BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF026A21

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095865.1|  PREDICTED: probable galacturonosyltransferase 4    139   3e-34   
ref|XP_011086294.1|  PREDICTED: probable galacturonosyltransferase 4    131   2e-31   Sesamum indicum [beniseed]
gb|EYU33824.1|  hypothetical protein MIMGU_mgv1a002625mg                124   3e-29   Erythranthe guttata [common monkey flower]
ref|XP_006350235.1|  PREDICTED: probable galacturonosyltransferas...    124   3e-29   Solanum tuberosum [potatoes]
ref|XP_010319211.1|  PREDICTED: probable galacturonosyltransferas...    124   7e-29   Solanum lycopersicum
ref|XP_006350232.1|  PREDICTED: probable galacturonosyltransferas...    123   1e-28   Solanum tuberosum [potatoes]
ref|XP_004236640.1|  PREDICTED: probable galacturonosyltransferas...    120   1e-27   Solanum lycopersicum
emb|CDP04556.1|  unnamed protein product                              97.1    2e-19   Coffea canephora [robusta coffee]
ref|XP_009802396.1|  PREDICTED: probable galacturonosyltransferas...  92.4    6e-18   Nicotiana sylvestris
ref|XP_009802392.1|  PREDICTED: probable galacturonosyltransferas...  90.5    3e-17   Nicotiana sylvestris
ref|XP_009610681.1|  PREDICTED: probable galacturonosyltransferase 4  90.1    4e-17   
ref|XP_008794742.1|  PREDICTED: probable galacturonosyltransferas...  89.4    5e-17   Phoenix dactylifera
ref|XP_008794740.1|  PREDICTED: probable galacturonosyltransferas...  89.4    6e-17   Phoenix dactylifera
ref|XP_008794738.1|  PREDICTED: probable galacturonosyltransferas...  87.4    3e-16   Phoenix dactylifera
ref|XP_010252974.1|  PREDICTED: probable galacturonosyltransferase 4  85.9    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_008794741.1|  PREDICTED: probable galacturonosyltransferas...  84.7    2e-15   Phoenix dactylifera
ref|XP_008794739.1|  PREDICTED: probable galacturonosyltransferas...  84.7    2e-15   Phoenix dactylifera
gb|KDP29029.1|  hypothetical protein JCGZ_16418                       84.0    4e-15   Jatropha curcas
ref|XP_008794737.1|  PREDICTED: probable galacturonosyltransferas...  82.8    1e-14   Phoenix dactylifera
ref|XP_008464310.1|  PREDICTED: probable galacturonosyltransferase 4  81.6    2e-14   Cucumis melo [Oriental melon]
ref|XP_010272524.1|  PREDICTED: probable galacturonosyltransferase 4  81.3    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_004168876.1|  PREDICTED: probable galacturonosyltransferas...  80.5    5e-14   
ref|XP_010052503.1|  PREDICTED: probable galacturonosyltransferas...  80.5    5e-14   Eucalyptus grandis [rose gum]
ref|XP_010942526.1|  PREDICTED: probable galacturonosyltransferas...  80.1    9e-14   Elaeis guineensis
ref|XP_007026430.1|  Galacturonosyltransferase 4 isoform 1            79.7    1e-13   Theobroma cacao [chocolate]
emb|CBI25859.3|  unnamed protein product                              78.6    1e-13   Vitis vinifera
ref|XP_010647027.1|  PREDICTED: probable galacturonosyltransferas...  79.3    1e-13   Vitis vinifera
gb|KJB67438.1|  hypothetical protein B456_010G190800                  79.0    2e-13   Gossypium raimondii
ref|XP_004139519.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...  79.0    2e-13   
gb|KGN65009.1|  hypothetical protein Csa_1G179740                     79.0    2e-13   Cucumis sativus [cucumbers]
ref|XP_010052506.1|  PREDICTED: probable galacturonosyltransferas...  79.0    2e-13   Eucalyptus grandis [rose gum]
gb|KJB67440.1|  hypothetical protein B456_010G190800                  78.6    2e-13   Gossypium raimondii
ref|XP_007026431.1|  Galacturonosyltransferase 4 isoform 2            78.6    3e-13   Theobroma cacao [chocolate]
gb|KJB67437.1|  hypothetical protein B456_010G190800                  78.6    3e-13   Gossypium raimondii
ref|XP_010052508.1|  PREDICTED: probable galacturonosyltransferas...  78.6    3e-13   
ref|XP_004499343.1|  PREDICTED: probable galacturonosyltransferas...  78.2    3e-13   Cicer arietinum [garbanzo]
ref|XP_002525229.1|  Glycosyltransferase QUASIMODO1, putative         77.8    4e-13   Ricinus communis
emb|CAN70213.1|  hypothetical protein VITISV_038741                   77.8    5e-13   Vitis vinifera
ref|XP_010647084.1|  PREDICTED: probable galacturonosyltransferase 4  76.3    2e-12   Vitis vinifera
ref|XP_004486385.1|  PREDICTED: probable galacturonosyltransferas...  75.9    2e-12   Cicer arietinum [garbanzo]
ref|XP_010942525.1|  PREDICTED: probable galacturonosyltransferas...  75.9    2e-12   Elaeis guineensis
ref|XP_011460080.1|  PREDICTED: probable galacturonosyltransferas...  75.5    2e-12   Fragaria vesca subsp. vesca
ref|XP_011460082.1|  PREDICTED: probable galacturonosyltransferas...  75.5    3e-12   Fragaria vesca subsp. vesca
ref|XP_010942524.1|  PREDICTED: probable galacturonosyltransferas...  75.1    3e-12   Elaeis guineensis
gb|EPS65589.1|  hypothetical protein M569_09187                       74.7    4e-12   Genlisea aurea
ref|XP_010647025.1|  PREDICTED: probable galacturonosyltransferas...  74.7    5e-12   Vitis vinifera
ref|XP_011460081.1|  PREDICTED: probable galacturonosyltransferas...  73.9    1e-11   Fragaria vesca subsp. vesca
ref|XP_003594361.1|  Galacturonosyltransferase                        73.2    1e-11   Medicago truncatula
gb|KDO78643.1|  hypothetical protein CISIN_1g005035mg                 72.8    2e-11   Citrus sinensis [apfelsine]
ref|XP_006467237.1|  PREDICTED: probable galacturonosyltransferas...  72.4    2e-11   Citrus sinensis [apfelsine]
gb|KDO78641.1|  hypothetical protein CISIN_1g005035mg                 72.4    3e-11   Citrus sinensis [apfelsine]
