGDNGSLIYHHGYGYAPYSPYSRATSPAPTLGHDGQ  148

Query  583  LYGAQHYQYPTPYFQPL--TSGPYPTPAA  663
            LYG+Q Y Y  PYFQPL  TS  Y TP A
Sbjct  149  LYGSQQYHY--PYFQPLPPTSNSYTTPVA  175



>ref|XP_009764450.1| PREDICTED: uncharacterized protein LOC104216148 isoform X1 [Nicotiana 
sylvestris]
Length=709

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 110/149 (74%), Gaps = 7/149 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyg---gy  402
            K LEI EP KK SVDS +  NGQ Q  +RS +P++P+F+DP  CYLPNGYP       GY
Sbjct  25   KNLEIAEPKKKPSVDSKNVGNGQNQSMNRSVTPVLPEFIDPNFCYLPNGYPSTAAYYYGY  84

Query  403  dgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQ  582
            D +GNEWE Y RY+N +GVEMPGVYGDN SL+Y HGYGY PY PYSPATSP PT+GHDGQ
Sbjct  85   DASGNEWEDYSRYLNLDGVEMPGVYGDNGSLIYHHGYGYAPYSPYSPATSPAPTLGHDGQ  144

Query  583  LYGAQHYQYPTPYFQPL--TSGPYPTPAA  663
            LYG+Q Y Y  PYFQPL  TS  Y TP A
Sbjct  145  LYGSQQYHY--PYFQPLPPTSNSYTTPVA  171



>gb|EYU32828.1| hypothetical protein MIMGU_mgv1a002229mg [Erythranthe guttata]
 gb|EYU32829.1| hypothetical protein MIMGU_mgv1a002229mg [Erythranthe guttata]
Length=698

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 136/175 (78%), Gaps = 8/175 (5%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  342
            A VAP ADQ ++++Q LSLDSQ K  + P+ T+K SVDS +AANG IQ +DRS +P++ D
Sbjct  2    ATVAPPADQAADIMQKLSLDSQAKTFDAPDATRKPSVDSNNAANGGIQ-SDRSVTPVLTD  60

Query  343  FMDPTLCYLPNgypyy---yggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHg  510
            F DP++ Y+ + YP      GGY+G+ NEWE Y +Y++ +G EM PG+YGDNS L+Y HG
Sbjct  61   FTDPSMYYVQSSYPSAYYYAGGYEGSVNEWEDYAKYMSQDGAEMTPGIYGDNS-LMYHHG  119

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLT--SGPYPTPAAPA  669
            YGY PY PYSPA SPVPTVGHDGQLYGAQHYQYPTPYFQ L+  SGPYPTPAAPA
Sbjct  120  YGYAPYAPYSPAASPVPTVGHDGQLYGAQHYQYPTPYFQSLSPASGPYPTPAAPA  174



>ref|XP_010103094.1| hypothetical protein L484_005073 [Morus notabilis]
 gb|EXB94817.1| hypothetical protein L484_005073 [Morus notabilis]
Length=714

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 122/158 (77%), Gaps = 15/158 (9%)
 Frame = +1

Query  232  KALEIPEPTKKVS------VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            K  EIPEPTKK S      +DS +A NGQI PADRS SPL+PDFMDP++CY+PN      
Sbjct  33   KGAEIPEPTKKQSANQFGSLDSGNAVNGQIPPADRSVSPLLPDFMDPSVCYVPNGYPSTA  92

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYGGYDGTGNEW+ Y RY+N +GVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  93   YYYGGYDGTGNEWDDYSRYMNPDGVEMTSGVYGDNGSLMY-HGYGYAPYGPYSPAASPVP  151

Query  562  TVGHDGQLYGAQHYQYPTPYFQPLT--SGPY-PTPAAP  666
            T+G+DGQLYG QHYQYP PYFQPLT  S PY P+ A P
Sbjct  152  TMGNDGQLYGPQHYQYP-PYFQPLTPSSAPYTPSAAVP  188



>gb|KDP29478.1| hypothetical protein JCGZ_19307 [Jatropha curcas]
Length=688

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 136/174 (78%), Gaps = 13/174 (7%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  324
            AAVAP+ ++ +ELLQ+LS+DSQTK LEIPEPTKK SV      +S  +ANGQI  A+RS 
Sbjct  2    AAVAPSTEKAAELLQTLSIDSQTKTLEIPEPTKKTSVYQYGGVESGVSANGQIPTAERSV  61

Query  325  SPLIPDFMDPTLCYLPNgy---pyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  492
            +P +PD MDP++CYLPN Y    YYYG Y+G+ NEWE Y RY N EGVEM  GVYGDN S
Sbjct  62   TPFLPDLMDPSMCYLPNSYPSPAYYYGSYNGSSNEWEDYSRYANTEGVEMASGVYGDNGS  121

Query  493  LVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLT--SGPY  648
            ++Y +GYGY PYGPYSPATSPVPT+ +DGQLYG QHYQYP PYFQPLT  SGP+
Sbjct  122  VMYHNGYGYAPYGPYSPATSPVPTLVNDGQLYGPQHYQYP-PYFQPLTPNSGPF  174



>ref|XP_007014622.1| Evolutionarily conserved C-terminal region 2 isoform 1 [Theobroma 
cacao]
 gb|EOY32241.1| Evolutionarily conserved C-terminal region 2 isoform 1 [Theobroma 
cacao]
Length=742

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 123/158 (78%), Gaps = 13/158 (8%)
 Frame = +1

Query  232  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNg--ypy  387
            K L+IPEPTKK       SVDS +A N QI   +R  +PL+PDFMDPT+CYLPNG    Y
Sbjct  58   KPLDIPEPTKKPSVYQYESVDSGNAGNTQIPSFERCATPLLPDFMDPTMCYLPNGYPSAY  117

Query  388  yyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPT  564
            YYGG++GTGN+W+ Y RYVN +GV+M  GVYGDN SL+Y HGYGY PYGPYSPA SPVPT
Sbjct  118  YYGGFEGTGNDWDEYSRYVNPDGVDMTSGVYGDNGSLMYHHGYGYAPYGPYSPAGSPVPT  177

Query  565  VGHDGQLYGAQHYQYPTPYFQPLT--SGPY-PTPAAPA  669
            VG+DGQLYG QHYQYP PYFQPLT  +GP+ P PAAP+
Sbjct  178  VGNDGQLYGPQHYQYP-PYFQPLTPSNGPFTPNPAAPS  214



>gb|KHG09343.1| Glutamate receptor [Gossypium arboreum]
Length=416

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 140/183 (77%), Gaps = 13/183 (7%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  318
            MA  VAP ADQT+ELLQ L++DSQ K  +IPEPTKK       SVDS +  N QI   DR
Sbjct  1    MAPTVAPPADQTAELLQKLTIDSQAKPFDIPEPTKKPSVYQYGSVDSGNTGNTQIPTFDR  60

Query  319  SFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNS  489
            S +PL+ DFMDPT+CY+P+G    YYYGG+DGTGNEW+ Y +Y+N +GV+M  GVYGDN 
Sbjct  61   STTPLLQDFMDPTMCYIPSGYPSAYYYGGFDGTGNEWDEYSQYLNPDGVDMTSGVYGDNG  120

Query  490  SLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLT--SGPY-PTPA  660
            SL+Y HGY Y PYGPYSPA SPVPT+G+DGQLYG QHYQYP P+FQP+T  SGP+ P PA
Sbjct  121  SLMYHHGYSYAPYGPYSPAASPVPTLGNDGQLYGPQHYQYP-PFFQPMTLNSGPFTPNPA  179

Query  661  APA  669
            AP+
Sbjct  180  APS  182



>ref|XP_007159551.1| hypothetical protein PHAVU_002G247000g [Phaseolus vulgaris]
 gb|ESW31545.1| hypothetical protein PHAVU_002G247000g [Phaseolus vulgaris]
Length=677

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 120/156 (77%), Gaps = 15/156 (10%)
 Frame = +1

Query  232  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            K LE+PEPTKK       SVDS + ANGQI   +RS +P++ DF+DP +CYLPN      
Sbjct  25   KPLEMPEPTKKATGNQYGSVDSGNGANGQIPSYERSVTPVL-DFIDPAMCYLPNGYPSTA  83

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SLVY HGYGY PYGPYSPA SPVP
Sbjct  84   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLVYHHGYGYAPYGPYSPAGSPVP  143

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPA  660
            T+G+DGQLYG QHYQYP PYFQPL  TS P+ PTPA
Sbjct  144  TMGNDGQLYGPQHYQYP-PYFQPLTPTSAPFTPTPA  178



>ref|XP_011461644.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=772

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 134/189 (71%), Gaps = 14/189 (7%)
 Frame = +1

Query  136  RGSIDRAMAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANG  297
            R S   +  A VAP ADQ ++LLQ LS+DSQTK LEIPEPTKK       S+DS +A NG
Sbjct  57   RSSYQFSAMATVAPPADQAADLLQKLSIDSQTKTLEIPEPTKKPSVNQYGSIDSGNAVNG  116

Query  298  QIQPADRSFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-P  468
            QI P+DRS +PL  DF D +  YLPNG     YY G      +W+ Y RYVN EGV+M  
Sbjct  117  QI-PSDRSVTPLSTDFTDQSFSYLPNGYPSAAYYYGGYDGAGDWDEYSRYVNPEGVDMTS  175

Query  469  GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSG  642
            GVYGDN SL+Y HGYGY PYGPYSPA SPVPT+G+DGQLYG QHYQYP PYFQPL  TSG
Sbjct  176  GVYGDNGSLMYHHGYGYAPYGPYSPAASPVPTMGNDGQLYGPQHYQYP-PYFQPLTPTSG  234

Query  643  PY-PTPAAP  666
            PY P+P AP
Sbjct  235  PYTPSPVAP  243



>ref|XP_011461643.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=773

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 134/189 (71%), Gaps = 14/189 (7%)
 Frame = +1

Query  136  RGSIDRAMAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANG  297
            R S   +  A VAP ADQ ++LLQ LS+DSQTK LEIPEPTKK       S+DS +A NG
Sbjct  57   RSSYQFSAMATVAPPADQAADLLQKLSIDSQTKTLEIPEPTKKPSVNQYGSIDSGNAVNG  116

Query  298  QIQPADRSFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-P  468
            QI P+DRS +PL  DF D +  YLPNG     YY G      +W+ Y RYVN EGV+M  
Sbjct  117  QI-PSDRSVTPLSTDFTDQSFSYLPNGYPSAAYYYGGYDGAGDWDEYSRYVNPEGVDMTS  175

Query  469  GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSG  642
            GVYGDN SL+Y HGYGY PYGPYSPA SPVPT+G+DGQLYG QHYQYP PYFQPL  TSG
Sbjct  176  GVYGDNGSLMYHHGYGYAPYGPYSPAASPVPTMGNDGQLYGPQHYQYP-PYFQPLTPTSG  234

Query  643  PY-PTPAAP  666
            PY P+P AP
Sbjct  235  PYTPSPVAP  243



>gb|EYU39279.1| hypothetical protein MIMGU_mgv1a002515mg [Erythranthe guttata]
Length=665

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 113/149 (76%), Gaps = 8/149 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  411
            K  E  + TKK SVDS++ ANG +Q +DRS +PL+PDF DP+  Y PN YP     Y G 
Sbjct  24   KTYENQDATKKPSVDSSNVANG-VQ-SDRSITPLLPDFTDPSTGYHPNSYPSPAYYYSG-  80

Query  412  gNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLY  588
             N+WE YPRY+NA+GV+M PG YGDN S++Y HGYGYTPY PYSPA SPVPT+GHDGQLY
Sbjct  81   -NDWEDYPRYMNADGVDMTPGAYGDNGSIMY-HGYGYTPYPPYSPAASPVPTLGHDGQLY  138

Query  589  GAQHYQYPTPYFQPL--TSGPYPTPAAPA  669
            G+QHYQYPTPYFQ L  TSGPYPT A  A
Sbjct  139  GSQHYQYPTPYFQSLTQTSGPYPTQAGSA  167



>gb|KJB21909.1| hypothetical protein B456_004G020600 [Gossypium raimondii]
Length=583

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 139/183 (76%), Gaps = 13/183 (7%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  318
            MA  VAP ADQT+ELLQ L++DSQ K  +IPEPTKK       SVDS +  N QI   DR
Sbjct  1    MAPTVAPPADQTAELLQKLTIDSQAKPFDIPEPTKKPSVYQYGSVDSGNTGNTQIPTFDR  60

Query  319  SFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNS  489
            S +PL+ DFMDP +CY+P+G    YYYGG+DGTGNEW+ Y +Y+N +GV+M  GVYGDN 
Sbjct  61   STTPLLQDFMDPNMCYIPSGYPSAYYYGGFDGTGNEWDEYSQYLNPDGVDMTSGVYGDNG  120

Query  490  SLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP--LTSGPY-PTPA  660
            SL+Y HGY Y PYGPYSPA SPVPT+G+DGQLYG QHYQYP P+FQP  LTSGP+ P PA
Sbjct  121  SLMYHHGYSYAPYGPYSPAASPVPTLGNDGQLYGPQHYQYP-PFFQPMTLTSGPFTPNPA  179

Query  661  APA  669
            AP+
Sbjct  180  APS  182



>ref|XP_004504214.1| PREDICTED: YTH domain family protein 2-like isoform X3 [Cicer 
arietinum]
Length=677

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 118/155 (76%), Gaps = 13/155 (8%)
 Frame = +1

Query  232  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNg--ypy  387
            KALEIPEP KK       +VDS + ANGQI   +RS +P++ DFMDPT+CYLPNG     
Sbjct  25   KALEIPEPNKKPTGNQYGTVDSGNHANGQIPSYERSITPVLQDFMDPTMCYLPNGYPSTA  84

Query  388  yyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPT  564
            YY GYDGTGN+WE Y RY+N E V+M  GVYGDN SL+Y HGYGY PYGPYSPA SPVPT
Sbjct  85   YYYGYDGTGNDWEDYSRYLNPEAVDMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVPT  144

Query  565  VGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPA  660
            +G+DGQ+Y  QHYQYP PYFQPL  TSGP+ PTPA
Sbjct  145  MGNDGQMYAPQHYQYP-PYFQPLTPTSGPFTPTPA  178



>ref|XP_004504212.1| PREDICTED: YTH domain family protein 2-like isoform X1 [Cicer 
arietinum]
Length=685

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 118/156 (76%), Gaps = 14/156 (9%)
 Frame = +1

Query  232  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            KALEIPEP KK       +VDS + ANGQI   +RS +P++ DFMDPT+CYLPN      
Sbjct  25   KALEIPEPNKKPTGNQYGTVDSGNHANGQIPSYERSITPVLQDFMDPTMCYLPNGYPSTA  84

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYG YDGTGN+WE Y RY+N E V+M  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  85   YYYGSYDGTGNDWEDYSRYLNPEAVDMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVP  144

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPA  660
            T+G+DGQ+Y  QHYQYP PYFQPL  TSGP+ PTPA
Sbjct  145  TMGNDGQMYAPQHYQYP-PYFQPLTPTSGPFTPTPA  179



>ref|XP_004504213.1| PREDICTED: YTH domain family protein 2-like isoform X2 [Cicer 
arietinum]
Length=678

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 118/156 (76%), Gaps = 14/156 (9%)
 Frame = +1

Query  232  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            KALEIPEP KK       +VDS + ANGQI   +RS +P++ DFMDPT+CYLPN      
Sbjct  25   KALEIPEPNKKPTGNQYGTVDSGNHANGQIPSYERSITPVLQDFMDPTMCYLPNGYPSTA  84

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYG YDGTGN+WE Y RY+N E V+M  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  85   YYYGSYDGTGNDWEDYSRYLNPEAVDMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVP  144

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPA  660
            T+G+DGQ+Y  QHYQYP PYFQPL  TSGP+ PTPA
Sbjct  145  TMGNDGQMYAPQHYQYP-PYFQPLTPTSGPFTPTPA  179



>gb|KJB21907.1| hypothetical protein B456_004G020600 [Gossypium raimondii]
Length=656

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 139/183 (76%), Gaps = 13/183 (7%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  318
            MA  VAP ADQT+ELLQ L++DSQ K  +IPEPTKK       SVDS +  N QI   DR
Sbjct  1    MAPTVAPPADQTAELLQKLTIDSQAKPFDIPEPTKKPSVYQYGSVDSGNTGNTQIPTFDR  60

Query  319  SFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNS  489
            S +PL+ DFMDP +CY+P+G    YYYGG+DGTGNEW+ Y +Y+N +GV+M  GVYGDN 
Sbjct  61   STTPLLQDFMDPNMCYIPSGYPSAYYYGGFDGTGNEWDEYSQYLNPDGVDMTSGVYGDNG  120

Query  490  SLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP--LTSGPY-PTPA  660
            SL+Y HGY Y PYGPYSPA SPVPT+G+DGQLYG QHYQYP P+FQP  LTSGP+ P PA
Sbjct  121  SLMYHHGYSYAPYGPYSPAASPVPTLGNDGQLYGPQHYQYP-PFFQPMTLTSGPFTPNPA  179

Query  661  APA  669
            AP+
Sbjct  180  APS  182



>gb|KJB21908.1| hypothetical protein B456_004G020600 [Gossypium raimondii]
Length=670

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 139/183 (76%), Gaps = 13/183 (7%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  318
            MA  VAP ADQT+ELLQ L++DSQ K  +IPEPTKK       SVDS +  N QI   DR
Sbjct  1    MAPTVAPPADQTAELLQKLTIDSQAKPFDIPEPTKKPSVYQYGSVDSGNTGNTQIPTFDR  60

Query  319  SFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNS  489
            S +PL+ DFMDP +CY+P+G    YYYGG+DGTGNEW+ Y +Y+N +GV+M  GVYGDN 
Sbjct  61   STTPLLQDFMDPNMCYIPSGYPSAYYYGGFDGTGNEWDEYSQYLNPDGVDMTSGVYGDNG  120

Query  490  SLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP--LTSGPY-PTPA  660
            SL+Y HGY Y PYGPYSPA SPVPT+G+DGQLYG QHYQYP P+FQP  LTSGP+ P PA
Sbjct  121  SLMYHHGYSYAPYGPYSPAASPVPTLGNDGQLYGPQHYQYP-PFFQPMTLTSGPFTPNPA  179

Query  661  APA  669
            AP+
Sbjct  180  APS  182



>ref|XP_009376095.1| PREDICTED: uncharacterized protein LOC103964826 isoform X2 [Pyrus 
x bretschneideri]
Length=686