ref|XP_008782990.1|  PREDICTED: probable galacturonosyltransferase 4  71.2    6e-11   Phoenix dactylifera
ref|XP_003535002.1|  PREDICTED: probable galacturonosyltransferas...  71.2    6e-11   Glycine max [soybeans]
gb|KHN40761.1|  Putative galacturonosyltransferase 4                  71.2    7e-11   Glycine soja [wild soybean]
ref|XP_006449976.1|  hypothetical protein CICLE_v10014426mg           70.9    7e-11   Citrus clementina [clementine]
ref|XP_006449975.1|  hypothetical protein CICLE_v10014426mg           70.9    9e-11   
ref|XP_008224656.1|  PREDICTED: probable galacturonosyltransferase 4  70.5    1e-10   Prunus mume [ume]
gb|KHN40223.1|  Putative galacturonosyltransferase 4                  70.1    1e-10   Glycine soja [wild soybean]
ref|XP_006584115.1|  PREDICTED: probable galacturonosyltransferas...  70.1    1e-10   Glycine max [soybeans]
ref|XP_006600275.1|  PREDICTED: probable galacturonosyltransferas...  69.7    2e-10   Glycine max [soybeans]
ref|XP_010910633.1|  PREDICTED: probable galacturonosyltransferas...  69.3    2e-10   Elaeis guineensis
gb|ABN08854.1|  Glycosyl transferase, family 8                        69.3    3e-10   Medicago truncatula
gb|KHG17315.1|  putative galacturonosyltransferase 4 -like protein    68.6    5e-10   Gossypium arboreum [tree cotton]
ref|XP_011005780.1|  PREDICTED: probable galacturonosyltransferas...  68.6    5e-10   Populus euphratica
ref|XP_011005782.1|  PREDICTED: probable galacturonosyltransferas...  68.6    5e-10   Populus euphratica
ref|XP_006373556.1|  hypothetical protein POPTR_0016s00360g           68.2    6e-10   
gb|KJB57893.1|  hypothetical protein B456_009G185300                  67.4    1e-09   Gossypium raimondii
ref|XP_007147564.1|  hypothetical protein PHAVU_006G135100g           67.0    1e-09   Phaseolus vulgaris [French bean]
ref|XP_011040102.1|  PREDICTED: probable galacturonosyltransferase 4  65.1    6e-09   Populus euphratica
ref|XP_011016525.1|  PREDICTED: probable galacturonosyltransferase 4  65.1    6e-09   Populus euphratica
ref|XP_006857626.1|  hypothetical protein AMTR_s00061p00126570        64.7    7e-09   Amborella trichopoda
gb|KDO78642.1|  hypothetical protein CISIN_1g005035mg                 64.7    9e-09   Citrus sinensis [apfelsine]
ref|XP_010942295.1|  PREDICTED: probable galacturonosyltransferase 4  63.9    1e-08   Elaeis guineensis
ref|XP_010686598.1|  PREDICTED: probable galacturonosyltransferase 4  63.9    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002308736.1|  hypothetical protein POPTR_0006s00320g           63.5    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_007213869.1|  hypothetical protein PRUPE_ppa018681mg           63.2    2e-08   
ref|XP_010538434.1|  PREDICTED: probable galacturonosyltransferase 4  62.8    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_009363241.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...  60.5    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_009407928.1|  PREDICTED: probable galacturonosyltransferase 4  59.3    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006597630.1|  PREDICTED: probable galacturonosyltransferas...  58.5    9e-07   Glycine max [soybeans]
ref|XP_004158838.1|  PREDICTED: probable galacturonosyltransferas...  57.0    3e-06   
gb|KHN03562.1|  Putative galacturonosyltransferase 4                  56.6    3e-06   Glycine soja [wild soybean]
ref|XP_009398763.1|  PREDICTED: probable galacturonosyltransferas...  56.6    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008384215.1|  PREDICTED: probable galacturonosyltransferas...  56.6    4e-06   
ref|XP_010096508.1|  putative galacturonosyltransferase 4             56.2    5e-06   
ref|XP_009395236.1|  PREDICTED: probable galacturonosyltransferase 4  55.8    7e-06   
ref|XP_009374812.1|  PREDICTED: probable galacturonosyltransferase 4  55.8    7e-06   Pyrus x bretschneideri [bai li]
ref|XP_008384214.1|  PREDICTED: probable galacturonosyltransferas...  55.8    7e-06   
ref|XP_008358828.1|  PREDICTED: probable galacturonosyltransferase 4  55.1    1e-05   Malus domestica [apple tree]
ref|XP_010481273.1|  PREDICTED: probable galacturonosyltransferas...  54.3    2e-05   Camelina sativa [gold-of-pleasure]
gb|KJB67439.1|  hypothetical protein B456_010G190800                  54.3    2e-05   Gossypium raimondii
ref|XP_002882844.1|  hypothetical protein ARALYDRAFT_478777           54.3    2e-05   
ref|XP_010481267.1|  PREDICTED: probable galacturonosyltransferas...  53.5    3e-05   Camelina sativa [gold-of-pleasure]
ref|NP_568688.1|  probable galacturonosyltransferase 4                53.5    4e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11325.1|  unnamed protein product                              53.5    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495019.1|  PREDICTED: probable galacturonosyltransferas...  53.5    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010441403.1|  PREDICTED: probable galacturonosyltransferas...  53.1    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008440947.1|  PREDICTED: probable galacturonosyltransferas...  51.2    2e-04   Cucumis melo [Oriental melon]
ref|XP_006279595.1|  hypothetical protein CARUB_v10026096mg           50.8    3e-04   Capsella rubella
ref|XP_009398761.1|  PREDICTED: probable galacturonosyltransferas...  50.4    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010481270.1|  PREDICTED: probable galacturonosyltransferas...  50.1    6e-04   Camelina sativa [gold-of-pleasure]
gb|KFK31342.1|  hypothetical protein AALP_AA6G099900                  49.7    8e-04   Arabis alpina [alpine rockcress]