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 133/175 (76%), Gaps = 21/175 (12%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  342
            A VAP  +Q ++LLQ +SLDSQTK LEIPEPTKK+             P++RS +PL+ D
Sbjct  2    ATVAPPVEQAADLLQKMSLDSQTKTLEIPEPTKKI-------------PSERSVTPLLSD  48

Query  343  FMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHg  510
            F+DP++CYLPN      YYYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN SL+Y HG
Sbjct  49   FVDPSMCYLPNGYPSTAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGSLLYHHG  108

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAAP  666
            YGY PYGPYSPA SPVPT+G+DGQLYG Q YQYP PYFQPL  TSGPY P+PAAP
Sbjct  109  YGYAPYGPYSPAGSPVPTMGNDGQLYGPQQYQYP-PYFQPLTPTSGPYTPSPAAP  162



>gb|KDP23024.1| hypothetical protein JCGZ_01687 [Jatropha curcas]
Length=689

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 134/174 (77%), Gaps = 13/174 (7%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  324
            A VAP+ ++ +ELLQ+LSLD+QTK LEIPEPTKK SV      +S  +ANGQI  A+RS 
Sbjct  2    ATVAPSTEEAAELLQTLSLDTQTKTLEIPEPTKKTSVYQYGGVESGVSANGQIPSAERSV  61

Query  325  SPLIPDFMDPTLCYLPNgypy---yyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  492
            +P +PD MDPT+CYLPNGY     YYG Y+G+G EW+ Y RY N +GVEM  GVY DN S
Sbjct  62   TPFLPDLMDPTMCYLPNGYASPAYYYGSYNGSGTEWDDYSRYANTDGVEMASGVYPDNGS  121

Query  493  LVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLT--SGPY  648
            ++Y +GYGY PYGPYSPATSPVPT+ +DGQLYG QHYQYP PYFQPLT  SGP+
Sbjct  122  VMYHNGYGYAPYGPYSPATSPVPTLVNDGQLYGPQHYQYP-PYFQPLTPNSGPF  174



>ref|XP_004506479.1| PREDICTED: uncharacterized protein LOC101499095 [Cicer arietinum]
Length=252

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 114/157 (73%), Gaps = 14/157 (9%)
 Frame = +1

Query  232  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  384
            KALEIPEP KK       +VDS   ANGQI   +RS +P++ DFMDPT+CYLPN      
Sbjct  25   KALEIPEPNKKPRGNQYGTVDSGIHANGQIPSYERSITPVLQDFMDPTMCYLPNGYPSTA  84

Query  385  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVP  561
            YYYG Y GTGN+ + Y RY+N E V M  GVYGDN SL+Y HGYGY PYGPYSPA SPVP
Sbjct  85   YYYGAYGGTGNDSDDYSRYLNPEAVNMTSGVYGDNGSLLYHHGYGYAPYGPYSPAGSPVP  144

Query  562  TVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAA  663
            T+G+DGQ+Y  QHYQYP PYFQPL  TSGP+ PTPA 
Sbjct  145  TMGNDGQMYVPQHYQYP-PYFQPLTPTSGPFTPTPAV  180



>ref|XP_011025120.1| PREDICTED: uncharacterized protein LOC105126076 [Populus euphratica]
Length=619

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 97/136 (71%), Gaps = 13/136 (10%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  411
            K LE+PEPT K            IQP+DRS +P++  FMDPT+CYLPNGY  YY G    
Sbjct  25   KTLEMPEPTSK------------IQPSDRSVTPVLSSFMDPTVCYLPNGYQSYYYGGYNG  72

Query  412  gNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLY  588
              EW+ Y +Y+NAEGV+M  GVYGDN S +Y HGY Y PY PYSPA SPVPT+G+DGQLY
Sbjct  73   AGEWDDYSKYLNAEGVDMVSGVYGDNGSAMYPHGYWYGPYSPYSPAASPVPTMGNDGQLY  132

Query  589  GAQHYQYPTPYFQPLT  636
            G QHYQYP PYFQPLT
Sbjct  133  GPQHYQYPPPYFQPLT  148



>ref|XP_002304850.2| hypothetical protein POPTR_0003s20840g [Populus trichocarpa]
 gb|EEE79829.2| hypothetical protein POPTR_0003s20840g [Populus trichocarpa]
Length=619

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 97/136 (71%), Gaps = 13/136 (10%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  411
            K LE+PEPT K            IQP+DRS +P++ +FMDPT+CYLPNGY  YY G    
Sbjct  25   KTLEMPEPTSK------------IQPSDRSVTPVLSNFMDPTVCYLPNGYQSYYYGGYNG  72

Query  412  gNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLY  588
              EW+ Y +Y+N EGV+M  GVYGDN S +Y HGY Y PY PYSPA SPVPT+G+DGQLY
Sbjct  73   AGEWDDYSKYLNPEGVDMVSGVYGDNGSAMYPHGYWYGPYSPYSPAASPVPTMGNDGQLY  132

Query  589  GAQHYQYPTPYFQPLT  636
            G QHYQYP PYFQPLT
Sbjct  133  GPQHYQYPPPYFQPLT  148



>ref|XP_003629923.1| YTH domain family protein [Medicago truncatula]
Length=677

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 135/176 (77%), Gaps = 14/176 (8%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS---VDSTHAANGQIQPADRSFSPL  333
            AAVA  ADQ +ELLQ  SL+SQ K+LEIPEP KK +    DS +A NGQI   +RS +P+
Sbjct  2    AAVANPADQAAELLQKFSLESQPKSLEIPEPNKKATGNQYDSGNALNGQIPSYERSVTPV  61

Query  334  IPDFMDPTLCYLPN-gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDN-SSLVYQ  504
            + DFMDP +CYLPN    YYYGGYDGTG+EWE    Y+NA+GV++  GVYGDN SSLVY 
Sbjct  62   LQDFMDPAMCYLPNGYPSYYYGGYDGTGSEWE----YLNADGVDLTSGVYGDNGSSLVYH  117

Query  505  HgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAA  663
            HGYGY PY PYSPA SPVPT+G+DGQLYG QHYQYP P+FQPL  TSGP+ PT AA
Sbjct  118  HGYGYAPYAPYSPAGSPVPTMGNDGQLYGPQHYQYP-PFFQPLTPTSGPFTPTSAA  172



>gb|AET04399.2| evolutionarily carboxy-terminal region protein [Medicago truncatula]
Length=670

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 118/153 (77%), Gaps = 14/153 (9%)
 Frame = +1

Query  232  KALEIPEPTKKVS---VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN-gypyyygg  399
            K+LEIPEP KK +    DS +A NGQI   +RS +P++ DFMDP +CYLPN    YYYGG
Sbjct  25   KSLEIPEPNKKATGNQYDSGNALNGQIPSYERSVTPVLQDFMDPAMCYLPNGYPSYYYGG  84

Query  400  ydgtgNEWEGYPRYVNAEGVEM-PGVYGDN-SSLVYQHgygytpygpyspatspVPTVGH  573
            YDGTG+EWE    Y+NA+GV++  GVYGDN SSLVY HGYGY PY PYSPA SPVPT+G+
Sbjct  85   YDGTGSEWE----YLNADGVDLTSGVYGDNGSSLVYHHGYGYAPYAPYSPAGSPVPTMGN  140

Query  574  DGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAA  663
            DGQLYG QHYQYP P+FQPL  TSGP+ PT AA
Sbjct  141  DGQLYGPQHYQYP-PFFQPLTPTSGPFTPTSAA  172



>ref|XP_008812836.1| PREDICTED: YTH domain-containing family protein 2-like [Phoenix 
dactylifera]
Length=702

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 129/177 (73%), Gaps = 14/177 (8%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQP-----ADRSFS  327
            AAVAP +DQ ++LLQ LSLDSQ K  +  E TKK S     +ANG   P     ++RS +
Sbjct  2    AAVAPASDQAADLLQKLSLDSQAKNHDAVEATKKPSAVQFGSANGGEVPNVPIPSERSLT  61

Query  328  PLIPDFMDPTLCYLPNgypyyyggydgtgNEW-EGYPRYVNAEGVEMP-GVYGDNSSLVY  501
            P++PDFMDP++CYLP+GYPYYYGGYDG+ NEW + YPRYVN +GVEMP GVYGD    +Y
Sbjct  62   PILPDFMDPSMCYLPSGYPYYYGGYDGSVNEWGDDYPRYVNHDGVEMPPGVYGD----MY  117

Query  502  QHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP--LTSGPYPTPAAP  666
             HGYGY P+G Y    SPVPT+GHDGQLYG QHYQYPTP+FQP  LT  P+ TP  P
Sbjct  118  HHGYGYAPFGAYPSPGSPVPTMGHDGQLYGPQHYQYPTPFFQPPTLTGAPH-TPNQP  173



>gb|KDO54489.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=509

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 126/170 (74%), Gaps = 13/170 (8%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  315
            MA  VAP  ++ S+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAPAVEKASDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  59

Query  316  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  60   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  119

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL  633
            N SL+Y HGYGY PY PYSPATSPVPT+G DGQLYG QHYQYP  YFQP+
Sbjct  120  NGSLMYHHGYGYAPYPPYSPATSPVPTMGTDGQLYGPQHYQYPH-YFQPI  168



>ref|XP_010932747.1| PREDICTED: YTH domain-containing family protein 1-like [Elaeis 
guineensis]
Length=701

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 128/178 (72%), Gaps = 16/178 (9%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK---VSVDSTHAA---NGQIQPADRSF  324
            AAVAP +DQ ++LLQ LSLDSQ K  +  E TKK   +   S H     N  I P++RS 
Sbjct  2    AAVAPASDQAADLLQKLSLDSQAKTHDAVEATKKPPAIQFGSAHGGEVPNVSI-PSERSL  60

Query  325  SPLIPDFMDPTLCYLPNgypyyyggydgtgNEW-EGYPRYVNAEGVEMP-GVYGDNSSLV  498
            +P++PDFMDP++CYLP+GYPYYYGGYDG+ NEW + YPRYVN +GVEMP GVYGD    +
Sbjct  61   TPVLPDFMDPSMCYLPSGYPYYYGGYDGSVNEWGDDYPRYVNHDGVEMPPGVYGD----M  116

Query  499  YQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP--LTSGPYPTPAAP  666
            Y HGYGY P+G Y    S VPT+GHDGQLYG QHYQYPTP+FQP  LT  P+ TP  P
Sbjct  117  YHHGYGYAPFGAYPSPGSSVPTMGHDGQLYGPQHYQYPTPFFQPPTLTGAPH-TPNQP  173



>ref|XP_004144062.1| PREDICTED: uncharacterized protein LOC101215929 [Cucumis sativus]
 ref|XP_004159352.1| PREDICTED: uncharacterized LOC101215929 [Cucumis sativus]
Length=704

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 113/143 (79%), Gaps = 10/143 (7%)
 Frame = +1

Query  232  KALEIPEPTKKVS------VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgy-pyy  390
            K +EIPEPTKK S      +DS +AA  QI P +RS +P + +FMDP++CYLPNGY  YY
Sbjct  27   KPVEIPEPTKKQSANQYGSIDSGNAAISQI-PNERSVTPFLQEFMDPSMCYLPNGYPSYY  85

Query  391  yggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTV  567
            YGG+DGT N+W+ Y RY N++GVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP++
Sbjct  86   YGGFDGTANDWDDYSRYTNSDGVEMTSGVYGDNGSLMYHHGYGYGPYGPYSPAASPVPSM  145

Query  568  GHDGQLYGAQHYQYPTPYFQPLT  636
            G+DGQLYG QHYQYP PYFQPLT
Sbjct  146  GNDGQLYGPQHYQYP-PYFQPLT  167



>ref|XP_008451001.1| PREDICTED: uncharacterized protein LOC103492414 isoform X1 [Cucumis 
melo]
Length=704

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 113/143 (79%), Gaps = 10/143 (7%)
 Frame = +1

Query  232  KALEIPEPTKKVS------VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgy-pyy  390
            K +EIPEPTKK S      +DS +AA  QI P +RS +P + +FMDP++CYLPNGY  YY
Sbjct  27   KPVEIPEPTKKQSANQYGSIDSGNAAISQI-PNERSVTPFLQEFMDPSMCYLPNGYPSYY  85

Query  391  yggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTV  567
            YGG+DGT N+W+ Y RY N++GVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP++
Sbjct  86   YGGFDGTANDWDDYSRYTNSDGVEMTSGVYGDNGSLMYHHGYGYGPYGPYSPAASPVPSM  145

Query  568  GHDGQLYGAQHYQYPTPYFQPLT  636
            G+DGQLYG QHYQYP PYFQPLT
Sbjct  146  GNDGQLYGPQHYQYP-PYFQPLT  167



>ref|XP_008451002.1| PREDICTED: uncharacterized protein LOC103492414 isoform X2 [Cucumis 
melo]
Length=703

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 113/143 (79%), Gaps = 10/143 (7%)
 Frame = +1

Query  232  KALEIPEPTKKVS------VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgy-pyy  390
            K +EIPEPTKK S      +DS +AA  QI P +RS +P + +FMDP++CYLPNGY  YY
Sbjct  27   KPVEIPEPTKKQSANQYGSIDSGNAAISQI-PNERSVTPFLQEFMDPSMCYLPNGYPSYY  85

Query  391  yggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTV  567
            YGG+DGT N+W+ Y RY N++GVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP++
Sbjct  86   YGGFDGTANDWDDYSRYTNSDGVEMTSGVYGDNGSLMYHHGYGYGPYGPYSPAASPVPSM  145

Query  568  GHDGQLYGAQHYQYPTPYFQPLT  636
            G+DGQLYG QHYQYP PYFQPLT
Sbjct  146  GNDGQLYGPQHYQYP-PYFQPLT  167



>gb|KDO54494.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=591

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 126/170 (74%), Gaps = 13/170 (8%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  315
            MA  VAP  ++ S+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAPAVEKASDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  59

Query  316  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  60   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  119

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL  633
            N SL+Y HGYGY PY PYSPATSPVPT+G DGQLYG QHYQYP  YFQP+
Sbjct  120  NGSLMYHHGYGYAPYPPYSPATSPVPTMGTDGQLYGPQHYQYPH-YFQPI  168



>gb|KDO54493.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=638

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 126/170 (74%), Gaps = 13/170 (8%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  315
            MA  VAP  ++ S+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAPAVEKASDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  59

Query  316  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  60   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  119

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL  633
            N SL+Y HGYGY PY PYSPATSPVPT+G DGQLYG QHYQYP  YFQP+
Sbjct  120  NGSLMYHHGYGYAPYPPYSPATSPVPTMGTDGQLYGPQHYQYPH-YFQPI  168



>ref|XP_006445566.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 ref|XP_006488953.1| PREDICTED: uncharacterized protein LOC102626352 isoform X1 [Citrus 
sinensis]
 gb|ESR58806.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 gb|KDO54487.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
 gb|KDO54488.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=711

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 126/170 (74%), Gaps = 13/170 (8%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  315
            MA  VAP  ++ S+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAPAVEKASDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  59

Query  316  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  60   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  119

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL  633
            N SL+Y HGYGY PY PYSPATSPVPT+G DGQLYG QHYQYP  YFQP+
Sbjct  120  NGSLMYHHGYGYAPYPPYSPATSPVPTMGTDGQLYGPQHYQYPH-YFQPI  168



>ref|XP_010257810.1| PREDICTED: YTH domain-containing family protein 2-like [Nelumbo 
nucifera]
Length=532

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 122/161 (76%), Gaps = 10/161 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  324
            AAVAP ADQ ++LLQ LS+DSQT  +E+PE TKK       SV++  A NG +Q  +RS 
Sbjct  2    AAVAPPADQAADLLQKLSIDSQTNNIEVPEATKKPSTIQYGSVEAAEAHNGPVQSFERST  61

Query  325  SPLIPDFMDPTLCYLPNgypyyy---ggydgtgNEWEGYPRYVNAEGVEMP-GVYGDNSS  492
            +PL+ DFMDP++CYLPNGY       GGYDG  NEW+ YPRYVN +GVEMP GVYGDN S
Sbjct  62   TPLLQDFMDPSMCYLPNGYASTAYYYGGYDGHINEWDDYPRYVNPDGVEMPTGVYGDNGS  121

Query  493  LVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPT  615
            L+Y HGYGY PYG YSPA SPVPT+GHDGQLYG QHYQYP+
Sbjct  122  LMYHHGYGYAPYGAYSPAGSPVPTMGHDGQLYGPQHYQYPS  162



>ref|XP_010917720.1| PREDICTED: uncharacterized protein LOC105042282 [Elaeis guineensis]
Length=695

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 119/163 (73%), Gaps = 10/163 (6%)
 Frame = +1

Query  166  AVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQI----QPADRSFSPL  333
            AVAPT DQ S+LLQ LS+DSQ K     E TKK S     +ANG++     P+ RS +PL
Sbjct  3    AVAPTTDQASDLLQKLSMDSQAKTNGAMEATKKPSAIQFGSANGEVPNMLIPSQRSLTPL  62

Query  334  IPDFMDPTLCYLPNgypyyyggydgtgNEW-EGYPRYVNAEGVEMP-GVYGDNSSLVYQH  507
            +PDFMDP++CY PNGYP+YYGG+DG+ NEW + Y RY+N +GVEMP G YGD    +Y H
Sbjct  63   LPDFMDPSMCYFPNGYPFYYGGFDGSVNEWGDDYSRYLNQDGVEMPPGFYGD----MYHH  118

Query  508  gygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLT  636
            GYGY PYG Y    SPVPT+GHDGQ YG QHYQYPTP+FQPLT
Sbjct  119  GYGYAPYGAYPSPGSPVPTIGHDGQPYGPQHYQYPTPFFQPLT  161



>ref|XP_011048156.1| PREDICTED: uncharacterized protein LOC105142292 isoform X1 [Populus 
euphratica]
Length=614

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 103/149 (69%), Gaps = 18/149 (12%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  411
            K LE+PEPT K            IQP+DRS +P++ +FMDPT+CYLPNGYP YY G    
Sbjct  25   KTLEMPEPTNK------------IQPSDRSVTPVLSNFMDPTVCYLPNGYPSYYYGGYNG  72

Query  412  gNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYG  591
              EW+ Y +Y+N EGV+M      N S +Y HGY Y PYGPYSPA SPVPT+G+DGQLYG
Sbjct  73   TGEWDDYSKYLNTEGVDMT---SGNGSAMYPHGYWYGPYGPYSPAASPVPTMGNDGQLYG  129

Query  592  AQHYQYPTPYFQPL--TSGPY-PTPAAPA  669
             QHYQYPTPYFQPL  TS P+ P+  AP+
Sbjct  130  PQHYQYPTPYFQPLTPTSEPFIPSHVAPS  158



>ref|XP_010257809.1| PREDICTED: YTH domain-containing family protein 1-like [Nelumbo 
nucifera]
Length=588

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 121/161 (75%), Gaps = 10/161 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  324
            AAVAP ADQ ++LLQ LS+DSQTK +E+PE TKK       SV++  A NG +Q  +RS 
Sbjct  2    AAVAPPADQAADLLQKLSIDSQTKNIEVPEATKKPFTIQYGSVETAEAPNGPVQSCERST  61

Query  325  SPLIPDFMDPTLCYLPNgypyyy---ggydgtgNEWEGYPRYVNAEGVEMP-GVYGDNSS  492
            +PL+ DFMDP++CYLPNGY       GGYDG  NEW+ YPR+VN +GVEM  GVYGDN S
Sbjct  62   TPLLQDFMDPSMCYLPNGYASTAYYYGGYDGHINEWDDYPRFVNPDGVEMSTGVYGDNGS  121

Query  493  LVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPT  615
            L+Y HGYGY PYG Y PA SPVPT+GHDGQLYG QHYQYP+
Sbjct  122  LIYHHGYGYAPYGAYPPAGSPVPTMGHDGQLYGPQHYQYPS  162



>ref|XP_002299095.2| hypothetical protein POPTR_0001s039401g, partial [Populus trichocarpa]
 gb|EEE83900.2| hypothetical protein POPTR_0001s039401g, partial [Populus trichocarpa]
Length=549

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 103/149 (69%), Gaps = 18/149 (12%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  411
            K L++PEPT K            IQP+DRS +P++ +FMDPT+CYLPNGYP YY G    
Sbjct  25   KTLDMPEPTNK------------IQPSDRSVTPVLSNFMDPTVCYLPNGYPSYYYGGYNG  72

Query  412  gNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYG  591
              EW+ Y +Y+N EGV+M      N S +Y HGY Y PYGPYSPA SPVPT+G+DGQLYG
Sbjct  73   TGEWDDYSKYLNTEGVDMT---SGNGSAMYPHGYWYGPYGPYSPAASPVPTMGNDGQLYG  129

Query  592  AQHYQYPTPYFQPL--TSGPY-PTPAAPA  669
             QHYQYPTPYFQPL  TS P+ P+  AP+
Sbjct  130  PQHYQYPTPYFQPLTPTSEPFIPSHVAPS  158



>gb|ABK96645.1| unknown [Populus trichocarpa x Populus deltoides]
Length=615

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 103/149 (69%), Gaps = 18/149 (12%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  411
            K L++PEPT K            IQP+DRS +P++ +FMDPT+CYLPNGYP YY G    
Sbjct  25   KTLDMPEPTNK------------IQPSDRSVTPVLSNFMDPTVCYLPNGYPSYYYGGYNG  72

Query  412  gNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYG  591
              EW+ Y +Y+N EGV+M      N S +Y HGY Y PYGPYSPA SPVPT+G+DGQLYG
Sbjct  73   TGEWDDYSKYLNTEGVDMT---SGNGSAMYPHGYWYGPYGPYSPAASPVPTMGNDGQLYG  129

Query  592  AQHYQYPTPYFQPL--TSGPY-PTPAAPA  669
             QHYQYPTPYFQPL  TS P+ P+  AP+
Sbjct  130  PQHYQYPTPYFQPLTPTSEPFIPSHVAPS  158



>gb|KDO54495.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=585

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 127/170 (75%), Gaps = 14/170 (8%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  315
            MA  VAP A +TS+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAP-AVETSDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  58

Query  316  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  59   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  118

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL  633
            N SL+Y HGYGY PY PYSPATSPVPT+G DGQLYG QHYQYP  YFQP+
Sbjct  119  NGSLMYHHGYGYAPYPPYSPATSPVPTMGTDGQLYGPQHYQYPH-YFQPI  167



>ref|XP_006488954.1| PREDICTED: uncharacterized protein LOC102626352 isoform X2 [Citrus 
sinensis]
 gb|KDO54491.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=710

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 127/170 (75%), Gaps = 14/170 (8%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  315
            MA  VAP A +TS+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAP-AVETSDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  58

Query  316  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  59   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  118

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL  633
            N SL+Y HGYGY PY PYSPATSPVPT+G DGQLYG QHYQYP  YFQP+
Sbjct  119  NGSLMYHHGYGYAPYPPYSPATSPVPTMGTDGQLYGPQHYQYPH-YFQPI  167



>gb|KDO54492.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=708

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 107/145 (74%), Gaps = 13/145 (9%)
 Frame = +1

Query  232  KALEIPEPTKK------VSVDSTHAA-NGQIQPADRSFSPLIPDFMDPTLCYLPN---gy  381
            K+LEI E TKK       SVDS +AA NGQI P++RS +P + DFMDP +CY+PN     
Sbjct  23   KSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSERSGTPFLNDFMDPNMCYVPNGYPST  81

Query  382  pyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspV  558
             +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGDN SL+Y HGYGY PY PYSPATSPV
Sbjct  82   AFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGDNGSLMYHHGYGYAPYPPYSPATSPV  141

Query  559  PTVGHDGQLYGAQHYQYPTPYFQPL  633
            PT+G DGQLYG QHYQYP  YFQP+
Sbjct  142  PTMGTDGQLYGPQHYQYPH-YFQPI  165



>gb|KDO54490.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=710

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 126/170 (74%), Gaps = 14/170 (8%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  315
            MA  VAP A +TS+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAP-AVETSDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  58

Query  316  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEMPGV-YGD  483
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  V YGD
Sbjct  59   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSVMYGD  118

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL  633
            N SL+Y HGYGY PY PYSPATSPVPT+G DGQLYG QHYQYP  YFQP+
Sbjct  119  NGSLMYHHGYGYAPYPPYSPATSPVPTMGTDGQLYGPQHYQYPH-YFQPI  167



>ref|XP_011048157.1| PREDICTED: uncharacterized protein LOC105142292 isoform X2 [Populus 
euphratica]
Length=612

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 101/149 (68%), Gaps = 20/149 (13%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  411
            K LE+PEPT K              P+DRS +P++ +FMDPT+CYLPNGYP YY G    
Sbjct  25   KTLEMPEPTNK--------------PSDRSVTPVLSNFMDPTVCYLPNGYPSYYYGGYNG  70

Query  412  gNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYG  591
              EW+ Y +Y+N EGV+M      N S +Y HGY Y PYGPYSPA SPVPT+G+DGQLYG
Sbjct  71   TGEWDDYSKYLNTEGVDMT---SGNGSAMYPHGYWYGPYGPYSPAASPVPTMGNDGQLYG  127

Query  592  AQHYQYPTPYFQPL--TSGPY-PTPAAPA  669
             QHYQYPTPYFQPL  TS P+ P+  AP+
Sbjct  128  PQHYQYPTPYFQPLTPTSEPFIPSHVAPS  156



>ref|XP_008779460.1| PREDICTED: YTH domain-containing family protein 1-like isoform 
X1 [Phoenix dactylifera]
Length=700

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 116/157 (74%), Gaps = 10/157 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQI----QPADRSFSP  330
            AAVAPTADQ ++LLQ LS+DSQ K  +  E TKK S      ANG++     P++RS +P
Sbjct  2    AAVAPTADQAADLLQKLSMDSQAKTNDAVEATKKPSAIQFGPANGEVPNMLIPSERSLTP  61

Query  331  LIPDFMDPTLCYLPNgypyyyggydgtgNEW-EGYPRYVNAEGVEMP-GVYGDNSSLVYQ  504
            L+PDFMDP++CYLPNGYPYYYGG+DG+ NEW + Y RY+N +GVEMP G YGD    +Y 
Sbjct  62   LLPDFMDPSMCYLPNGYPYYYGGFDGSVNEWGDDYSRYLNHDGVEMPPGFYGD----MYH  117

Query  505  HgygytpygpyspatspVPTVGHDGQLYGAQHYQYPT  615
            HGYGY PYG Y    SPVPT+GHDGQ YG QHYQYPT
Sbjct  118  HGYGYAPYGAYPSPGSPVPTIGHDGQPYGPQHYQYPT  154



>ref|XP_010552316.1| PREDICTED: uncharacterized protein LOC104822698 isoform X4 [Tarenaya 
hassleriana]
Length=677

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 117/174 (67%), Gaps = 9/174 (5%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  336
            A +AP ADQ ++LLQ LSLDSQ KALEIPEPTK  +V    A  +NGQ+   DRS +PL+
Sbjct  2    ATIAPPADQATDLLQKLSLDSQAKALEIPEPTKNTAVYQYAAVDSNGQVPSYDRSLTPLL  61

Query  337  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM--PGVYGDNSSLVYQH  507
            P D +DP++CY+PN Y  YY G  G G+EW  Y  Y N +GV+M  PG+YG+N S+VY  
Sbjct  62   PSDALDPSVCYVPNAYQPYYFGGYGNGHEWGEYTGYTNPDGVDMTSPGIYGENGSVVYPQ  121

Query  508  gygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAAPA  669
                    PYSPATSP PTVG DGQ++GAQ YQYP   F PL++G   + AA +
Sbjct  122  -GFGYAAYPYSPATSPAPTVGSDGQMFGAQQYQYP---FFPLSTGFASSVAAAS  171



>ref|XP_010552315.1| PREDICTED: uncharacterized protein LOC104822698 isoform X3 [Tarenaya 
hassleriana]
Length=678

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 117/174 (67%), Gaps = 9/174 (5%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  336
            A +AP ADQ ++LLQ LSLDSQ KALEIPEPTK  +V    A  +NGQ+   DRS +PL+
Sbjct  2    ATIAPPADQATDLLQKLSLDSQAKALEIPEPTKNTAVYQYAAVDSNGQVPSYDRSLTPLL  61

Query  337  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM--PGVYGDNSSLVYQH  507
            P D +DP++CY+PN Y  YY G  G G+EW  Y  Y N +GV+M  PG+YG+N S+VY  
Sbjct  62   PSDALDPSVCYVPNAYQPYYFGGYGNGHEWGEYTGYTNPDGVDMTSPGIYGENGSVVYPQ  121

Query  508  gygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAAPA  669
                    PYSPATSP PTVG DGQ++GAQ YQYP   F PL++G   + AA +
Sbjct  122  -GFGYAAYPYSPATSPAPTVGSDGQMFGAQQYQYP---FFPLSTGFASSVAAAS  171



>ref|XP_010552314.1| PREDICTED: uncharacterized protein LOC104822698 isoform X2 [Tarenaya 
hassleriana]
Length=678

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 117/175 (67%), Gaps = 10/175 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAA---NGQIQPADRSFSPL  333
            A +AP ADQ ++LLQ LSLDSQ KALEIPEPTK  +    +AA   NGQ+   DRS +PL
Sbjct  2    ATIAPPADQATDLLQKLSLDSQAKALEIPEPTKNQTAVYQYAAVDSNGQVPSYDRSLTPL  61

Query  334  IP-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM--PGVYGDNSSLVYQ  504
            +P D +DP++CY+PN Y  YY G  G G+EW  Y  Y N +GV+M  PG+YG+N S+VY 
Sbjct  62   LPSDALDPSVCYVPNAYQPYYFGGYGNGHEWGEYTGYTNPDGVDMTSPGIYGENGSVVYP  121

Query  505  HgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAAPA  669
                     PYSPATSP PTVG DGQ++GAQ YQYP   F PL++G   + AA +
Sbjct  122  Q-GFGYAAYPYSPATSPAPTVGSDGQMFGAQQYQYP---FFPLSTGFASSVAAAS  172



>ref|XP_010552313.1| PREDICTED: uncharacterized protein LOC104822698 isoform X1 [Tarenaya 
hassleriana]
Length=679

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 117/175 (67%), Gaps = 10/175 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAA---NGQIQPADRSFSPL  333
            A +AP ADQ ++LLQ LSLDSQ KALEIPEPTK  +    +AA   NGQ+   DRS +PL
Sbjct  2    ATIAPPADQATDLLQKLSLDSQAKALEIPEPTKNQTAVYQYAAVDSNGQVPSYDRSLTPL  61

Query  334  IP-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM--PGVYGDNSSLVYQ  504
            +P D +DP++CY+PN Y  YY G  G G+EW  Y  Y N +GV+M  PG+YG+N S+VY 
Sbjct  62   LPSDALDPSVCYVPNAYQPYYFGGYGNGHEWGEYTGYTNPDGVDMTSPGIYGENGSVVYP  121

Query  505  HgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAAPA  669
                     PYSPATSP PTVG DGQ++GAQ YQYP   F PL++G   + AA +
Sbjct  122  Q-GFGYAAYPYSPATSPAPTVGSDGQMFGAQQYQYP---FFPLSTGFASSVAAAS  172



>ref|XP_006826301.1| hypothetical protein AMTR_s00004p00073360 [Amborella trichopoda]
 gb|ERM93538.1| hypothetical protein AMTR_s00004p00073360 [Amborella trichopoda]
Length=692

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 116/182 (64%), Gaps = 17/182 (9%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  318
            MAA VAP ADQ +ELLQ LSL+SQ K  E+ E TKK       SVD+    N QI  +DR
Sbjct  1    MAAVVAP-ADQATELLQKLSLESQGKPKEVSEATKKPSSVQYGSVDARDITNVQIPSSDR  59

Query  319  SFSPLIPDFMDPTLCYLPNgypyyyggydgtg--NEWEGYPRYVNAEGVEM--PGVYGDN  486
            S +P++ +FMDP +CYLPNGY   Y         +EWE YPRYV+ +GV+M  PGVYGD 
Sbjct  60   STTPVLQEFMDPNMCYLPNGYASSYYYGSYEVPISEWEDYPRYVHPDGVDMPPPGVYGD-  118

Query  487  SSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLT--SGPYPTPA  660
               +Y  GY Y  Y PY PA SPVPT+G DGQLYG QH+QY  PY+Q  T  S PY +  
Sbjct  119  ---MYHPGYAYPSYSPYPPAGSPVPTMGPDGQLYGPQHFQYGAPYYQQPTQPSAPYNSNQ  175

Query  661  AP  666
            AP
Sbjct  176  AP  177



>gb|KCW87046.1| hypothetical protein EUGRSUZ_B03591 [Eucalyptus grandis]
Length=744

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 121/179 (68%), Gaps = 21/179 (12%)
 Frame = +1

Query  145  IDRAMAAAVAP-TAdqtsellqslsldsqtKALEIPEPTKKVSVD------STHAANGQI  303
            I R + A VAP +A+QT++LLQ LSLD+Q K LEIPEPTKK S +      +  AANGQI
Sbjct  58   IHRRIMATVAPASANQTADLLQKLSLDAQPKTLEIPEPTKKTSANRLGSVINGKAANGQI  117

Query  304  QPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYG  480
            QP + S +P +P+F +P +C++P GY            EW+ + RY N EGV++  G YG
Sbjct  118  QPYEPSVTPSLPEF-EPPMCFVPTGYEGTGA-------EWDDFSRYTNTEGVDVASGFYG  169

Query  481  DNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTP  657
            +N SL+Y HGYG+ P+ PYSPATSPVP  G+D Q YG+QHY YP+PY+Q +T  P  TP
Sbjct  170  ENGSLMYHHGYGFAPFAPYSPATSPVP--GND-QTYGSQHYHYPSPYYQSVT--PTATP  223



>ref|XP_010653843.1| PREDICTED: uncharacterized protein LOC100245287 isoform X2 [Vitis 
vinifera]
Length=690

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 90/146 (62%), Gaps = 20/146 (14%)
 Frame = +1

Query  232  KALEIPEPTKK-VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggy--  402
            K+LE+ E  KK VSVDS   ANG  +P +RS + L  DF+DP +CYLPNGYP  Y     
Sbjct  25   KSLEVSEQAKKFVSVDSGDLANGLGKPFERSATHLHQDFVDPNMCYLPNGYPSTYYFAPG  84

Query  403  -dgtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQHgygytpygpyspatspVPTVGHD  576
             DG  NEW         +GVEMP GVYGD    +Y HG+GY       P +  VPT+GHD
Sbjct  85   YDGQMNEW--------GDGVEMPPGVYGD----IYHHGFGYPYGTYPPPGSP-VPTMGHD  131

Query  577  GQLYGAQHYQYPTPYFQPL--TSGPY  648
            GQLYG QHYQYPTPY+QP     GPY
Sbjct  132  GQLYGPQHYQYPTPYYQPQAPNGGPY  157



>ref|XP_010653842.1| PREDICTED: uncharacterized protein LOC100245287 isoform X1 [Vitis 
vinifera]
 emb|CBI29937.3| unnamed protein product [Vitis vinifera]
Length=694

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 90/146 (62%), Gaps = 20/146 (14%)
 Frame = +1

Query  232  KALEIPEPTKK-VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggy--  402
            K+LE+ E  KK VSVDS   ANG  +P +RS + L  DF+DP +CYLPNGYP  Y     
Sbjct  25   KSLEVSEQAKKFVSVDSGDLANGLGKPFERSATHLHQDFVDPNMCYLPNGYPSTYYFAPG  84

Query  403  -dgtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQHgygytpygpyspatspVPTVGHD  576
             DG  NEW         +GVEMP GVYGD    +Y HG+GY       P +  VPT+GHD
Sbjct  85   YDGQMNEW--------GDGVEMPPGVYGD----IYHHGFGYPYGTYPPPGSP-VPTMGHD  131

Query  577  GQLYGAQHYQYPTPYFQPL--TSGPY  648
            GQLYG QHYQYPTPY+QP     GPY
Sbjct  132  GQLYGPQHYQYPTPYYQPQAPNGGPY  157



>emb|CAN81896.1| hypothetical protein VITISV_009052 [Vitis vinifera]
Length=696

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 90/146 (62%), Gaps = 20/146 (14%)
 Frame = +1

Query  232  KALEIPEPTKK-VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggy--  402
            K+LE+ E  KK VSVDS   ANG  +P +RS + L  DF+DP +CYLPNGYP  Y     
Sbjct  80   KSLEVSEQAKKFVSVDSGDLANGLGKPFERSATHLHQDFVDPNMCYLPNGYPSTYYFAPG  139