>ref|XP_011095865.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
 ref|XP_011095866.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
 ref|XP_011095867.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
 ref|XP_011095868.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
Length=682

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 99/143 (69%), Gaps = 7/143 (5%)
 Frame = +1

Query  196  MRFR-RKSVLFLLLVTVLAPIVLYTDT---RFNSSPSRDEFIEEVSAFTLGGEIRPLNVL  363
            MR + R+SVLFLLLVTV APIVLYTDT    F SS SR+EF+E+VSAFT  GE+RPLNVL
Sbjct  1    MRMKLRRSVLFLLLVTVFAPIVLYTDTLGAYFTSSSSRNEFVEDVSAFTFAGEVRPLNVL  60

Query  364  PQEPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLA-EENEMGNVSTKGRDQE  540
            PQE +   KEPLG+VYSE+S  S S  SD    E+AR TRQLA E  E G  S       
Sbjct  61   PQESSATLKEPLGIVYSEHSTESSSNHSDDSARENARITRQLAGESGEDGIASASNLRTR  120

Query  541  TG--RAVDDDPLRQVTEEGNNSV  603
            +G  +++D++P+RQVT E + S 
Sbjct  121  SGENQSLDENPIRQVTNEVHESA  143



>ref|XP_011086294.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
Length=676

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 88/129 (68%), Gaps = 5/129 (4%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT---RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            RKSVLF LLVT LAPIVLYTDT    F SS SR+EF+E+VSAFT  GE+RPLNVLPQE +
Sbjct  6    RKSVLFFLLVTFLAPIVLYTDTLGVHFTSSSSRNEFVEDVSAFTFAGEVRPLNVLPQESS  65

Query  379  TITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAVD  558
            T  KEPLG+VY ENS  S S  SD    E+ R TRQL E  E+    T      +  ++D
Sbjct  66   TTLKEPLGIVYLENSAESGSNFSDDSSGENTRITRQLTE--ELAEDRTTNSSSLSKNSLD  123

Query  559  DDPLRQVTE  585
            ++P+RQV +
Sbjct  124  ENPIRQVID  132



>gb|EYU33824.1| hypothetical protein MIMGU_mgv1a002625mg [Erythranthe guttata]
Length=653

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 87/127 (69%), Gaps = 9/127 (7%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTR-FNSSPS--RDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            RK VLFLLLVTV APIVLYTDT    S+PS  R+EF+E+ S FT  GE+RPLNVLPQE +
Sbjct  6    RKPVLFLLLVTVFAPIVLYTDTLGLYSTPSSSRNEFMEDGSTFTFAGEVRPLNVLPQESS  65

Query  379  TITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAVD  558
            T  KEPLGVVYSENSI    EAS  +  ES R TRQL EE+      T      +G + D
Sbjct  66   TTLKEPLGVVYSENSI----EASSNKSEESTRITRQLTEESTED--KTTNLSGSSGGSKD  119

Query  559  DDPLRQV  579
            ++P+RQV
Sbjct  120  ENPIRQV  126



>ref|XP_006350235.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X4 [Solanum tuberosum]
Length=679