Query  403  -dgtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQHgygytpygpyspatspVPTVGHD  576
             DG  NEW         +GVEMP GVYGD    +Y HG+GY       P +  VPT+GHD
Sbjct  140  YDGQMNEW--------GDGVEMPPGVYGD----IYHHGFGYPYGTYPPPGSP-VPTMGHD  186

Query  577  GQLYGAQHYQYPTPYFQPL--TSGPY  648
            GQLYG QHYQYPTPY+QP     GPY
Sbjct  187  GQLYGPQHYQYPTPYYQPQAPNGGPY  212



>gb|KGN66348.1| hypothetical protein Csa_1G599420 [Cucumis sativus]
Length=674

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 97/137 (71%), Gaps = 28/137 (20%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgy-pyyyggydg  408
            K +EIPEPTKK                         +FMDP++CYLPNGY  YYYGG+DG
Sbjct  27   KPVEIPEPTKK-------------------------EFMDPSMCYLPNGYPSYYYGGFDG  61

Query  409  tgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQL  585
            T N+W+ Y RY N++GVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP++G+DGQL
Sbjct  62   TANDWDDYSRYTNSDGVEMTSGVYGDNGSLMYHHGYGYGPYGPYSPAASPVPSMGNDGQL  121

Query  586  YGAQHYQYPTPYFQPLT  636
            YG QHYQYP PYFQPLT
Sbjct  122  YGPQHYQYP-PYFQPLT  137



>ref|XP_008451003.1| PREDICTED: uncharacterized protein LOC103492414 isoform X3 [Cucumis 
melo]
Length=674

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 97/137 (71%), Gaps = 28/137 (20%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgy-pyyyggydg  408
            K +EIPEPTKK                         +FMDP++CYLPNGY  YYYGG+DG
Sbjct  27   KPVEIPEPTKK-------------------------EFMDPSMCYLPNGYPSYYYGGFDG  61

Query  409  tgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQL  585
            T N+W+ Y RY N++GVEM  GVYGDN SL+Y HGYGY PYGPYSPA SPVP++G+DGQL
Sbjct  62   TANDWDDYSRYTNSDGVEMTSGVYGDNGSLMYHHGYGYGPYGPYSPAASPVPSMGNDGQL  121

Query  586  YGAQHYQYPTPYFQPLT  636
            YG QHYQYP PYFQPLT
Sbjct  122  YGPQHYQYP-PYFQPLT  137



>ref|XP_010465188.1| PREDICTED: uncharacterized protein LOC104745597 [Camelina sativa]
Length=672

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 114/171 (67%), Gaps = 7/171 (4%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  337  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHg  510
            P D  DP++CYLP  Y  YY    G+G EW  Y  Y N EGV+M  G+YG+N ++VY  G
Sbjct  62   PSDAADPSVCYLPTPYTPYYYNAYGSGQEWTDYSAYTNPEGVDMNSGIYGENGTVVYPQG  121

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            YGY  Y PYSPATSPVP VG DGQL+GAQ YQYPT YF    SGP+ +  A
Sbjct  122  YGYAAYPPYSPATSPVPQVGGDGQLFGAQQYQYPT-YFP--NSGPFASSVA  169



>ref|XP_010487108.1| PREDICTED: uncharacterized protein LOC104765132 isoform X3 [Camelina 
sativa]
Length=671

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 114/171 (67%), Gaps = 7/171 (4%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  337  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHg  510
            P D  DP++CYLP  Y  YY    G+G EW  Y  Y N EGV+M  G+YG+N ++VY  G
Sbjct  62   PSDAADPSVCYLPTPYTPYYYNAYGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVYPQG  121

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            YGY  Y PYSPATSPVP VG DGQL+GAQ YQYPT YF    SGP+ +  A
Sbjct  122  YGYAAYPPYSPATSPVPQVGGDGQLFGAQQYQYPT-YFP--NSGPFASSVA  169



>ref|XP_010500586.1| PREDICTED: uncharacterized protein LOC104777950 isoform X2 [Camelina 
sativa]
Length=672

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 115/171 (67%), Gaps = 7/171 (4%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  337  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHg  510
            P D  DP++CYLP  Y  YY    G+G EW  Y  Y N EGV+M  G+YG+N ++VY  G
Sbjct  62   PSDAADPSVCYLPTPYTPYYYNAYGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVYPQG  121

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            YGY PY PYSPATSPVP VG DGQL+GAQ YQYPT YF    SGP+ +  A
Sbjct  122  YGYAPYPPYSPATSPVPQVGGDGQLFGAQQYQYPT-YFP--NSGPFASSVA  169



>gb|KCW87047.1| hypothetical protein EUGRSUZ_B03591 [Eucalyptus grandis]
Length=764

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 129/184 (70%), Gaps = 23/184 (13%)
 Frame = +1

Query  145  IDRAMAAAVAP-TAdqtsellqslsldsqtKALEIPEPTKKVSVD------STHAANGQI  303
            I R + A VAP +A+QT++LLQ LSLD+Q K LEIPEPTKK S +      +  AANGQI
Sbjct  58   IHRRIMATVAPASANQTADLLQKLSLDAQPKTLEIPEPTKKTSANRLGSVINGKAANGQI  117

Query  304  QPADRSFSPLIPDFM---------DPTLCYLPNg---ypyyyggydgtgNEWEGYPRYVN  447
            QP + S +P +P+F          +PT+C++P G   + YY+GGY+GTG EW+ + RY N
Sbjct  118  QPYEPSVTPSLPEFEPPMCFVPTGEPTMCFVPTGYPPHAYYHGGYEGTGAEWDDFSRYTN  177

Query  448  AEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYF  624
             EGV++  G YG+N SL+Y HGYG+ P+ PYSPATSPVP  G+D Q YG+QHY YP+PY+
Sbjct  178  TEGVDVASGFYGENGSLMYHHGYGFAPFAPYSPATSPVP--GND-QTYGSQHYHYPSPYY  234

Query  625  QPLT  636
            Q +T
Sbjct  235  QSVT  238



>ref|XP_010910310.1| PREDICTED: YTH domain-containing family protein 2-like [Elaeis 
guineensis]
Length=692

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 99/157 (63%), Gaps = 17/157 (11%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPA------DRSFSPLIPDFMDPTLCYLPNgypyyy  393
            K  + PE TKK S      A+G + P+      +RS +PL+ + MD ++CYLPNGYP   
Sbjct  25   KTHDSPEVTKKPSGIQHAPADGAVVPSAPVPPQERSVTPLLQEVMDASMCYLPNGYPSTT  84

Query  394  ---ggydgtgNEWEGYPRYVNAEGVEMP--GVYGDNSSLVYQHgygytpygpyspatspV  558
               GGYDG  NEWE + RY N +GVEMP  GVYGD    +Y HGYGY PYGPY    SPV
Sbjct  85   YYYGGYDGAMNEWEDFARYANPDGVEMPPPGVYGD----LYHHGYGYAPYGPYPSPGSPV  140

Query  559  PTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAAPA  669
            PT+GHDGQLYG QHYQYP  Y+Q  T  P P   +P+
Sbjct  141  PTMGHDGQLYGPQHYQYPAQYYQ--TPTPAPKQVSPS  175



>ref|XP_006407213.1| hypothetical protein EUTSA_v10020224mg [Eutrema salsugineum]
 gb|ESQ48666.1| hypothetical protein EUTSA_v10020224mg [Eutrema salsugineum]
Length=648

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 112/171 (65%), Gaps = 9/171 (5%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ +++LQ L+LDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQATDMLQKLTLDSQAKASEIPEPNKKTAVYQYGGVDTHGQVPSFDRSLTPIL  61

Query  337  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHg  510
            P D +DP++CY+PN Y  YY G  G+G+EW  Y  Y N EGV+M  G+YG+N SL+Y   
Sbjct  62   PSDAVDPSVCYVPNAYQPYYYGGYGSGHEWSDYTGYPNPEGVDMNSGIYGENGSLMYPQ-  120

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
                   PYSPATSP P VG DGQLYGAQ YQYPT  F P  SGP+ +  A
Sbjct  121  GYGYAAYPYSPATSPAPQVGGDGQLYGAQQYQYPT--FFP--SGPFASSIA  167



>ref|XP_010487109.1| PREDICTED: uncharacterized protein LOC104765132 isoform X4 [Camelina 
sativa]
Length=670

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 96/148 (65%), Gaps = 7/148 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  402
            KA EIPEP KK +V      +  GQ+   DRS +P++P D  DP++CYLP  Y  YY   
Sbjct  24   KASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPMLPSDAADPSVCYLPTPYTPYYYNA  83

Query  403  dgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDG  579
             G+G EW  Y  Y N EGV+M  G+YG+N ++VY  GYGY  Y PYSPATSPVP VG DG
Sbjct  84   YGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVYPQGYGYAAYPPYSPATSPVPQVGGDG  143

Query  580  QLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            QL+GAQ YQYPT YF    SGP+ +  A
Sbjct  144  QLFGAQQYQYPT-YFP--NSGPFASSVA  168



>ref|XP_010487106.1| PREDICTED: uncharacterized protein LOC104765132 isoform X1 [Camelina 
sativa]
Length=674

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  337  P-DFMDPTLCYLPNgyp---yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  501
            P D  DP++CYLP  Y    Y      G+G EW  Y  Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYLPTPYTPYYYNVSSAYGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVY  121

Query  502  QHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
              GYGY  Y PYSPATSPVP VG DGQL+GAQ YQYPT YF    SGP+ +  A
Sbjct  122  PQGYGYAAYPPYSPATSPVPQVGGDGQLFGAQQYQYPT-YFP--NSGPFASSVA  172



>ref|XP_006407214.1| hypothetical protein EUTSA_v10020224mg [Eutrema salsugineum]
 gb|ESQ48667.1| hypothetical protein EUTSA_v10020224mg [Eutrema salsugineum]
Length=666

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 94/148 (64%), Gaps = 9/148 (6%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  402
            KA EIPEP KK +V      +  GQ+   DRS +P++P D +DP++CY+PN Y  YY G 
Sbjct  24   KASEIPEPNKKTAVYQYGGVDTHGQVPSFDRSLTPILPSDAVDPSVCYVPNAYQPYYYGG  83

Query  403  dgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDG  579
             G+G+EW  Y  Y N EGV+M  G+YG+N SL+Y          PYSPATSP P VG DG
Sbjct  84   YGSGHEWSDYTGYPNPEGVDMNSGIYGENGSLMYPQ-GYGYAAYPYSPATSPAPQVGGDG  142

Query  580  QLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            QLYGAQ YQYPT  F P  SGP+ +  A
Sbjct  143  QLYGAQQYQYPT--FFP--SGPFASSIA  166



>ref|XP_010044923.1| PREDICTED: uncharacterized protein LOC104433760 [Eucalyptus grandis]
 gb|KCW87045.1| hypothetical protein EUGRSUZ_B03590 [Eucalyptus grandis]
Length=690

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 126/179 (70%), Gaps = 22/179 (12%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS-----VDSTHAANGQIQPADRSFS  327
            AAVAP+ADQ ++L+Q LSLD+Q+K LE+PE  K  S     VD  +AANGQIQ  D + +
Sbjct  2    AAVAPSADQPTDLMQKLSLDAQSKTLEMPEVAKMSSNQNGSVDGVNAANGQIQSYDGAVT  61

Query  328  PLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAE-GVEM-PGVYGDNSSLVY  501
                   +PT+C++PN YPYYYGGYDGTG +W+ +PRY N E GV+M  G YGDN SL+Y
Sbjct  62   -------EPTVCFVPNSYPYYYGGYDGTGGDWDNFPRYANVEGGVDMSSGFYGDNGSLMY  114

Query  502  QHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL---TSGPY-PTPAAP  666
             HGYG+ PYGPYSPA S VP  G+D QLYG Q Y YP+PYFQ     TS P+ P+ AAP
Sbjct  115  -HGYGFAPYGPYSPAASSVP--GND-QLYGTQQYHYPSPYFQSNMTPTSAPFTPSAAAP  169



>ref|XP_010500580.1| PREDICTED: uncharacterized protein LOC104777950 isoform X1 [Camelina 
sativa]
Length=675

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  337  P-DFMDPTLCYLPNgyp---yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  501
            P D  DP++CYLP  Y    Y      G+G EW  Y  Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYLPTPYTPYYYNVSSAYGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVY  121

Query  502  QHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
              GYGY PY PYSPATSPVP VG DGQL+GAQ YQYPT YF    SGP+ +  A
Sbjct  122  PQGYGYAPYPPYSPATSPVPQVGGDGQLFGAQQYQYPT-YFP--NSGPFASSVA  172



>ref|XP_006297132.1| hypothetical protein CARUB_v10013133mg [Capsella rubella]
 gb|EOA30030.1| hypothetical protein CARUB_v10013133mg [Capsella rubella]
Length=671

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 110/173 (64%), Gaps = 10/173 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V       A+GQ+   DRS +PL+
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDAHGQVPSYDRSLTPLL  61

Query  337  P-DFMDPTLCYLPNgyp--yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQ  504
            P D  DP++CYLPN Y   YY     G+G EW  Y  Y N+EGV+M  G+YG+N ++VY 
Sbjct  62   PSDAADPSVCYLPNPYTPYYYNVSAYGSGQEWTDYAAYTNSEGVDMNSGIYGENGTVVYP  121

Query  505  HgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
                     PYSPATSP P VG DGQLYGAQ YQYP  YF    SGP+ +  A
Sbjct  122  -PGYTYATYPYSPATSPAPQVGGDGQLYGAQQYQYPA-YFP--NSGPFASSVA  170



>ref|XP_010044924.1| PREDICTED: uncharacterized protein LOC104433761 [Eucalyptus grandis]
Length=702

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 109/161 (68%), Gaps = 24/161 (15%)
 Frame = +1

Query  232  KALEIPEPTKKVSVD------STHAANGQIQPADRSFSPLIPDFM---------DPTLCY  366
            K LEIPEPTKK S +      +  AANGQIQP + S +P +P+F          +PT+C+
Sbjct  26   KTLEIPEPTKKTSANRLGSVINGKAANGQIQPYEPSVTPSLPEFEPPMCFVPTGEPTMCF  85

Query  367  LPNg---ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygp  534
            +P G   + YY+GGY+GTG EW+ + RY N EGV++  G YG+N SL+Y HGYG+ P+ P
Sbjct  86   VPTGYPPHAYYHGGYEGTGAEWDDFSRYTNTEGVDVASGFYGENGSLMYHHGYGFAPFAP  145

Query  535  yspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTP  657
            YSPATSPVP  G+D Q YG+QHY YP+PY+Q +T  P  TP
Sbjct  146  YSPATSPVP--GND-QTYGSQHYHYPSPYYQSVT--PTATP  181



>ref|XP_010487107.1| PREDICTED: uncharacterized protein LOC104765132 isoform X2 [Camelina 
sativa]
Length=673

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 95/151 (63%), Gaps = 10/151 (7%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgyp---yyy  393
            KA EIPEP KK +V      +  GQ+   DRS +P++P D  DP++CYLP  Y    Y  
Sbjct  24   KASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPMLPSDAADPSVCYLPTPYTPYYYNV  83

Query  394  ggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVG  570
                G+G EW  Y  Y N EGV+M  G+YG+N ++VY  GYGY  Y PYSPATSPVP VG
Sbjct  84   SSAYGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVYPQGYGYAAYPPYSPATSPVPQVG  143

Query  571  HDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
             DGQL+GAQ YQYPT YF    SGP+ +  A
Sbjct  144  GDGQLFGAQQYQYPT-YFP--NSGPFASSVA  171



>ref|XP_009398525.1| PREDICTED: YTH domain-containing family protein 2-like [Musa 
acuminata subsp. malaccensis]
Length=695

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 100/158 (63%), Gaps = 16/158 (10%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAANGQIQPA------DRSFSPLIPDFMDPTLCYLPNgypyyy  393
            K+ +  E  KK S     +ANG   P       +RS +PL+ + MD  +CY+PNGY   +
Sbjct  27   KSNDSSEVKKKPSGVQYGSANGGEAPIASIPTYERSLTPLLQEHMDAGMCYVPNGYTPSF  86

Query  394  --ggydgtgNEWEGYPRYVNAEGVEMP--GVYGDNSSLVYQHgygytpygpyspatspVP  561
              GGYDG+  EWE YPRYVN++GVE+P  GVYGD    +Y HGYGY PYGPY    SPVP
Sbjct  87   YYGGYDGSMAEWEDYPRYVNSDGVEVPPPGVYGD----MYHHGYGYAPYGPYPSPGSPVP  142

Query  562  TVGHDGQLYGAQHYQYPTPYFQP--LTSGPYPTPAAPA  669
            T+GH+GQLYG QHYQ+P  Y+QP   TS P  T   P+
Sbjct  143  TLGHNGQLYGPQHYQFPATYYQPPTATSAPDTTSQTPS  180



>ref|XP_009408493.1| PREDICTED: uncharacterized protein LOC103990922 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=678

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 83/128 (65%), Gaps = 10/128 (8%)
 Frame = +1

Query  301  IQPADRSFSPLIPDFMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMP--  468
            I  A+RS +PL+ + MD ++CY+PNGY   +  GGYDG+  EWE YPRYV   GVE+P  
Sbjct  55   IPTAERSLTPLLHEHMDASMCYIPNGYASSFYYGGYDGSMTEWEDYPRYVTPNGVEVPPL  114

Query  469  GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP--LTSG  642
            GVYGD    +YQHGYGY PY  Y    S VPT+ H+ QLYG QHYQYP  Y+QP   T  
Sbjct  115  GVYGD----MYQHGYGYAPYSQYPSPGSTVPTLAHNSQLYGPQHYQYPATYYQPPIPTGA  170

Query  643  PYPTPAAP  666
            PY T   P
Sbjct  171  PYKTNQIP  178



>ref|XP_009408492.1| PREDICTED: uncharacterized protein LOC103990922 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=679

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 83/128 (65%), Gaps = 10/128 (8%)
 Frame = +1

Query  301  IQPADRSFSPLIPDFMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMP--  468
            I  A+RS +PL+ + MD ++CY+PNGY   +  GGYDG+  EWE YPRYV   GVE+P  
Sbjct  56   IPTAERSLTPLLHEHMDASMCYIPNGYASSFYYGGYDGSMTEWEDYPRYVTPNGVEVPPL  115

Query  469  GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP--LTSG  642
            GVYGD    +YQHGYGY PY  Y    S VPT+ H+ QLYG QHYQYP  Y+QP   T  
Sbjct  116  GVYGD----MYQHGYGYAPYSQYPSPGSTVPTLAHNSQLYGPQHYQYPATYYQPPIPTGA  171

Query  643  PYPTPAAP  666
            PY T   P
Sbjct  172  PYKTNQIP  179



>ref|NP_001030689.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
 gb|AEE75360.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
Length=508

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 106/172 (62%), Gaps = 9/172 (5%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDS  KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQATDLLQKLSLDSPAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  337  P-DFMDPTLCYLPNgyp-yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  507
            P D  DP++CY+PN Y  Y Y    G+G EW  YP Y N EGV+M  G+YG+N ++VY  
Sbjct  62   PSDAADPSVCYVPNPYNPYQYYNVYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVYPQ  121

Query  508  gygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            GYGY  Y      +   P +G +GQLYGAQ YQYP  YF    SGPY +  A
Sbjct  122  GYGYAAYPYSPATSP-APQLGGEGQLYGAQQYQYPN-YFP--NSGPYASSVA  169



>ref|XP_009339199.1| PREDICTED: uncharacterized protein LOC103931442 isoform X2 [Pyrus 
x bretschneideri]
Length=675

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 84/126 (67%), Gaps = 8/126 (6%)
 Frame = +1

Query  313  DRSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYG  480
            DRS +PL  +FMDP+ CYLPN      YYYGGYDGTGNEW G   YVN  G ++   VYG
Sbjct  50   DRSTAPLRKNFMDPSACYLPNGYTSSAYYYGGYDGTGNEWGGISSYVNPNGNDVNSAVYG  109

Query  481  DNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-P  651
            DN S +Y HGYGY PY  YS + SPV TVG DGQLYG Q YQYP PYF+ L   SG + P
Sbjct  110  DNGSFMYHHGYGYAPYSTYSTSGSPVSTVGSDGQLYGPQQYQYP-PYFKQLKPNSGSHTP  168

Query  652  TPAAPA  669
              A P+
Sbjct  169  NSAVPS  174



>gb|AAN72190.1| Unknown protein [Arabidopsis thaliana]
 dbj|BAE99285.1| hypothetical protein [Arabidopsis thaliana]
Length=667

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 106/172 (62%), Gaps = 9/172 (5%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDS  KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQATDLLQKLSLDSPAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  337  P-DFMDPTLCYLPNgyp-yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  507
            P D  DP++CY+PN Y  Y Y    G+G EW  YP Y N EGV+M  G+YG+N ++VY  
Sbjct  62   PSDAADPSVCYVPNPYNPYQYYNVYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVYPQ  121

Query  508  gygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            GYGY  Y      +   P +G +GQLYGAQ YQYP  YF    SGPY +  A
Sbjct  122  GYGYAAYPYSPATSP-APQLGGEGQLYGAQQYQYPN-YFP--NSGPYASSVA  169



>ref|NP_187955.2| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
 dbj|BAB01753.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM74503.1| AT3g13460/MRP15_10 [Arabidopsis thaliana]
 gb|AEE75358.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
Length=667

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 106/172 (62%), Gaps = 9/172 (5%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDS  KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQATDLLQKLSLDSPAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  337  P-DFMDPTLCYLPNgyp-yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  507
            P D  DP++CY+PN Y  Y Y    G+G EW  YP Y N EGV+M  G+YG+N ++VY  
Sbjct  62   PSDAADPSVCYVPNPYNPYQYYNVYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVYPQ  121

Query  508  gygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            GYGY  Y      +   P +G +GQLYGAQ YQYP  YF    SGPY +  A
Sbjct  122  GYGYAAYPYSPATSP-APQLGGEGQLYGAQQYQYPN-YFP--NSGPYASSVA  169



>gb|KEH20708.1| evolutionarily carboxy-terminal region protein [Medicago truncatula]
Length=605

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 86/112 (77%), Gaps = 11/112 (10%)
 Frame = +1

Query  346  MDPTLCYLPNgypyyyggydgtg-NEWEGYPRYVNAEGVEM-PGVYGDN-SSLVYQHgyg  516
            MDP +CYLPNGYP YY G      +EWE    Y+NA+GV++  GVYGDN SSLVY HGYG
Sbjct  1    MDPAMCYLPNGYPSYYYGGYDGTGSEWE----YLNADGVDLTSGVYGDNGSSLVYHHGYG  56

Query  517  ytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAA  663
            Y PY PYSPA SPVPT+G+DGQLYG QHYQYP P+FQPL  TSGP+ PT AA
Sbjct  57   YAPYAPYSPAGSPVPTMGNDGQLYGPQHYQYP-PFFQPLTPTSGPFTPTSAA  107



>ref|XP_009339198.1| PREDICTED: uncharacterized protein LOC103931442 isoform X1 [Pyrus 
x bretschneideri]
Length=676

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 84/126 (67%), Gaps = 8/126 (6%)
 Frame = +1

Query  313  DRSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYG  480
            DRS +PL  +FMDP+ CYLPN      YYYGGYDGTGNEW G   YVN  G ++   VYG
Sbjct  51   DRSTAPLRKNFMDPSACYLPNGYTSSAYYYGGYDGTGNEWGGISSYVNPNGNDVNSAVYG  110

Query  481  DNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-P  651
            DN S +Y HGYGY PY  YS + SPV TVG DGQLYG Q YQYP PYF+ L   SG + P
Sbjct  111  DNGSFMYHHGYGYAPYSTYSTSGSPVSTVGSDGQLYGPQQYQYP-PYFKQLKPNSGSHTP  169

Query  652  TPAAPA  669
              A P+
Sbjct  170  NSAVPS  175



>ref|NP_001030690.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
 gb|AEE75361.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
Length=666

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 89/149 (60%), Gaps = 9/149 (6%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgyp-yyygg  399
            KA EIPEP KK +V      +  GQ+   DRS +P++P D  DP++CY+PN Y  Y Y  
Sbjct  24   KASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPMLPSDAADPSVCYVPNPYNPYQYYN  83

Query  400  ydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHD  576
              G+G EW  YP Y N EGV+M  G+YG+N ++VY  GYGY  Y      +   P +G +
Sbjct  84   VYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVYPQGYGYAAYPYSPATSP-APQLGGE  142

Query  577  GQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            GQLYGAQ YQYP  YF    SGPY +  A
Sbjct  143  GQLYGAQQYQYPN-YFP--NSGPYASSVA  168



>ref|NP_850578.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
 gb|AEE75359.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
Length=664

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 89/149 (60%), Gaps = 9/149 (6%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgyp-yyygg  399
            KA EIPEP KK +V      +  GQ+   DRS +P++P D  DP++CY+PN Y  Y Y  
Sbjct  22   KASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPMLPSDAADPSVCYVPNPYNPYQYYN  81

Query  400  ydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHD  576
              G+G EW  YP Y N EGV+M  G+YG+N ++VY  GYGY  Y      +   P +G +
Sbjct  82   VYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVYPQGYGYAAYPYSPATSP-APQLGGE  140

Query  577  GQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            GQLYGAQ YQYP  YF    SGPY +  A
Sbjct  141  GQLYGAQQYQYPN-YFP--NSGPYASSVA  166



>ref|XP_004985632.1| PREDICTED: uncharacterized protein LOC101767723 isoform X4 [Setaria 
italica]
Length=695

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 83/119 (70%), Gaps = 16/119 (13%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP L YLP    YYYGGYDG+ NEW+ YPRY+N +GVE+ P VYGD
Sbjct  75   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDGSMNEWDDYPRYLNQDGVEIAPAVYGD  131

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++GAQHYQYPT YFQP    P P P+
Sbjct  132  IYGYGY------APYGAYSPASSPVPTV--DGQMFGAQHYQYPTAYFQP----PTPVPS  178



>ref|XP_004985630.1| PREDICTED: uncharacterized protein LOC101767723 isoform X2 [Setaria 
italica]
Length=696

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 83/119 (70%), Gaps = 16/119 (13%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP L YLP    YYYGGYDG+ NEW+ YPRY+N +GVE+ P VYGD
Sbjct  76   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDGSMNEWDDYPRYLNQDGVEIAPAVYGD  132

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++GAQHYQYPT YFQP    P P P+
Sbjct  133  IYGYGY------APYGAYSPASSPVPTV--DGQMFGAQHYQYPTAYFQP----PTPVPS  179



>ref|XP_004985631.1| PREDICTED: uncharacterized protein LOC101767723 isoform X3 [Setaria 
italica]
Length=696

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 83/119 (70%), Gaps = 16/119 (13%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP L YLP    YYYGGYDG+ NEW+ YPRY+N +GVE+ P VYGD
Sbjct  75   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDGSMNEWDDYPRYLNQDGVEIAPAVYGD  131

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++GAQHYQYPT YFQP    P P P+
Sbjct  132  IYGYGY------APYGAYSPASSPVPTV--DGQMFGAQHYQYPTAYFQP----PTPVPS  178



>ref|XP_004985629.1| PREDICTED: uncharacterized protein LOC101767723 isoform X1 [Setaria 
italica]
Length=697

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 83/119 (70%), Gaps = 16/119 (13%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP L YLP    YYYGGYDG+ NEW+ YPRY+N +GVE+ P VYGD
Sbjct  76   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDGSMNEWDDYPRYLNQDGVEIAPAVYGD  132

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++GAQHYQYPT YFQP    P P P+
Sbjct  133  IYGYGY------APYGAYSPASSPVPTV--DGQMFGAQHYQYPTAYFQP----PTPVPS  179



>ref|XP_009399331.1| PREDICTED: YTH domain-containing family protein 1-like [Musa 
acuminata subsp. malaccensis]
Length=698

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 82/120 (68%), Gaps = 10/120 (8%)
 Frame = +1

Query  313  DRSFSPLIPDFMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMP--GVYG  480
            +RS +PL+ + MD ++CYLPNGY   +  GGY+G   EWE YPRY N +G E+P  GVYG
Sbjct  60   ERSLTPLLQEHMDASMCYLPNGYTSSFYYGGYNGLMTEWEDYPRYANPDGAEVPPPGVYG  119

Query  481  DNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP--LTSGPYPT  654
            D    +Y HGYGY  YGPY    SP+PT+G +GQLYG+QHY +P  Y+QP   TS PY T
Sbjct  120  D----MYHHGYGYASYGPYPSPGSPIPTLGQNGQLYGSQHYHFPATYYQPPTPTSAPYMT  175



>ref|XP_009398364.1| PREDICTED: YTH domain-containing family protein 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=688

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 90/138 (65%), Gaps = 16/138 (12%)
 Frame = +1

Query  289  ANGQIQP------ADRSFSPLIPDFMDPTLCYLPNgypy--yyggydgtgNEWEGYPRYV  444
            ANG+  P        RS +PL+ + MD ++CY PNGY    YYGGYD +  EWE YPRYV
Sbjct  46   ANGRELPIAPIPTCKRSLTPLLQEHMDASMCYFPNGYTSPFYYGGYDASITEWEDYPRYV  105

Query  445  NAEGVEMP--GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTP  618
            + +G+E+P  GVYGD    +YQHGYGY PY PYS   SPVPT+GH+ QLYG Q YQ+PT 
Sbjct  106  SPDGMEVPPLGVYGD----MYQHGYGYAPYTPYSAPGSPVPTLGHNSQLYGPQQYQFPTT  161

Query  619  YFQP--LTSGPYPTPAAP  666
            Y+     TS PY T  AP
Sbjct  162  YYHSPAPTSAPYTTSQAP  179



>ref|NP_001185240.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33254.1| uncharacterized protein AT1G55500 [Arabidopsis thaliana]
Length=599

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 104/168 (62%), Gaps = 12/168 (7%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  336
            + VAP ADQ +++L+ LSLDS+++ LEIPEPTKK  V    A  +NGQ+   DRS SP++
Sbjct  2    STVAPPADQAADVLKKLSLDSKSRTLEIPEPTKKTGVYQYGAMDSNGQVPSFDRSLSPML  61

Query  337  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHg  510
            P D +DP++ Y+PN Y   Y    G+      Y  Y N+E V+M  G YG+N+SLVY  G
Sbjct  62   PSDALDPSVFYVPNVYQQPYYYGYGSD-----YTGYTNSESVDMTSGAYGENASLVYPQG  116

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPT  654
            YGY  +      +   P +G DGQLYGAQ YQYP P     +SGP+ +
Sbjct  117  YGYAAFPYSPATSP-APQLGGDGQLYGAQQYQYPFPL--TASSGPFAS  161



>emb|CAN81999.1| hypothetical protein VITISV_031582 [Vitis vinifera]
Length=147

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +1

Query  310  ADRSFSPLIPDFMDPTLCYLPNgypyyyggyd-gtgNEWEGYPRYVNAEGVEMP-GVYGD  483
             +R  +PL+ +FMDP++CY+PNGY  YY G   GT NEWE Y RY+N EGVE+P GVYGD
Sbjct  51   CERFVTPLLQEFMDPSVCYVPNGYSSYYYGGYDGTTNEWEDYSRYMNLEGVEIPVGVYGD  110

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYG  591
            N S +Y HGYGY PYGPY P  SP+P VG DGQLYG
Sbjct  111  NGSFMYHHGYGYAPYGPYPPINSPIPIVGRDGQLYG  146



>ref|NP_001280979.1| uncharacterized LOC103446969 [Malus domestica]
 gb|AHN05778.1| YTH domain-contained RNA binding protein 1 [Malus domestica]
Length=676

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 83/125 (66%), Gaps = 8/125 (6%)
 Frame = +1

Query  316  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            RS +PL  +FMDP+ CYLPN      YYYGGYDGTGNEW G   YVN  G ++   VYGD
Sbjct  52   RSTAPLRKNFMDPSACYLPNGYTSSAYYYGGYDGTGNEWGGISSYVNPNGNDVNSAVYGD  111

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PT  654
            N S +Y HGYGY PY  YS + SPV TVG DGQLYG Q YQYP PYF+ L   SG + P 
Sbjct  112  NGSFMYHHGYGYAPYSTYSTSGSPVSTVGSDGQLYGPQQYQYP-PYFKQLKPNSGSHTPN  170

Query  655  PAAPA  669
             A P+
Sbjct  171  SAVPS  175



>ref|XP_009411291.1| PREDICTED: uncharacterized protein LOC103993077 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=671

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 77/110 (70%), Gaps = 9/110 (8%)
 Frame = +1

Query  310  ADRSFSPLIPDFMDPTLCYLPNgypy---yyggydgtgNEWEGYPRYVNAEGVE-MPGVY  477
            ++RS +PL+PDF+DP++CY+P GY     +YGGYD   N+W  Y RY N +GVE +PGVY
Sbjct  58   SERSLTPLLPDFVDPSMCYVPGGYASPAYFYGGYDRAVNKWGDYSRYTNNDGVEILPGVY  117

Query  478  GDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQ  627
            GD    +YQ GYGY PY  Y    S VPT+GHDGQ YG Q YQYP P+F+
Sbjct  118  GD----LYQ-GYGYAPYSAYPSNGSSVPTMGHDGQHYGPQQYQYPVPFFE  162



>ref|XP_010534849.1| PREDICTED: uncharacterized protein LOC104810317 [Tarenaya hassleriana]
Length=678

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 89/146 (61%), Gaps = 8/146 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVD--STHAANGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  402
            K+L+IPEP KK +V       +NGQ    DRS +PL+P D +DP++C++PNGY  YY G 
Sbjct  25   KSLDIPEPIKKTAVYHYGVVDSNGQPPSFDRSLTPLLPSDALDPSVCFIPNGYQPYYFGG  84

Query  403  dgtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDG  579
             G G EW     Y N +GV++  G+YG+N SLVY  GY Y  Y      +   P VG DG
Sbjct  85   YGNGLEWNESTGYTNPDGVDLSSGIYGENGSLVYPQGYAYAAYTYSPATSP-APAVGSDG  143

Query  580  QLYGAQHYQYPTPYF-QPLTSGPYPT  654
            QLY A+ YQY  PYF  P +SGP+ +
Sbjct  144  QLYAAELYQY--PYFPLPTSSGPFTS  167



>gb|EPS72124.1| hypothetical protein M569_02632, partial [Genlisea aurea]
Length=628

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 111/171 (65%), Gaps = 11/171 (6%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  342
            A VAP ADQ  +++Q L+LD+Q  ++EIP PTKK S DS + ANG    A    + LI D
Sbjct  2    AVVAPPADQAVDMMQKLTLDTQPNSIEIPTPTKKQSADSNNMANGVQSVA----TTLISD  57

Query  343  FMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgygy  519
              D  + Y PNG+  YYGGYDG+  +     ++   EGVEM  G YG+N+ L+Y H YGY
Sbjct  58   MTDKAVSYQPNGFTPYYGGYDGSERD---LAKFAGHEGVEMGAGAYGENAPLLYHHSYGY  114

Query  520  tpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PTPAA  663
            + Y PYSPA SPVPT+ HD QLYGAQ Y YP+PYFQ +   +GPY   PAA
Sbjct  115  SQYPPYSPAVSPVPTLPHDAQLYGAQQYHYPSPYFQSMAPNNGPYTANPAA  165



>ref|XP_009411292.1| PREDICTED: uncharacterized protein LOC103993077 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=668

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 77/110 (70%), Gaps = 9/110 (8%)
 Frame = +1

Query  310  ADRSFSPLIPDFMDPTLCYLPNgypy---yyggydgtgNEWEGYPRYVNAEGVE-MPGVY  477
            ++RS +PL+PDF+DP++CY+P GY     +YGGYD   N+W  Y RY N +GVE +PGVY
Sbjct  55   SERSLTPLLPDFVDPSMCYVPGGYASPAYFYGGYDRAVNKWGDYSRYTNNDGVEILPGVY  114

Query  478  GDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQ  627
            GD    +YQ GYGY PY  Y    S VPT+GHDGQ YG Q YQYP P+F+
Sbjct  115  GD----LYQ-GYGYAPYSAYPSNGSSVPTMGHDGQHYGPQQYQYPVPFFE  159



>ref|XP_008351306.1| PREDICTED: uncharacterized protein LOC103414704 isoform X3 [Malus 
domestica]
Length=663

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 84/127 (66%), Gaps = 8/127 (6%)
 Frame = +1