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 92/142 (65%), Gaps = 4/142 (3%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPS--RDEFIEEVSAFTLGGEIRPLNVLPQEP  375
            RK VLFLLLVTV APIVLYTDT   + +SPS  R EFIE++S FT GG++RPLNVLPQE 
Sbjct  6    RKPVLFLLLVTVFAPIVLYTDTLGTYFTSPSSSRTEFIEDLSTFTFGGDVRPLNVLPQES  65

Query  376  NTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAV  555
            +T  KEP G VYSENS  S S ASD   +E ARKTRQL EE+     +T   +     A+
Sbjct  66   STSLKEPRGDVYSENSSHSLSNASDTLSSEDARKTRQLTEESMKHQTATGSSNDGVEVAM  125

Query  556  DDDPLRQVTEEGNNSVKSDHIS  621
            +   + QVT   +   ++D  S
Sbjct  126  NGSHISQVTANLHEPQQTDKTS  147



>ref|XP_010319211.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010319212.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Solanum 
lycopersicum]
Length=679

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 4/142 (3%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPS--RDEFIEEVSAFTLGGEIRPLNVLPQEP  375
            RK VLFLLLVTV APIVLYTDT   + +SPS  R EFIE++S FT GG++RPLNVLPQE 
Sbjct  6    RKPVLFLLLVTVFAPIVLYTDTLGTYFTSPSSSRTEFIEDLSTFTFGGDVRPLNVLPQES  65

Query  376  NTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAV  555
            +T  KEP G VYSENS  + S ASD   +E ARKTRQL EE+     +T   +     A+
Sbjct  66   STSLKEPRGDVYSENSSQTISNASDTLGSEDARKTRQLTEESLKHQTATGSSNDGVEVAM  125

Query  556  DDDPLRQVTEEGNNSVKSDHIS  621
            + + + QVT+  +   ++D  S
Sbjct  126  NGNHISQVTDNLHEPQQTDKTS  147



>ref|XP_006350232.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006350233.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006350234.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X3 [Solanum tuberosum]
Length=680

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPS--RDEFIEEVSAFTLGGEIRPLNVLPQEP  375
            RK VLFLLLVTV APIVLYTDT   + +SPS  R EFIE++S FT GG++RPLNVLPQE 
Sbjct  6    RKPVLFLLLVTVFAPIVLYTDTLGTYFTSPSSSRTEFIEDLSTFTFGGDVRPLNVLPQES  65

Query  376  NTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKG  528
            +T  KEP G VYSENS  S S ASD   +E ARKTRQL E   M + +  G
Sbjct  66   STSLKEPRGDVYSENSSHSLSNASDTLSSEDARKTRQLTEAESMKHQTATG  116



>ref|XP_004236640.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319210.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Solanum 
lycopersicum]
Length=680

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 5/143 (3%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPS--RDEFIEEVSAFTLGGEIRPLNVLPQEP  375
            RK VLFLLLVTV APIVLYTDT   + +SPS  R EFIE++S FT GG++RPLNVLPQE 
Sbjct  6    RKPVLFLLLVTVFAPIVLYTDTLGTYFTSPSSSRTEFIEDLSTFTFGGDVRPLNVLPQES  65

Query  376  NTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQE-TGRA  552
            +T  KEP G VYSENS  + S ASD   +E ARKTRQL E   + + +  G   +    A
Sbjct  66   STSLKEPRGDVYSENSSQTISNASDTLGSEDARKTRQLTEAESLKHQTATGSSNDGVEVA  125

Query  553  VDDDPLRQVTEEGNNSVKSDHIS  621
            ++ + + QVT+  +   ++D  S
Sbjct  126  MNGNHISQVTDNLHEPQQTDKTS  148



>emb|CDP04556.1| unnamed protein product [Coffea canephora]
Length=684

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 89/147 (61%), Gaps = 22/147 (15%)
 Frame = +1

Query  196  MRFRRKSVLFLLLVTVLAPIVLYTDTRFNSSP------------SRDEFIEEVSAFTLGG  339
            M+ R+ ++L LL+ TVLAPIVLYT+T     P              D  +EE S FT GG
Sbjct  1    MKPRKAALLLLLVSTVLAPIVLYTETLGIYLPSSATSSSSSSSSGNDFIVEEASTFTFGG  60

Query  340  EIRPLNVLPQEPNTITKEPLGVVYSENSILSHS-EASDGQRNESARKTRQLAEEN-----  501
            +IRPLN+LPQE  TI KEPLG VYSENS  S +   SD   N++AR TRQL E++     
Sbjct  61   DIRPLNILPQESTTILKEPLGFVYSENSTQSLAVNVSDASANDNARITRQLTEDSLQHQA  120

Query  502  EMGNVSTKGRDQETGRAVDDDPLRQVT  582
             + +V + GR   TG A  ++P+RQVT
Sbjct  121  TVLSVLSGGR---TGDAF-ENPIRQVT  143



>ref|XP_009802396.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Nicotiana 
sylvestris]
Length=680

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 98/150 (65%), Gaps = 8/150 (5%)
 Frame = +1