Query  310  ADRSFSPLIPDFMDPTLCYLPNg---ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVY  477
            A +S +PL  DFM+P+ CYLPNG     YYYGGY GTGNEW G   YVN  G ++   VY
Sbjct  37   ARKSTAPLHKDFMNPSACYLPNGYTPSAYYYGGYGGTGNEWGGISSYVNPNGSDVNSAVY  96

Query  478  GDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-  648
            GDN S +Y HGYGY PY  YS + SPV TVG DGQLYG Q YQYP PYF+ L   SG + 
Sbjct  97   GDNGSFMYHHGYGYXPYSTYSTSGSPVSTVGSDGQLYGPQQYQYP-PYFKQLKPNSGSHT  155

Query  649  PTPAAPA  669
            P  A P+
Sbjct  156  PNSAVPS  162



>ref|XP_009398365.1| PREDICTED: YTH domain-containing family protein 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=684

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 88/136 (65%), Gaps = 16/136 (12%)
 Frame = +1

Query  289  ANGQIQP------ADRSFSPLIPDFMDPTLCYLPNgypy--yyggydgtgNEWEGYPRYV  444
            ANG+  P        RS +PL+ + MD ++CY PNGY    YYGGYD +  EWE YPRYV
Sbjct  46   ANGRELPIAPIPTCKRSLTPLLQEHMDASMCYFPNGYTSPFYYGGYDASITEWEDYPRYV  105

Query  445  NAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYF  624
            + +G+E  GVYGD    +YQHGYGY PY PYS   SPVPT+GH+ QLYG Q YQ+PT Y+
Sbjct  106  SPDGME--GVYGD----MYQHGYGYAPYTPYSAPGSPVPTLGHNSQLYGPQQYQFPTTYY  159

Query  625  QP--LTSGPYPTPAAP  666
                 TS PY T  AP
Sbjct  160  HSPAPTSAPYTTSQAP  175



>ref|NP_001169286.1| hypothetical protein [Zea mays]
 gb|ACN33287.1| unknown [Zea mays]
 gb|AFW89695.1| hypothetical protein ZEAMMB73_168477 [Zea mays]
Length=701

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 83/119 (70%), Gaps = 16/119 (13%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP L YLP    YYYGGYD + +EW+ YPRY+N++GVE+ P VYGD
Sbjct  78   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDSSMSEWDDYPRYLNSDGVEIAPAVYGD  134

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPATSPVPTV  DGQ++GAQHYQYPT YFQP    P P P+
Sbjct  135  IYGYGY------APYGAYSPATSPVPTV--DGQMFGAQHYQYPTTYFQP----PTPIPS  181



>ref|XP_010542475.1| PREDICTED: uncharacterized protein LOC104815674 [Tarenaya hassleriana]
Length=683

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 92/150 (61%), Gaps = 18/150 (12%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  402
            K LEI EP+KK +V    A  +NGQ+   DRS +PL+P D +DP++C++P+GY  YY G 
Sbjct  25   KTLEISEPSKKTAVYKYGAVDSNGQLSSFDRSLTPLLPSDALDPSVCFVPSGYQPYYFGG  84

Query  403  dgtgNEWEGYP--RYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPT---  564
             G G++W  Y    Y N +GV++  G+YG+N S+VYQ GYGY  Y          PT   
Sbjct  85   YGNGHDWTEYEYTGYANPDGVDVTSGIYGENGSIVYQQGYGYAAYQYS-------PTASP  137

Query  565  --VGHDGQLYGAQHYQYPTPYFQPLTSGPY  648
              VG D QLYGAQ Y+YP+ +    +SGP+
Sbjct  138  APVGSDEQLYGAQQYRYPSYFPSKTSSGPF  167



>gb|AFW89696.1| hypothetical protein ZEAMMB73_168477 [Zea mays]
Length=702

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 83/119 (70%), Gaps = 16/119 (13%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP L YLP    YYYGGYD + +EW+ YPRY+N++GVE+ P VYGD
Sbjct  78   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDSSMSEWDDYPRYLNSDGVEIAPAVYGD  134

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPATSPVPTV  DGQ++GAQHYQYPT YFQP    P P P+
Sbjct  135  IYGYGY------APYGAYSPATSPVPTV--DGQMFGAQHYQYPTTYFQP----PTPIPS  181



>ref|XP_002884968.1| hypothetical protein ARALYDRAFT_478733 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61227.1| hypothetical protein ARALYDRAFT_478733 [Arabidopsis lyrata subsp. 
lyrata]
Length=677

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 106/172 (62%), Gaps = 9/172 (5%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P+I
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPMI  61

Query  337  P-DFMDPTLCYLPNgyp-yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  507
            P D  DP++CY+P  Y  Y Y    G+G +W  Y  Y N EGV+M  G+YG+N ++VY  
Sbjct  62   PSDAADPSVCYVPTPYNPYQYYNAYGSGQDWTDYAAYTNPEGVDMNSGIYGENGTVVYPQ  121

Query  508  gygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            GYGY  Y      +   P +G +GQLYGAQ YQYP+ YF    SGPY +  A
Sbjct  122  GYGYATYPYSPATSP-APQLGGEGQLYGAQQYQYPS-YFP--NSGPYASSVA  169



>ref|XP_008351300.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X2 [Malus domestica]
Length=675

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 83/125 (66%), Gaps = 8/125 (6%)
 Frame = +1

Query  316  RSFSPLIPDFMDPTLCYLPNg---ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            +S +PL  DFM+P+ CYLPNG     YYYGGY GTGNEW G   YVN  G ++   VYGD
Sbjct  51   QSTAPLHKDFMNPSACYLPNGYTPSAYYYGGYGGTGNEWGGISSYVNPNGSDVNSAVYGD  110

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PT  654
            N S +Y HGYGY PY  YS + SPV TVG DGQLYG Q YQYP PYF+ L   SG + P 
Sbjct  111  NGSFMYHHGYGYXPYSTYSTSGSPVSTVGSDGQLYGPQQYQYP-PYFKQLKPNSGSHTPN  169

Query  655  PAAPA  669
             A P+
Sbjct  170  SAVPS  174



>ref|XP_008384358.1| PREDICTED: uncharacterized protein LOC103446969 isoform X2 [Malus 
domestica]
 ref|XP_008366131.1| PREDICTED: uncharacterized protein LOC103429777 isoform X2 [Malus 
domestica]
Length=675

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 82/125 (66%), Gaps = 8/125 (6%)
 Frame = +1

Query  316  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            RS +PL  +FMDP+ CYLPN      YYYGGYDGTGNEW G   YVN  G ++   VYGD
Sbjct  51   RSTAPLRKNFMDPSACYLPNGYTSSAYYYGGYDGTGNEWGGISSYVNPNGNDVNSAVYGD  110

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PT  654
              S +Y HGYGY PY  YS + SPV TVG DGQLYG Q YQYP PYF+ L   SG + P 
Sbjct  111  XGSFMYHHGYGYAPYSTYSTSGSPVSTVGSDGQLYGPQQYQYP-PYFKQLKPNSGSHTPN  169

Query  655  PAAPA  669
             A P+
Sbjct  170  SAVPS  174



>ref|XP_006445565.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 gb|ESR58805.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 gb|KDO54497.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
 gb|KDO54498.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=642

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 5/100 (5%)
 Frame = +1

Query  346  MDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHgy  513
            MDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGDN SL+Y HGY
Sbjct  1    MDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGDNGSLMYHHGY  60

Query  514  gytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL  633
            GY PY PYSPATSPVPT+G DGQLYG QHYQYP  YFQP+
Sbjct  61   GYAPYPPYSPATSPVPTMGTDGQLYGPQHYQYPH-YFQPI  99



>ref|XP_008366130.1| PREDICTED: uncharacterized protein LOC103429777 isoform X1 [Malus 
domestica]
Length=676

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 82/125 (66%), Gaps = 8/125 (6%)
 Frame = +1

Query  316  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            RS +PL  +FMDP+ CYLPN      YYYGGYDGTGNEW G   YVN  G ++   VYGD
Sbjct  52   RSTAPLRKNFMDPSACYLPNGYTSSAYYYGGYDGTGNEWGGISSYVNPNGNDVNSAVYGD  111

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PT  654
              S +Y HGYGY PY  YS + SPV TVG DGQLYG Q YQYP PYF+ L   SG + P 
Sbjct  112  XGSFMYHHGYGYAPYSTYSTSGSPVSTVGSDGQLYGPQQYQYP-PYFKQLKPNSGSHTPN  170

Query  655  PAAPA  669
             A P+
Sbjct  171  SAVPS  175



>ref|XP_009124755.1| PREDICTED: uncharacterized protein LOC103849773 [Brassica rapa]
Length=655

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 110/172 (64%), Gaps = 13/172 (8%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VA TADQ++++LQ L+LDSQ K  EIPEP KK +V      +  GQ+   DRS +PL+
Sbjct  2    ATVAQTADQSADMLQKLTLDSQPKGSEIPEP-KKAAVYQYGGVDMHGQVPSYDRSLTPLL  60

Query  337  P-DFMDPTLCYLPNgypy-yyggydgtgNEWEGYPRYV-NAEGVEMP-GVYGDNSSLVYQ  504
            P D  DP++CY+PN Y   +Y GY  +G +W  +  Y  N EGV+M  GVYG+N SLVY 
Sbjct  61   PSDAADPSVCYVPNAYQQPFYYGYGASGQDWSEFTGYNPNLEGVDMSAGVYGENGSLVY-  119

Query  505  HgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                     PYSPATSP P VG DGQLYGAQHYQYP   F P  +GP  TPA
Sbjct  120  -PGYGYAAYPYSPATSPAPQVGGDGQLYGAQHYQYPA--FFP--AGPVATPA  166



>gb|KFK38676.1| hypothetical protein AALP_AA3G146000 [Arabis alpina]
Length=685

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 88/151 (58%), Gaps = 8/151 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAA--NGQIQPADRSFSPLIP-DFMDPTLCYLP--Ngypyyyg  396
            KA EIPEP KK +V        NGQ+   DRS +P+ P D +DP++CY+P  N YP+YY 
Sbjct  25   KASEIPEPNKKTAVYQYGGVDLNGQVPSYDRSLTPMQPGDVVDPSVCYVPGMNAYPHYYY  84

Query  397  gydgtgNEWEGY-PRYVNAEGVEM-PGVYGDNSSLVYQHgygytpygpyspatspVPTVG  570
            G  GT  +W  Y   Y N EGV+M   +YG+N S+VY   YGY  Y      +   P VG
Sbjct  85   GAYGTSQDWSEYTAAYPNPEGVDMNTAIYGENGSVVYPQTYGYAQYPYSPATSP-APQVG  143

Query  571  HDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
             DGQLYGAQ YQYP  +    ++GPY +  A
Sbjct  144  GDGQLYGAQQYQYPAYFPHTASTGPYASSVA  174



>emb|CDY07089.1| BnaCnng01040D [Brassica napus]
Length=636

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 111/174 (64%), Gaps = 13/174 (7%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSP  330
            MA  VA TADQ++++LQ L+LDSQ KA EIPEP KK +V      +  GQ+   DRS +P
Sbjct  1    MATTVAQTADQSADMLQKLTLDSQPKASEIPEP-KKAAVYQYGGVDVHGQVPSYDRSLTP  59

Query  331  LIP-DFMDPTLCYLPNgypy-yyggydgtgNEWEGYPRYV-NAEGVEMP-GVYGDNSSLV  498
            L+P D  DP++CY+PN Y   +Y GY  +G +W  +  Y  + EGV+M  GVYG+N SLV
Sbjct  60   LLPSDAADPSVCYVPNAYQQPFYYGYGASGQDWSEFTGYNPSLEGVDMSAGVYGENGSLV  119

Query  499  YQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
            Y          PYSPATSP P VG DGQLYGAQ YQYP   F P  +GP  TPA
Sbjct  120  Y--PGYGYAAYPYSPATSPAPQVGGDGQLYGAQQYQYPA--FFP--AGPVATPA  167



>ref|XP_008645292.1| PREDICTED: uncharacterized protein LOC100383598 isoform X2 [Zea 
mays]
 gb|ACN27699.1| unknown [Zea mays]
Length=687

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 79/115 (69%), Gaps = 16/115 (14%)
 Frame = +1

Query  319  SFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSL  495
            S +P+I DF DP L YLP    YYYGGYD + +EW+ YPRY+N++GVE+ P VYGD    
Sbjct  75   SITPVIQDFTDPNLFYLP---AYYYGGYDSSMSEWDDYPRYLNSDGVEIAPAVYGDIYGY  131

Query  496  VYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
             Y       PYG YSPATSPVPTV  DGQ++GAQHYQYPT YFQP    P P P+
Sbjct  132  GY------APYGAYSPATSPVPTV--DGQMFGAQHYQYPTAYFQP----PTPVPS  174



>ref|NP_001169717.1| uncharacterized protein LOC100383598 [Zea mays]
 gb|ACN34636.1| unknown [Zea mays]
 tpg|DAA43447.1| TPA: hypothetical protein ZEAMMB73_193181 [Zea mays]
Length=690

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 79/115 (69%), Gaps = 16/115 (14%)
 Frame = +1

Query  319  SFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSL  495
            S +P+I DF DP L YLP    YYYGGYD + +EW+ YPRY+N++GVE+ P VYGD    
Sbjct  74   SITPVIQDFTDPNLFYLP---AYYYGGYDSSMSEWDDYPRYLNSDGVEIAPAVYGDIYGY  130

Query  496  VYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
             Y       PYG YSPATSPVPTV  DGQ++GAQHYQYPT YFQP    P P P+
Sbjct  131  GY------APYGAYSPATSPVPTV--DGQMFGAQHYQYPTAYFQP----PTPVPS  173



>ref|XP_008645285.1| PREDICTED: uncharacterized protein LOC100383598 isoform X1 [Zea 
mays]
 tpg|DAA43448.1| TPA: hypothetical protein ZEAMMB73_193181 [Zea mays]
Length=691

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 79/115 (69%), Gaps = 16/115 (14%)
 Frame = +1

Query  319  SFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSL  495
            S +P+I DF DP L YLP    YYYGGYD + +EW+ YPRY+N++GVE+ P VYGD    
Sbjct  75   SITPVIQDFTDPNLFYLP---AYYYGGYDSSMSEWDDYPRYLNSDGVEIAPAVYGDIYGY  131

Query  496  VYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
             Y       PYG YSPATSPVPTV  DGQ++GAQHYQYPT YFQP    P P P+
Sbjct  132  GY------APYGAYSPATSPVPTV--DGQMFGAQHYQYPTAYFQP----PTPVPS  174



>ref|NP_001280968.1| YTH domain-containing family protein 2-like [Malus domestica]
 gb|AHN05779.1| YTH domain-contained RNA binding protein 2 [Malus domestica]
Length=676

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 82/125 (66%), Gaps = 8/125 (6%)
 Frame = +1

Query  316  RSFSPLIPDFMDPTLCYLPNg---ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            +S +PL  DFM+P+ CYLPNG     YYYGGY GTGNEW     YVN  G ++   VYGD
Sbjct  52   QSTAPLHKDFMNPSACYLPNGYTPSAYYYGGYGGTGNEWGRISSYVNPNGSDVNSAVYGD  111

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY-PT  654
            N S +Y HGYGY PY  YS + SPV TVG DGQLYG Q YQYP PYF+ L   SG + P 
Sbjct  112  NGSFMYHHGYGYAPYSTYSTSGSPVSTVGSDGQLYGPQQYQYP-PYFKQLKPNSGSHTPN  170

Query  655  PAAPA  669
             A P+
Sbjct  171  SAVPS  175



>ref|XP_009603414.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009603416.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009603417.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=662

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 112/182 (62%), Gaps = 29/182 (16%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS------VDSTHAANGQIQPADRSF  324
            AAV P++DQT++LLQ L LDS+ K+L+  + TK+VS      V+    ANG  +P +RS 
Sbjct  2    AAVVPSSDQTADLLQDLHLDSENKSLQARDSTKQVSSVQYAPVEPGTMANGMNKPFERST  61

Query  325  SPLIPDFMDPTLCYLPNgypy---------yyggydgtgNEWEGYPRYVNAEGVEMP-GV  474
            SP   DF  P++ Y PNGY           Y G    +GNEW+G+    +A+GVEMP G+
Sbjct  62   SPFNQDFTGPSMFYSPNGYTSPTYPSSTYYYGGYDGSSGNEWDGF---ASADGVEMPQGM  118

Query  475  YGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY  648
            +GD     YQHGYGY PYG YSP+ S V   GHD QLYG Q YQYP+ YFQ    TSG Y
Sbjct  119  FGD-----YQHGYGYAPYGTYSPSGSHV---GHDRQLYGPQQYQYPSSYFQSASSTSGSY  170

Query  649  PT  654
            P+
Sbjct  171  PS  172



>ref|XP_009146490.1| PREDICTED: uncharacterized protein LOC103870130 [Brassica rapa]
Length=644

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 80/132 (61%), Gaps = 7/132 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  402
            KA EIPEP KK +V      +  GQ+   DRS +PL+P D +DP++CY+PN YP +Y G 
Sbjct  22   KASEIPEPNKKTAVYQYGGVDSHGQVPTYDRSLTPLLPSDAVDPSVCYVPNAYPQFYYGG  81

Query  403  dgtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDG  579
             G   +W  Y  Y N EGV+M  G+YG+N S+VY   YGY  Y      +   P VG DG
Sbjct  82   YGN-GDWSEYTGYQNPEGVDMSSGIYGENGSIVYPQSYGYAAYPYSPATSPG-PQVGGDG  139

Query  580  QLYGA-QHYQYP  612
            QLYGA Q YQYP
Sbjct  140  QLYGAQQQYQYP  151



>emb|CDY43989.1| BnaA05g25840D [Brassica napus]
Length=634

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 80/132 (61%), Gaps = 7/132 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  402
            KA EIPEP KK +V      +  GQ+   DRS +PL+P D +DP++CY+PN YP +Y G 
Sbjct  12   KASEIPEPNKKTAVYQYGGVDSHGQVPTYDRSLTPLLPSDAVDPSVCYVPNAYPQFYYGG  71

Query  403  dgtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDG  579
             G   +W  Y  Y N EGV+M  G+YG+N S+VY   YGY  Y      +   P VG DG
Sbjct  72   YGN-GDWSEYTGYQNPEGVDMSSGIYGENGSIVYPQSYGYAAYPYSPATSPG-PQVGGDG  129

Query  580  QLYGA-QHYQYP  612
            QLYGA Q YQYP
Sbjct  130  QLYGAQQQYQYP  141



>ref|XP_010229176.1| PREDICTED: uncharacterized protein LOC100841677 isoform X3 [Brachypodium 
distachyon]
Length=750