Query  193  EMRFRRKSVLFLLLVTVLAPIVLYTDT---RFNSSPSRDEFIEEVSAFTLGGEIRPLNVL  363
            +M+FR K VLFLLLVTVLAPIVLYTDT    F    SR EFIE++S FTLGG++RPLN+L
Sbjct  2    KMKFR-KPVLFLLLVTVLAPIVLYTDTLASYFTPPSSRTEFIEDLSTFTLGGDVRPLNLL  60

Query  364  PQEPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQET  543
            PQE +T+ KEP G VYSENS LS S  SD   +E ARK RQL EE+     +T   +   
Sbjct  61   PQESSTLLKEPPGNVYSENSSLSLSNTSDTLSSEDARKARQLTEESMKHQAATGNSNDGI  120

Query  544  GRAVDDDPLRQVTEEGNNSVKSDHISDDSS  633
              A++ + + QVT+    S+   H  D +S
Sbjct  121  EVAMNGNRISQVTD----SLHEPHQMDKTS  146



>ref|XP_009802392.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009802394.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009802395.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
Length=681

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 98/151 (65%), Gaps = 9/151 (6%)
 Frame = +1

Query  193  EMRFRRKSVLFLLLVTVLAPIVLYTDT---RFNSSPSRDEFIEEVSAFTLGGEIRPLNVL  363
            +M+FR K VLFLLLVTVLAPIVLYTDT    F    SR EFIE++S FTLGG++RPLN+L
Sbjct  2    KMKFR-KPVLFLLLVTVLAPIVLYTDTLASYFTPPSSRTEFIEDLSTFTLGGDVRPLNLL  60

Query  364  PQEPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQE-  540
            PQE +T+ KEP G VYSENS LS S  SD   +E ARK RQL E   M + +  G   + 
Sbjct  61   PQESSTLLKEPPGNVYSENSSLSLSNTSDTLSSEDARKARQLTEAESMKHQAATGNSNDG  120

Query  541  TGRAVDDDPLRQVTEEGNNSVKSDHISDDSS  633
               A++ + + QVT+    S+   H  D +S
Sbjct  121  IEVAMNGNRISQVTD----SLHEPHQMDKTS  147



>ref|XP_009610681.1| PREDICTED: probable galacturonosyltransferase 4 [Nicotiana tomentosiformis]
 ref|XP_009610682.1| PREDICTED: probable galacturonosyltransferase 4 [Nicotiana tomentosiformis]
 ref|XP_009610684.1| PREDICTED: probable galacturonosyltransferase 4 [Nicotiana tomentosiformis]
Length=681

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 82/133 (62%), Gaps = 8/133 (6%)
 Frame = +1

Query  247  APIVLYTDT---RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNTITKEPLGVVYSE  417
            APIVLYTDT    F    SR EFIE++S FTLGG++RPLN+LPQE +T+ KEP G +YSE
Sbjct  19   APIVLYTDTLASYFTRPSSRTEFIEDLSTFTLGGDVRPLNLLPQESSTLLKEPPGDIYSE  78

Query  418  NSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQE-TGRAVDDDPLRQVTEEGN  594
            NS LS S  SD   +E ARK RQL E   M + +  G   +    A++ + + QVT+   
Sbjct  79   NSSLSLSNTSDTLSSEDARKARQLTEAESMKHQAATGNSNDGIEVAMNGNHISQVTD---  135

Query  595  NSVKSDHISDDSS  633
             S+   H  D +S
Sbjct  136  -SLHEPHQMDKTS  147



>ref|XP_008794742.1| PREDICTED: probable galacturonosyltransferase 4 isoform X6 [Phoenix 
dactylifera]
Length=641

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 80/140 (57%), Gaps = 11/140 (8%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            RRK VL LL  TVLAPI LYTD  + F SS S D+FIE+VS    G E+  LN LPQE  
Sbjct  3    RRKPVLVLLCFTVLAPIFLYTDRLSSFPSSISNDDFIEDVSNVAFGNEVGKLNALPQELT  62

Query  379  TITKEPLGVVYSENSILSHS---EASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGR  549
               KEP+G+VY +NSI SH    ++ D     +A+  R L+E+   G+V  +  ++  G+
Sbjct  63   NAVKEPIGIVYPDNSINSHQISVQSRDVSATSNAQDERNLSEK---GSVIEQVVNRRIGK  119

Query  550  AVDDDPLRQVTEEGNNSVKS  609
               DD  +   EE N  + S
Sbjct  120  ---DDSEKSKAEEENKELGS  136



>ref|XP_008794740.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Phoenix 
dactylifera]
Length=659

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 82/153 (54%), Gaps = 19/153 (12%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            RRK VL LL  TVLAPI LYTD  + F SS S D+FIE+VS    G E+  LN LPQE  
Sbjct  3    RRKPVLVLLCFTVLAPIFLYTDRLSSFPSSISNDDFIEDVSNVAFGNEVGKLNALPQELT  62

Query  379  TITKEPLGVVYSENSILSH---------SEASDGQ----RNESARKTRQLAEENEMGNVS  519
               KEP+G+VY +NSI SH         S  S+ Q    R     K+R L+  +E  N+S
Sbjct  63   NAVKEPIGIVYPDNSINSHQISVQSRDVSATSNAQEVPLRKSGEHKSRVLSATDER-NLS  121

Query  520  TKGR--DQETGRAV-DDDPLRQVTEEGNNSVKS  609
             KG   +Q   R +  DD  +   EE N  + S
Sbjct  122  EKGSVIEQVVNRRIGKDDSEKSKAEEENKELGS  154



>ref|XP_008794738.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Phoenix 
dactylifera]
Length=664

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 82/158 (52%), Gaps = 24/158 (15%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            RRK VL LL  TVLAPI LYTD  + F SS S D+FIE+VS    G E+  LN LPQE  
Sbjct  3    RRKPVLVLLCFTVLAPIFLYTDRLSSFPSSISNDDFIEDVSNVAFGNEVGKLNALPQELT  62

Query  379  TITKEPLGVVYSENSILSH---------SEASDGQ---------RNESARKTRQLAEENE  504
               KEP+G+VY +NSI SH         S  S+ Q         R     K+R L+  +E
Sbjct  63   NAVKEPIGIVYPDNSINSHQISVQSRDVSATSNAQVQLFTEVPLRKSGEHKSRVLSATDE  122

Query  505  MGNVSTKGR--DQETGRAV-DDDPLRQVTEEGNNSVKS  609
              N+S KG   +Q   R +  DD  +   EE N  + S
Sbjct  123  R-NLSEKGSVIEQVVNRRIGKDDSEKSKAEEENKELGS  159



>ref|XP_010252974.1| PREDICTED: probable galacturonosyltransferase 4 [Nelumbo nucifera]
Length=697

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 79/133 (59%), Gaps = 12/133 (9%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNT  381
            RK VLFLL VTVLAPIVLYTD    F +S +R EFIE+ S  + GGE   LN+L QEP+ 
Sbjct  23   RKPVLFLLFVTVLAPIVLYTDRLGSFTNSSTRSEFIEDFSTISFGGETGNLNLLRQEPSN  82

Query  382  ITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVST--KGRDQETGRAV  555
              KEP+G VY +N+  + S +SDG   +++       E  E  NVS   + RD +T R +
Sbjct  83   NLKEPIGFVYFDNTSTAFS-SSDGSTGDNS------GEIIESANVSKLEESRDLKT-RVL  134

Query  556  DDDPLRQVTEEGN  594
                 R  +E+GN
Sbjct  135  STTNERTQSEKGN  147



>ref|XP_008794741.1| PREDICTED: probable galacturonosyltransferase 4 isoform X5 [Phoenix 
dactylifera]
Length=642

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 80/141 (57%), Gaps = 12/141 (9%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAF-TLGGEIRPLNVLPQEP  375
            RRK VL LL  TVLAPI LYTD  + F SS S D+FIE+VS     G E+  LN LPQE 
Sbjct  3    RRKPVLVLLCFTVLAPIFLYTDRLSSFPSSISNDDFIEDVSNVQAFGNEVGKLNALPQEL  62

Query  376  NTITKEPLGVVYSENSILSHS---EASDGQRNESARKTRQLAEENEMGNVSTKGRDQETG  546
                KEP+G+VY +NSI SH    ++ D     +A+  R L+E+   G+V  +  ++  G
Sbjct  63   TNAVKEPIGIVYPDNSINSHQISVQSRDVSATSNAQDERNLSEK---GSVIEQVVNRRIG  119

Query  547  RAVDDDPLRQVTEEGNNSVKS  609
            +   DD  +   EE N  + S
Sbjct  120  K---DDSEKSKAEEENKELGS  137



>ref|XP_008794739.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Phoenix 
dactylifera]
Length=660

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 82/154 (53%), Gaps = 20/154 (13%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAF-TLGGEIRPLNVLPQEP  375
            RRK VL LL  TVLAPI LYTD  + F SS S D+FIE+VS     G E+  LN LPQE 
Sbjct  3    RRKPVLVLLCFTVLAPIFLYTDRLSSFPSSISNDDFIEDVSNVQAFGNEVGKLNALPQEL  62

Query  376  NTITKEPLGVVYSENSILSH---------SEASDGQ----RNESARKTRQLAEENEMGNV  516
                KEP+G+VY +NSI SH         S  S+ Q    R     K+R L+  +E  N+
Sbjct  63   TNAVKEPIGIVYPDNSINSHQISVQSRDVSATSNAQEVPLRKSGEHKSRVLSATDER-NL  121

Query  517  STKGR--DQETGRAV-DDDPLRQVTEEGNNSVKS  609
            S KG   +Q   R +  DD  +   EE N  + S
Sbjct  122  SEKGSVIEQVVNRRIGKDDSEKSKAEEENKELGS  155



>gb|KDP29029.1| hypothetical protein JCGZ_16418 [Jatropha curcas]
Length=644

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 88/153 (58%), Gaps = 18/153 (12%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIR-PLNVLPQEPN  378
            R  V+ +L VTV+APIVLYTD    F +S SR EF+E+V++FTL G+ R  LNVLPQE  
Sbjct  4    RNLVVGMLFVTVIAPIVLYTDRFAAFKASSSRAEFLEDVTSFTLSGDTREHLNVLPQEAA  63