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 81/119 (68%), Gaps = 16/119 (13%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  72   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSMSEWDEYPRYVNQDGVEVAPAVYGD  128

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++ AQHYQYP  Y+QP    P P P+
Sbjct  129  IYGYGY------APYGAYSPASSPVPTV--DGQMFAAQHYQYPAAYYQP----PTPVPS  175



>ref|XP_003558773.1| PREDICTED: uncharacterized protein LOC100841677 isoform X1 [Brachypodium 
distachyon]
Length=751

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 81/119 (68%), Gaps = 16/119 (13%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  73   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSMSEWDEYPRYVNQDGVEVAPAVYGD  129

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++ AQHYQYP  Y+QP    P P P+
Sbjct  130  IYGYGY------APYGAYSPASSPVPTV--DGQMFAAQHYQYPAAYYQP----PTPVPS  176



>emb|CDY24182.1| BnaC01g37620D [Brassica napus]
Length=541

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 109/174 (63%), Gaps = 13/174 (7%)
 Frame = +1

Query  157  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSP  330
            MA  VA +ADQ++++LQ L+LDSQ K  EIPEP KK +V      +   Q+   DRS +P
Sbjct  1    MATTVAQSADQSADMLQKLTLDSQPKGSEIPEP-KKAAVYQYGGVDVHSQVPSYDRSLTP  59

Query  331  LIP-DFMDPTLCYLPNgypy-yyggydgtgNEWEGYPRYV-NAEGVEMP-GVYGDNSSLV  498
            L+P D  DP++CY+PN Y   +Y GY  +G +W  +  Y  N EGV+M  GVYG+N SLV
Sbjct  60   LLPSDAADPSVCYVPNAYQQPFYYGYGASGQDWSEFTGYNPNLEGVDMSAGVYGENGSLV  119

Query  499  YQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
            Y          PYSPATSP P VG DGQLYGAQ YQYP   F P  +GP  TPA
Sbjct  120  Y--PGYGYAAYPYSPATSPAPQVGGDGQLYGAQQYQYPA--FFP--TGPVATPA  167



>ref|XP_010229175.1| PREDICTED: uncharacterized protein LOC100841677 isoform X2 [Brachypodium 
distachyon]
Length=750

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 81/119 (68%), Gaps = 16/119 (13%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  72   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSMSEWDEYPRYVNQDGVEVAPAVYGD  128

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++ AQHYQYP  Y+QP    P P P+
Sbjct  129  IYGYGY------APYGAYSPASSPVPTV--DGQMFAAQHYQYPAAYYQP----PTPVPS  175



>ref|XP_009797483.1| PREDICTED: uncharacterized protein LOC104243907 isoform X2 [Nicotiana 
sylvestris]
Length=642

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 112/187 (60%), Gaps = 29/187 (16%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS------VDSTHAANGQIQPADRSF  324
            AAV P++DQT++LLQ L LDS+ K+L+  + TK+VS      V+    ANG  +P +R  
Sbjct  2    AAVVPSSDQTADLLQDLHLDSENKSLQARDSTKQVSSVQYAPVEPGTMANGMNKPFERPI  61

Query  325  SPLIPDFMDPTLCYLPNgypy---------yyggydgtgNEWEGYPRYVNAEGVEMP-GV  474
            SP   DF  P++ Y PNGY           Y G    +GNEW+G     +A+GVEMP G+
Sbjct  62   SPFNQDFTGPSMFYSPNGYTSPTYPSSTYYYGGYDGSSGNEWDGL---ASADGVEMPQGM  118

Query  475  YGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY  648
            +GD     YQHGYGY PYG YSP+ S V   GHD QLYG Q YQYP+ YFQ    TSG Y
Sbjct  119  FGD-----YQHGYGYAPYGTYSPSGSHV---GHDRQLYGPQQYQYPSSYFQSASSTSGSY  170

Query  649  PTPAAPA  669
            P+  A +
Sbjct  171  PSNQAES  177



>gb|AAY44715.1| unknown [Arabidopsis thaliana]
Length=652

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 98/171 (57%), Gaps = 22/171 (13%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  336
            A VAP ADQ ++LLQ LSLDS  KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQATDLLQKLSLDSPAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  337  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQHg  510
            P D  DP++               G+G EW  YP Y N EGV+M  G+YG+N ++VY  G
Sbjct  62   PSDAADPSV--------------YGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVYPQG  107

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPAA  663
            YGY  Y      +   P +G +GQLYGAQ YQYP  YF    SGPY +  A
Sbjct  108  YGYAAYPYSPATSP-APQLGGEGQLYGAQQYQYPN-YFP--NSGPYASSVA  154



>ref|NP_001049022.1| Os03g0158500 [Oryza sativa Japonica Group]
 gb|ABF94075.1| YT521-B-like family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10936.1| Os03g0158500 [Oryza sativa Japonica Group]
 gb|EEE58351.1| hypothetical protein OsJ_09476 [Oryza sativa Japonica Group]
Length=707

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 82/119 (69%), Gaps = 17/119 (14%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  80   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEITPAVYGD  136

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++G QHYQYPT Y+QP    P P P+
Sbjct  137  IYGYGY------APYGAYSPASSPVPTV--DGQMFG-QHYQYPTSYYQP----PTPVPS  182



>gb|ABF94073.1| YT521-B-like family protein, expressed [Oryza sativa Japonica 
Group]
 gb|AGT42303.1| YT521-B-like family protein [Oryza sativa Japonica Group]
Length=708

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 82/119 (69%), Gaps = 17/119 (14%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  81   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEITPAVYGD  137

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++G QHYQYPT Y+QP    P P P+
Sbjct  138  IYGYGY------APYGAYSPASSPVPTV--DGQMFG-QHYQYPTSYYQP----PTPVPS  183



>gb|EEC74554.1| hypothetical protein OsI_10095 [Oryza sativa Indica Group]
Length=707

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 82/119 (69%), Gaps = 17/119 (14%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  80   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEITPAVYGD  136

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++G QHYQYPT Y+QP    P P P+
Sbjct  137  IYGYGY------APYGAYSPASSPVPTV--DGQMFG-QHYQYPTSYYQP----PTPVPS  182



>gb|ABF94076.1| YT521-B-like family protein, expressed [Oryza sativa Japonica 
Group]
Length=648

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 82/119 (69%), Gaps = 17/119 (14%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  80   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEITPAVYGD  136

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++G QHYQYPT Y+QP    P P P+
Sbjct  137  IYGYGY------APYGAYSPASSPVPTV--DGQMFG-QHYQYPTSYYQP----PTPVPS  182



>gb|KDP39708.1| hypothetical protein JCGZ_02728 [Jatropha curcas]
Length=663

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 103/173 (60%), Gaps = 26/173 (15%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVD---STHAANGQIQPADRSFSPL  333
            AAVA  +DQ S +L++LSLDSQTK +EIPEP KK+S     S+  A    +P +RS + L
Sbjct  2    AAVASPSDQVSGMLENLSLDSQTKTIEIPEPAKKLSTSQYGSSDLATNTAKPLNRSTTHL  61

Query  334  IPD---------FMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDN  486
              D         +  P  CY         GGYDG  N W  Y RYVN +     G+YG+N
Sbjct  62   HVDQNAYYYPSGYPSPAYCY---------GGYDGHDNGWNDYSRYVNHD----EGIYGNN  108

Query  487  SSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQ-PLTSG  642
             + +Y  GYGYT +G Y    S VPT+G+DGQLYG +HYQYP+P++Q P+ +G
Sbjct  109  ETAMYPQGYGYTSFGTYPSVDSTVPTMGNDGQLYGTEHYQYPSPFYQAPIANG  161



>gb|AAD10646.1| Hypothetical protein [Arabidopsis thaliana]
Length=580

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 98/167 (59%), Gaps = 23/167 (14%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  336
            + VAP ADQ +++L+ LSLDS+++ LEIPEPTKK  V    A  +NGQ+   DRS SP++
Sbjct  2    STVAPPADQAADVLKKLSLDSKSRTLEIPEPTKKTGVYQYGAMDSNGQVPSFDRSLSPML  61

Query  337  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgy  513
            P D +DP++ Y+PN Y   Y    G+      Y  Y N+E V+M   YG           
Sbjct  62   PSDALDPSVFYVPNVYQQPYYYGYGSD-----YTGYTNSESVDMTSGYG-----------  105

Query  514  gytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPT  654
                  PYSPATSP P +G DGQLYGAQ YQYP P     +SGP+ +
Sbjct  106  --YAAFPYSPATSPAPQLGGDGQLYGAQQYQYPFPL--TASSGPFAS  148



>ref|XP_009797480.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009797481.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009797482.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Nicotiana sylvestris]
Length=662

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 110/182 (60%), Gaps = 29/182 (16%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS------VDSTHAANGQIQPADRSF  324
            AAV P++DQT++LLQ L LDS+ K+L+  + TK+VS      V+    ANG  +P +R  
Sbjct  2    AAVVPSSDQTADLLQDLHLDSENKSLQARDSTKQVSSVQYAPVEPGTMANGMNKPFERPI  61

Query  325  SPLIPDFMDPTLCYLPNgypy---------yyggydgtgNEWEGYPRYVNAEGVEMP-GV  474
            SP   DF  P++ Y PNGY           Y G    +GNEW+G     +A+GVEMP G+
Sbjct  62   SPFNQDFTGPSMFYSPNGYTSPTYPSSTYYYGGYDGSSGNEWDGL---ASADGVEMPQGM  118

Query  475  YGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL--TSGPY  648
            +GD     YQHGYGY PYG YSP+ S V   GHD QLYG Q YQYP+ YFQ    TSG Y
Sbjct  119  FGD-----YQHGYGYAPYGTYSPSGSHV---GHDRQLYGPQQYQYPSSYFQSASSTSGSY  170

Query  649  PT  654
            P+
Sbjct  171  PS  172



>ref|NP_001185241.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33255.1| uncharacterized protein AT1G55500 [Arabidopsis thaliana]
Length=592

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 98/167 (59%), Gaps = 23/167 (14%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  336
            + VAP ADQ +++L+ LSLDS+++ LEIPEPTKK  V    A  +NGQ+   DRS SP++
Sbjct  2    STVAPPADQAADVLKKLSLDSKSRTLEIPEPTKKTGVYQYGAMDSNGQVPSFDRSLSPML  61

Query  337  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgy  513
            P D +DP++ Y+PN Y   Y    G+      Y  Y N+E V+M   YG           
Sbjct  62   PSDALDPSVFYVPNVYQQPYYYGYGSD-----YTGYTNSESVDMTSGYG-----------  105

Query  514  gytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPT  654
                  PYSPATSP P +G DGQLYGAQ YQYP P     +SGP+ +
Sbjct  106  --YAAFPYSPATSPAPQLGGDGQLYGAQQYQYPFPL--TASSGPFAS  148



>ref|XP_006651059.1| PREDICTED: uncharacterized protein LOC102715747, partial [Oryza 
brachyantha]
Length=680

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 82/119 (69%), Gaps = 17/119 (14%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  50   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEIAPAVYGD  106

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 Y       PYG YSPA+SPVPTV  DGQ++G QHYQYPT Y+QP    P P P+
Sbjct  107  IYGYGY------APYGAYSPASSPVPTV--DGQMFG-QHYQYPTSYYQP----PTPVPS  152



>gb|AAN06837.1| Putative RNA-binding protein [Oryza sativa Japonica Group]
Length=716

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 76/125 (61%), Gaps = 20/125 (16%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydg------tgNEWEGYPRYVNAEGVEM-  465
            P +RS +P++ DFMDP + YLP  Y      +        + +EW+ YPRYVN +GVE+ 
Sbjct  80   PPERSITPVLQDFMDPNMFYLPAYYYGELCWFAKLPGYDGSVSEWDDYPRYVNPDGVEIT  139

Query  466  PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGP  645
            P VYGD     Y       PYG YSPA+SPVPTV  DGQ++G QHYQYPT Y+QP    P
Sbjct  140  PAVYGDIYGYGY------APYGAYSPASSPVPTV--DGQMFG-QHYQYPTSYYQP----P  186

Query  646  YPTPA  660
             P P+
Sbjct  187  TPVPS  191



>ref|XP_008805376.1| PREDICTED: YTH domain-containing family protein 2-like [Phoenix 
dactylifera]
Length=624

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 71/110 (65%), Gaps = 15/110 (14%)
 Frame = +1

Query  346  MDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEMP--GVYGDNSSLVYQHg  510
            MD ++CY+P+      YYYGGYDG  NEW+ + RY N +GVEMP  GVYGD    +Y HG
Sbjct  1    MDASMCYIPSGYPSTTYYYGGYDGAMNEWKDFARYANPDGVEMPPPGVYGD----LYHHG  56

Query  511  ygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
            YGY PYG Y    S V T+G DGQLYG QHYQYP  Y+Q       PTPA
Sbjct  57   YGYAPYGAYPSPGSTVATMGRDGQLYGPQHYQYPAQYYQT------PTPA  100



>dbj|BAK04671.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 13/109 (12%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P DRS +P++ DF DP + YLP    YYYGGYDGT +EW+ Y RYVN +GVE+ P VYGD
Sbjct  76   PQDRSITPVVQDFTDPNMFYLP---AYYYGGYDGTMSEWDEYTRYVNQDGVEVAPAVYGD  132

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP  630
                 Y       PYG YSPA+SPVPTV  DGQ++ AQHYQYP  Y+QP
Sbjct  133  IYGYGY------APYGAYSPASSPVPTV--DGQMFAAQHYQYPA-YYQP  172



>gb|EMT25443.1| hypothetical protein F775_28207 [Aegilops tauschii]
Length=717

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 76/111 (68%), Gaps = 13/111 (12%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P DRS +P++ DF DP + YLP    YYYGGYDGT +EW+ Y RYVN +GVE+ P VYGD
Sbjct  36   PQDRSITPVVQDFTDPNMFYLP---AYYYGGYDGTMSEWDEYTRYVNQDGVEVTPAVYGD  92

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLT  636
                 Y       PYG YSPA+SPVPTV  DGQ++ AQHYQYP  Y+QP T
Sbjct  93   IYGYGY------APYGAYSPASSPVPTV--DGQMFAAQHYQYPA-YYQPPT  134



>dbj|BAJ96028.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=758

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 13/109 (12%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P DRS +P++ DF DP + YLP    YYYGGYDGT +EW+ Y RYVN +GVE+ P VYGD
Sbjct  77   PQDRSITPVVQDFTDPNMFYLP---AYYYGGYDGTMSEWDEYTRYVNQDGVEVAPAVYGD  133

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP  630
                 Y       PYG YSPA+SPVPTV  DGQ++ AQHYQYP  Y+QP
Sbjct  134  IYGYGY------APYGAYSPASSPVPTV--DGQMFAAQHYQYPA-YYQP  173



>emb|CDX82538.1| BnaA03g32830D [Brassica napus]
Length=640

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 68/132 (52%), Gaps = 23/132 (17%)
 Frame = +1

Query  235  ALEIPEPTKKV-----SVDSTHAANGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyg  396
            A EIPEP K        VD     NGQ+   DRS +PL+P D +DP++CY+PN Y   + 
Sbjct  28   ASEIPEPKKTAVYQYGGVD----LNGQVPSFDRSLTPLLPSDAVDPSVCYVPNAYQQPFY  83

Query  397  gydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHD  576
                   +W  Y  Y   EGV+M   YG                 PYSPATSP P VG D
Sbjct  84   YGGYGTGDWSEYTGYQTPEGVDMTSGYG-------------YAAYPYSPATSPAPQVGGD  130

Query  577  GQLYGAQHYQYP  612
            GQLYGAQ YQYP
Sbjct  131  GQLYGAQQYQYP  142



>emb|CDX75712.1| BnaC03g37950D [Brassica napus]
Length=634

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 71/133 (53%), Gaps = 24/133 (18%)
 Frame = +1

Query  235  ALEIPEPTKKV-----SVDSTHAANGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyg  396
            A EIPEP K        VD     NGQ+   DRS SPL+P D +DP++CY+PN Y   + 
Sbjct  28   ASEIPEPKKTAVYQYGGVD----LNGQVPSFDRSLSPLLPSDAVDPSVCYVPNAYQQPFY  83

Query  397  gydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHD  576
               G   +W  Y  Y N EGV+M   YG                 PYSPATSP P VG D
Sbjct  84   YGYGN-GDWSEYTGYQNPEGVDMNSGYG-------------YAAYPYSPATSPAPQVGGD  129

Query  577  GQLYGAQHYQYPT  615
            GQL+GAQ YQYPT
Sbjct  130  GQLFGAQQYQYPT  142



>gb|EMS56337.1| YTH domain family protein 2 [Triticum urartu]
Length=947

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 13/109 (12%)
 Frame = +1

Query  307  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  483
            P DRS +P++ DF DP + YLP    YYYGGYDGT +EW+ Y RYVN +GVE+ P VYGD
Sbjct  34   PQDRSITPVVQDFTDPNMFYLP---AYYYGGYDGTMSEWDEYTRYVNQDGVEVTPAVYGD  90

Query  484  NSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP  630
                 Y       PYG YSPA+SPVPTV  DGQ++ AQHYQYP  Y+QP
Sbjct  91   IYGYGY------APYGAYSPASSPVPTV--DGQMFAAQHYQYPA-YYQP  130



>gb|KDO54496.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=637

 Score = 58.9 bits (141),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 53/72 (74%), Gaps = 10/72 (14%)
 Frame = +1

Query  418  EWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQ  597
            EW+ Y RY         GVYGDN SL+Y HGYGY PY PYSPATSPVPT+G DGQLYG Q
Sbjct  33   EWDDYTRY---------GVYGDNGSLMYHHGYGYAPYPPYSPATSPVPTMGTDGQLYGPQ  83

Query  598  HYQYPTPYFQPL  633
            HYQYP  YFQP+
Sbjct  84   HYQYPH-YFQPI  94


 Score = 28.1 bits (61),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 3/30 (10%)
 Frame = +2

Query  341  ISWIQLCAIFLMVIHTIMEDMMGQAMSGRD  430
            ISW ++CA+F MVI  ++  M    +SG D
Sbjct  2    ISWTRICAMFPMVIPQLLSTM---GVSGYD  28