Query  379  TITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAVD  558
             + KEP+G+VYS+N   S S+    Q  +S+ K  +  +   + + +  G   +TG  + 
Sbjct  64   AL-KEPIGIVYSDNFTNSASDNFTIQILDSSPKDTREHKSARVLSATDDGHQSQTGNTI-  121

Query  559  DDPLRQVTEEGN---------NSVKSDHISDDS  630
                RQVT+  N         ++ K D +SD+S
Sbjct  122  ----RQVTDTTNQDGSQNDAGDAKKKDGVSDNS  150



>ref|XP_008794737.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Phoenix 
dactylifera]
Length=665

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 82/159 (52%), Gaps = 25/159 (16%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAF-TLGGEIRPLNVLPQEP  375
            RRK VL LL  TVLAPI LYTD  + F SS S D+FIE+VS     G E+  LN LPQE 
Sbjct  3    RRKPVLVLLCFTVLAPIFLYTDRLSSFPSSISNDDFIEDVSNVQAFGNEVGKLNALPQEL  62

Query  376  NTITKEPLGVVYSENSILSH---------SEASDGQ---------RNESARKTRQLAEEN  501
                KEP+G+VY +NSI SH         S  S+ Q         R     K+R L+  +
Sbjct  63   TNAVKEPIGIVYPDNSINSHQISVQSRDVSATSNAQVQLFTEVPLRKSGEHKSRVLSATD  122

Query  502  EMGNVSTKGR--DQETGRAV-DDDPLRQVTEEGNNSVKS  609
            E  N+S KG   +Q   R +  DD  +   EE N  + S
Sbjct  123  ER-NLSEKGSVIEQVVNRRIGKDDSEKSKAEEENKELGS  160



>ref|XP_008464310.1| PREDICTED: probable galacturonosyltransferase 4 [Cucumis melo]
Length=648

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNT  381
            R  VL +L VTV+API+LYT     FN S SR EF+EE  +FTL      LN+LP E   
Sbjct  4    RNLVLLMLFVTVIAPILLYTHRLGSFNFSSSRGEFLEEDFSFTLSSHSEHLNILPLESTR  63

Query  382  ITKEPLGVVYSENSILSHSEASDGQRN----ESARKTRQLAEENEMGNVSTKGRDQETGR  549
              KEP+G VYS+N + S+ +AS  ++N    +++    QL E  E  +        E   
Sbjct  64   TLKEPVGTVYSKNIVHSNPDASAIEQNSTDGQASAHDLQLPESREYKSTRALSTTNENAS  123

Query  550  AVDDDPLRQVTEE  588
            +  ++ +RQ+T++
Sbjct  124  STCENHIRQITDQ  136



>ref|XP_010272524.1| PREDICTED: probable galacturonosyltransferase 4 [Nelumbo nucifera]
Length=673

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIR-PLNVLPQEPN  378
            RK VLFLL VTVLAPIVLYTD    F  S SR EFIE  S  T   E R  LNVLPQEP+
Sbjct  4    RKPVLFLLFVTVLAPIVLYTDRLGSFTISSSRSEFIENFSTLTFSSETRQQLNVLPQEPH  63

Query  379  TITKEPLGVVYS  414
               KEP+G+V++
Sbjct  64   NKLKEPIGLVFA  75



>ref|XP_004168876.1| PREDICTED: probable galacturonosyltransferase 4-like [Cucumis 
sativus]
Length=649

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 77/134 (57%), Gaps = 7/134 (5%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEE-VSAFTLGGEIRPLNVLPQEPN  378
            R  VLF+L +TV+API+LYT+    FN S SR EF+E+  S+FTL      LN+LP E  
Sbjct  4    RNLVLFMLFITVIAPILLYTNRLGSFNFSSSRGEFLEDDFSSFTLSSHSEHLNILPLEST  63

Query  379  TITKEPLGVVYSENSILSHSEASDGQRN----ESARKTRQLAEENEMGNVSTKGRDQETG  546
               KEP+G VYS N +    +AS  ++N    +++    QL+E  E  +       +E  
Sbjct  64   RTLKEPVGAVYSNNMVHLDPDASAIEQNSTDGQASAHDLQLSESREYKSTRALSTTKENV  123

Query  547  RAVDDDPLRQVTEE  588
             ++ ++ +RQ+T++
Sbjct  124  SSISENHVRQITDQ  137



>ref|XP_010052503.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052504.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052505.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76571.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
 gb|KCW76572.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
Length=659

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 78/131 (60%), Gaps = 19/131 (15%)
 Frame = +1

Query  247  APIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNTITKEPLGVVYSEN  420
            API+LYTD    F S+ SR+EFIEEV++FT  G+   LNVLPQE +   KEP+G+VY++N
Sbjct  18   APIILYTDRIGTFKSASSRNEFIEEVTSFTFSGDAGRLNVLPQESSATLKEPIGLVYTDN  77

Query  421  SILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAVDDDPLRQVTEEGNNS  600
            +    S+  +G  ++SAR      ++++               A  ++P+RQVT+  N  
Sbjct  78   TT-KDSQKLEGVEHKSARVLSATTDDSQ---------------AQKENPIRQVTDGNNQG  121

Query  601  VKSDHISDDSS  633
            V+S  IS+ S+
Sbjct  122  VQSG-ISEKST  131