>emb|CDY23602.1| BnaC05g39920D [Brassica napus]
Length=624

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 5/94 (5%)
 Frame = +1

Query  232  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  402
            KA EIPEP KK +V      +  GQ+   DRS +PL+P D +DP++CY+PN    ++   
Sbjct  12   KASEIPEPNKKTAVYQYGGVDSHGQVPTYDRSLTPLLPTDAVDPSVCYVPN-AYPHFYYG  70

Query  403  dgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  501
                 +W  Y  Y N EGV+M  G+YG+N S+VY
Sbjct  71   GYGNGDWSEYTGYQNPEGVDMSSGIYGENGSIVY  104



>gb|ABF94074.1| YT521-B-like family protein, expressed [Oryza sativa Japonica 
Group]
Length=620

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 17/111 (15%)
 Frame = +1

Query  331  LIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  507
            ++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD     Y  
Sbjct  1    MLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEITPAVYGDIYGYGY--  55

Query  508  gygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGPYPTPA  660
                 PYG YSPA+SPVPTV  DGQ++G QHYQYPT Y+QP    P P P+
Sbjct  56   ----APYGAYSPASSPVPTV--DGQMFG-QHYQYPTSYYQP----PTPVPS  95



>ref|XP_003553331.1| PREDICTED: uncharacterized protein LOC100818027 isoform X1 [Glycine 
max]
Length=659

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 95/157 (61%), Gaps = 14/157 (9%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS-VDSTHAANGQIQPADRSFSPLIP  339
            AAVAP++D+T++LLQ+L+LDS++KA+ + EP KK     S  AA G+ +P          
Sbjct  2    AAVAPSSDKTADLLQNLTLDSESKAIGVAEPAKKNGPAFSNGAAKGRAKP----------  51

Query  340  DFMDPTLCYLPNgy-pyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgyg  516
               +P  C++PNGY   YY G      +W  Y RY+N +G    GVYGD+ S +Y  GYG
Sbjct  52   --FNPNSCFVPNGYPSAYYYGGYDGQGDWNAYSRYMNLDGGMAQGVYGDSCSYMYHQGYG  109

Query  517  ytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQ  627
            YTPYG Y+P  S  P +  DGQ YG Q YQYP  Y++
Sbjct  110  YTPYGTYAPPNSSSPMIQQDGQHYGLQQYQYPCSYYK  146



>ref|XP_009397705.1| PREDICTED: uncharacterized protein LOC103982492 [Musa acuminata 
subsp. malaccensis]
Length=667

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 98/160 (61%), Gaps = 23/160 (14%)
 Frame = +1

Query  160  AAAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQP------ADRS  321
            A A AP ADQT++L++ LSLDS+  + +  E TKK S     + NG+  P      ++RS
Sbjct  3    AVAPAPLADQTTDLMRKLSLDSKNMSSDASEVTKKPSGVQYGSVNGREAPMVSIPTSERS  62

Query  322  FSPLIPDFMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMP--GVYGDNS  489
             +PL+ + +D ++ Y PNG+   +  GGYDG+  EWE YPRYV+ +G E+P  GVYGD  
Sbjct  63   LTPLLQEHLDTSMFYYPNGHASSFYYGGYDGSATEWEAYPRYVSPDGSEVPPLGVYGD--  120

Query  490  SLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQY  609
              +Y HGYGY  YG         P +GH+ QLYG QHYQ+
Sbjct  121  --MYHHGYGYASYG---------PWLGHNSQLYGPQHYQF  149



>ref|XP_003624620.1| YTH domain family protein [Medicago truncatula]
Length=517

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  421  WEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQH  600
            W GY  YVN +G    GVYGDN S +Y  GYGYTPYG Y+   S  P V HDGQ+YG Q 
Sbjct  82   WSGYSNYVNLDGGMTQGVYGDNCSYMYHQGYGYTPYGAYASPNSSSPVVQHDGQMYGLQQ  141

Query  601  YQYPTPYFQPLTS  639
            YQYP  Y+   TS
Sbjct  142  YQYPCSYYNSPTS  154



>ref|XP_009135306.1| PREDICTED: uncharacterized protein LOC103859518 [Brassica rapa]
Length=639

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 71/129 (55%), Gaps = 18/129 (14%)
 Frame = +1

Query  235  ALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggyd  405
            A EIPEP KK +V      +  GQ+   DRS +PL+P D +DP++CY+PN Y   +    
Sbjct  28   ASEIPEP-KKTAVYQYGGVDLSGQVPSFDRSLTPLLPSDAVDPSVCYVPNAYQQPFYYGY  86

Query  406  gtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQL  585
            GT  +W  Y  Y   EGV+M   YG                 PYSPATSP P VG DGQL
Sbjct  87   GT-GDWSEYTGYQTPEGVDMTSGYG-------------YAAYPYSPATSPAPQVGGDGQL  132

Query  586  YGAQHYQYP  612
            YGAQ YQYP
Sbjct  133  YGAQQYQYP  141



>ref|XP_003624622.1| YTH domain family protein [Medicago truncatula]
 gb|AES80840.1| evolutionarily carboxy-terminal region protein [Medicago truncatula]
Length=659

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  421  WEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQH  600
            W GY  YVN +G    GVYGDN S +Y  GYGYTPYG Y+   S  P V HDGQ+YG Q 
Sbjct  79   WSGYSNYVNLDGGMTQGVYGDNCSYMYHQGYGYTPYGAYASPNSSSPVVQHDGQMYGLQQ  138

Query  601  YQYPTPYFQPLTS  639
            YQYP  Y+   TS
Sbjct  139  YQYPCSYYNSPTS  151



>ref|XP_003624619.1| YTH domain family protein [Medicago truncatula]
 gb|ABN09800.1| YT521-B-like protein [Medicago truncatula]
Length=662

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  421  WEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQH  600
            W GY  YVN +G    GVYGDN S +Y  GYGYTPYG Y+   S  P V HDGQ+YG Q 
Sbjct  82   WSGYSNYVNLDGGMTQGVYGDNCSYMYHQGYGYTPYGAYASPNSSSPVVQHDGQMYGLQQ  141

Query  601  YQYPTPYFQPLTS  639
            YQYP  Y+   TS
Sbjct  142  YQYPCSYYNSPTS  154



>gb|KHN34709.1| YTH domain family protein 1 [Glycine soja]
Length=669

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 95/157 (61%), Gaps = 4/157 (3%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK-VSVDSTHAANGQIQPADRSFSPLIP  339
            AAVAP++D+T++LLQ+L+LDS++KA+ + EP KK +   S H  NG       +     P
Sbjct  2    AAVAPSSDKTADLLQNLTLDSESKAIGVAEPAKKALHCFSFHCFNGPAFSNGAAKGRAKP  61

Query  340  DFMDPTLCYLPNgy-pyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgyg  516
               +P  C++PNGY   YY G      +W  Y RY+N +G    GVYGD+ S +Y  GYG
Sbjct  62   --FNPNSCFVPNGYPSAYYYGGYDGQGDWNAYSRYMNLDGGMAQGVYGDSCSYMYHQGYG  119

Query  517  ytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQ  627
            YTPYG Y+P  S  P +  DGQ YG Q YQYP  Y++
Sbjct  120  YTPYGTYAPPNSSSPMIQQDGQHYGLQQYQYPCSYYK  156



>ref|XP_002891837.1| hypothetical protein ARALYDRAFT_337630 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68096.1| hypothetical protein ARALYDRAFT_337630 [Arabidopsis lyrata subsp. 
lyrata]
Length=586

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 65/112 (58%), Gaps = 8/112 (7%)
 Frame = +1

Query  289  ANGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM  465
            + GQ+   DRS SP++P D +DP++ Y+PN Y   Y    G+      Y  Y N+E V+M
Sbjct  18   SKGQVPSFDRSLSPMLPSDALDPSVFYVPNVYQQPYFYGYGSD-----YTGYTNSESVDM  72

Query  466  -PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTP  618
              G YG+N+SL Y  GYGY  Y      +   P +G DGQLYGAQ YQYP P
Sbjct  73   TSGAYGENASLAYPQGYGYATYPYSPATSP-APQLGGDGQLYGAQQYQYPFP  123



>ref|XP_006650583.1| PREDICTED: probable ATP-dependent RNA helicase ddx17-like [Oryza 
brachyantha]
Length=624

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 71/136 (52%), Gaps = 19/136 (14%)
 Frame = +1

Query  277  STHAANGQI--QPADRSFSPLIPDFMDPTLCYLPNgypyyy----ggydgtgNEWEGYPR  438
            S  A + QI   P DRS +PL+ + +D  + Y  NGY         GYDG+GNEW+   R
Sbjct  5    SASAVDAQIVASPVDRSITPLLQEAVDANILYQTNGYGPSAYYYPSGYDGSGNEWD--SR  62

Query  439  YVNAEGVEMP-GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPT  615
            Y   +G EMP  VYGD       +           P+ SPVPTVGHDGQ Y  QHYQYP 
Sbjct  63   YAGHDGAEMPPSVYGD------MYHGYGYAPYGPYPSGSPVPTVGHDGQSYNTQHYQYPG  116

Query  616  PYFQPLTSGPYPTPAA  663
             Y+Q     P PT A+
Sbjct  117  QYYQH----PAPTNAS  128



>ref|XP_004493150.1| PREDICTED: uncharacterized protein LOC101504344 isoform X1 [Cicer 
arietinum]
Length=659

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  418  EWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQ  597
            +W  Y  YVN +G    G+YGDN S +Y   Y YTPYG Y+   S  P V HDGQLYG Q
Sbjct  75   DWNAYSSYVNLDGGMAQGMYGDNCSYMYHQSYPYTPYGTYASPNSSSPLVQHDGQLYGLQ  134

Query  598  HYQYPTPYFQPLTS  639
             YQYP  Y++  TS
Sbjct  135  QYQYPGSYYKTPTS  148



>ref|XP_009764452.1| PREDICTED: uncharacterized protein LOC104216148 isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = +2

Query  455  ELRCLECMGTIVHLCISMGMV---TLHMALIHLLLPQCQLWDMMVSYMVLNTTSILHHIS  625
            ELRC E MGT   L I M MV   T+H   IHLLLP  QLW MM S M  + T+I     
Sbjct  2    ELRCPEFMGTTGRLSIIMAMVMHPTVH---IHLLLPLPQLWGMMASSMDHSNTTIRISSP  58

Query  626  SL*RVVHTLLLLP  664
            SL  V+HTLL LP
Sbjct  59   SLQPVIHTLLQLP  71



>ref|NP_564692.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK91441.1| At1g55500/T5A14_10 [Arabidopsis thaliana]
 gb|AAN72251.1| At1g55500/T5A14_10 [Arabidopsis thaliana]
 gb|AEE33253.1| uncharacterized protein AT1G55500 [Arabidopsis thaliana]
Length=549

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 67/123 (54%), Gaps = 21/123 (17%)
 Frame = +1

Query  289  ANGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM  465
            +NGQ+   DRS SP++P D +DP++ Y+PN Y   Y    G+      Y  Y N+E V+M
Sbjct  3    SNGQVPSFDRSLSPMLPSDALDPSVFYVPNVYQQPYYYGYGSD-----YTGYTNSESVDM  57

Query  466  PGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPLTSGP  645
               YG                 PYSPATSP P +G DGQLYGAQ YQYP P     +SGP
Sbjct  58   TSGYG-------------YAAFPYSPATSPAPQLGGDGQLYGAQQYQYPFPL--TASSGP  102

Query  646  YPT  654
            + +
Sbjct  103  FAS  105



>emb|CDP14325.1| unnamed protein product [Coffea canephora]
Length=580

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 100/167 (60%), Gaps = 24/167 (14%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS------VDSTHAANGQIQPADRSF  324
            AA++P++DQ +ELLQ LSLD+  K L+ PEPT K        VD  +  NG  +P +R+ 
Sbjct  2    AAISPSSDQAAELLQKLSLDTLDKPLQDPEPTNKTPAVQYAPVDIANQVNG-FKPFERTA  60

Query  325  SPLIPDFMDPTLCY----LPNgypyyyggydgtgNEWEGYPRYVNAEGVEMP-GVYGDNS  489
            +   PDFMDP++ Y     P+   YY G    + N+W+ Y    ++ GVEMP GVYGD  
Sbjct  61   TSPHPDFMDPSMFYNPAGYPSSTYYYGGFNGSSANDWDWYG---SSNGVEMPPGVYGD--  115

Query  490  SLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQP  630
               YQ+ YGYTPYG YS + S +     D  LYG QH+QYPT YFQP
Sbjct  116  ---YQNSYGYTPYGTYSSSGSAMRP---DNPLYGPQHFQYPT-YFQP  155



>gb|EPS63062.1| hypothetical protein M569_11723, partial [Genlisea aurea]
Length=510

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = +1

Query  469  GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL---TS  639
            G YG+N+ L+Y  GY Y+ Y PYSP  SPVP + HDGQLYG+Q YQYP+PYFQ +   T+
Sbjct  1    GAYGENTPLMYHPGYSYSHYPPYSPVGSPVPALAHDGQLYGSQQYQYPSPYFQSMAPPTN  60

Query  640  GPYPTPAA  663
            GPY  P A
Sbjct  61   GPYSNPTA  68



>ref|XP_009597426.1| PREDICTED: uncharacterized protein LOC104093384 isoform X3 [Nicotiana 
tomentosiformis]
Length=572

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = +2

Query  455  ELRCLECMGTIVHLCISMGMV---TLHMALIHLLLPQCQLWDMMVSYMVLNTTSILHHIS  625
            ELRCLE MG +  L I M MV   T+H   IH+L P  QLW MM S M  N T+I     
Sbjct  2    ELRCLEFMGIMGRLSIIMAMVMHPTVH---IHVLHPLPQLWGMMASSMDHNNTTIRISSP  58

Query  626  SL*RVVHTLLLLP  664
            SL  V+HTLL LP
Sbjct  59   SLQPVIHTLLQLP  71



>ref|XP_010652548.1| PREDICTED: uncharacterized protein LOC100249721 [Vitis vinifera]
Length=278

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 14/73 (19%)
 Frame = +1

Query  415  NEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYG  591
            NEW        ++GVEMP  VYGD    +Y HG+GY       P +  +PT+GHDGQLYG
Sbjct  7    NEW--------SDGVEMPPSVYGD----IYHHGFGYPYRTYPPPGSP-IPTMGHDGQLYG  53

Query  592  AQHYQYPTPYFQP  630
             QHY+YPTPY+QP
Sbjct  54   PQHYRYPTPYYQP  66



>ref|XP_006604223.1| PREDICTED: uncharacterized protein LOC100818027 isoform X2 [Glycine 
max]
Length=575

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 90/152 (59%), Gaps = 14/152 (9%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS-VDSTHAANGQIQPADRSFSPLIP  339
            AAVAP++D+T++LLQ+L+LDS++KA+ + EP KK     S  AA G+ +P          
Sbjct  2    AAVAPSSDKTADLLQNLTLDSESKAIGVAEPAKKNGPAFSNGAAKGRAKP----------  51

Query  340  DFMDPTLCYLPNgy-pyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQHgyg  516
               +P  C++PNGY   YY G      +W  Y RY+N +G    GVYGD+ S +Y  GYG
Sbjct  52   --FNPNSCFVPNGYPSAYYYGGYDGQGDWNAYSRYMNLDGGMAQGVYGDSCSYMYHQGYG  109

Query  517  ytpygpyspatspVPTVGHDGQLYGAQHYQYP  612
            YTPYG Y+P  S  P +  DGQ YG Q Y  P
Sbjct  110  YTPYGTYAPPNSSSPMIQQDGQHYGLQQYHLP  141



>ref|XP_010652549.1| PREDICTED: uncharacterized protein LOC104879848 [Vitis vinifera]
Length=319

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 45/73 (62%), Gaps = 14/73 (19%)
 Frame = +1

Query  415  NEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYG  591
            NEW         +GVEMP GVY D    +Y HG+GY       P +  VPT+GHDGQLYG
Sbjct  7    NEW--------GDGVEMPLGVYSD----IYHHGFGYPYRTYPPPGSP-VPTMGHDGQLYG  53

Query  592  AQHYQYPTPYFQP  630
             QHYQY TPY+QP
Sbjct  54   LQHYQYSTPYYQP  66



>ref|XP_008351313.1| PREDICTED: uncharacterized protein LOC103414704 isoform X4 [Malus 
domestica]
 ref|XP_008351320.1| PREDICTED: uncharacterized protein LOC103414704 isoform X4 [Malus 
domestica]
Length=581

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +1

Query  457  VEMPGVYGDNSSLVYQHgygytpygpyspatspVPTVGHDGQLYGAQHYQYPTPYFQPL-  633
            + M  VYGDN S +Y HGYGY PY  YS + SPV TVG DGQLYG Q YQYP PYF+ L 
Sbjct  8    ITMEAVYGDNGSFMYHHGYGYXPYSTYSTSGSPVSTVGSDGQLYGPQQYQYP-PYFKQLK  66

Query  634  -TSGPY-PTPAAPA  669
              SG + P  A P+
Sbjct  67   PNSGSHTPNSAVPS  80



>ref|NP_001051264.1| Os03g0748000 [Oryza sativa Japonica Group]
 gb|ABF98867.1| YT521-B-like family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13178.1| Os03g0748000 [Oryza sativa Japonica Group]
 gb|EEC76176.1| hypothetical protein OsI_13502 [Oryza sativa Indica Group]
 gb|EEE59928.1| hypothetical protein OsJ_12565 [Oryza sativa Japonica Group]
Length=661

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 74/156 (47%), Gaps = 19/156 (12%)
 Frame = +1

Query  163  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK---VSVDSTHAANGQ--IQPADRSFS  327
            AAVAP A   +  +         K    P+ TKK   +   S  A + Q    P DRS +
Sbjct  2    AAVAPGAGDQATDMMQKLSLESKKEGATPDATKKPAGMPYGSASAGDAQNAASPVDRSIT  61

Query  328  PLIPDFMDPTLCYLPNgypyyy----ggydgtgNEWEGYPRYVNAEGVEMP-GVYGDNSS  492
            PL+ + ++  + Y  NGY         GYDG+ NEW+   RY   +G EMP  VYGD   
Sbjct  62   PLLQEAVNANILYQTNGYGPSAYYYPTGYDGSANEWD--SRYAAHDGTEMPPSVYGDMYG  119

Query  493  LVYQHgygytpygpyspatspVPTVGHDGQLYGAQH  600
              Y             P+ SPVPTVGHDGQ YGAQH
Sbjct  120  YGY-------APYGPYPSGSPVPTVGHDGQSYGAQH  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780