>ref|XP_010942526.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Elaeis 
guineensis]
Length=659

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 67/122 (55%), Gaps = 15/122 (12%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNT  381
            RK VL LL  TVLAPIVLYTD  + F  S S ++FIE+VS    G E+  LN LPQE   
Sbjct  4    RKPVLVLLCFTVLAPIVLYTDRLSSFPGSLSNNDFIEDVSNVAFGNEVGKLNALPQELTN  63

Query  382  ITKEPLGVVYSENSILSHS---EASDG----------QRNESARKTRQLAEENEMGNVST  522
            + KEP+G+VY +NS  ++    ++ DG          QR     K+R L+  +E      
Sbjct  64   VVKEPIGIVYPDNSSNAYQIWVQSRDGSASSNAQEVPQRKSGELKSRMLSTMDERNLSEK  123

Query  523  KG  528
            KG
Sbjct  124  KG  125



>ref|XP_007026430.1| Galacturonosyltransferase 4 isoform 1 [Theobroma cacao]
 gb|EOY29052.1| Galacturonosyltransferase 4 isoform 1 [Theobroma cacao]
Length=626

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNT  381
            R  VL LL VTV+API LYTD    FN S S  +F+++V+ FTL G+ R LNVLPQE +T
Sbjct  4    RHLVLGLLSVTVIAPIFLYTDRVATFNPSSSGRDFLDDVATFTLLGDTRRLNVLPQETST  63

Query  382  ITKEPLGVVYSENSILSHSEASDGQRNESAR  474
              KEP G+VYS++S  S  + ++ + ++S R
Sbjct  64   AIKEPAGIVYSDHSNNSFRKVTETREHKSTR  94



>emb|CBI25859.3| unnamed protein product [Vitis vinifera]
Length=438

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 93/146 (64%), Gaps = 17/146 (12%)
 Frame = +1

Query  187  QGEMRFRRKSVLFLLLVTVLAPIVLYTDT---RFNSSPSR-DEFIEEVSAFTLGGEIRPL  354
            +G+   +RK+VLFLLLVTVL+PIVLYTDT    F +S S  DEF E+V+A TLGG    L
Sbjct  52   RGKEMIKRKTVLFLLLVTVLSPIVLYTDTLGRSFKTSFSAADEFDEDVTALTLGGVDAKL  111

Query  355  NVLPQEPNTITKEPLGVVYSENSILSHSE-ASDGQRNESA-RKTRQLAEENEMGNVSTKG  528
            N+LPQE +T  KEP+G+VYS+N  L   E A+D Q   S   KTR L+   E G+     
Sbjct  112  NLLPQESSTTLKEPIGIVYSDNDSLDVDESAADLQLGGSVEHKTRVLSTTYEEGD-----  166

Query  529  RDQETGRAVDDDPLRQVTEEGNNSVK  606
                  R+  ++P+RQVT+  ++S++
Sbjct  167  ------RSQRENPIRQVTDGKDDSLQ  186



>ref|XP_010647027.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Vitis 
vinifera]
Length=637

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 76/125 (61%), Gaps = 16/125 (13%)
 Frame = +1

Query  247  APIVLYTDT---RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNTITKEPLGVVYSE  417
            +PIVLYTDT    F +S S DEF E+V+A TLGG    LN+LPQE +T  KEP+G+VYS+
Sbjct  17   SPIVLYTDTLGRSFKTSFSADEFDEDVTALTLGGVDAKLNLLPQESSTTLKEPIGIVYSD  76

Query  418  NSILSHSE-ASDGQRNESA-RKTRQLAEENEMGNVSTKGRDQETGRAVDDDPLRQVTEEG  591
            N  L   E A+D Q   S   KTR L+   E G+           R+  ++P+RQVT+  
Sbjct  77   NDSLDVDESAADLQLGGSVEHKTRVLSTTYEEGD-----------RSQRENPIRQVTDGK  125

Query  592  NNSVK  606
            +++++
Sbjct  126  DDNLQ  130



>gb|KJB67438.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=549

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 66/100 (66%), Gaps = 5/100 (5%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD---TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  VL LL ++V+API LYTD   +  N S SR +F+++VSAFT+ G+ R LNVL QE +
Sbjct  4    RHIVLGLLSISVIAPIFLYTDRVGSFVNPSSSRRDFLDDVSAFTVSGDTRHLNVLHQETS  63

Query  379  TITKEPLGVVYSENSILS--HSEASDGQRNESARKTRQLA  492
            T  KEP+GVVYS++S ++  H  A      +  R+ +QL+
Sbjct  64   TALKEPIGVVYSDHSTVTREHKSARVLSATDEERQQQQLS  103



>ref|XP_004139519.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
4-like [Cucumis sativus]
Length=646

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 75/134 (56%), Gaps = 7/134 (5%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEE-VSAFTLGGEIRPLNVLPQEPN  378
            R  VLF+L +TV+API+LYT+    FN S SR EF+E+  S+FTL      LN+LP E  
Sbjct  4    RNLVLFMLFITVIAPILLYTNRLGSFNFSSSRGEFLEDDFSSFTLSSHSEHLNILPLEST  63

Query  379  TITKEPLGVVYSENSILSHSEASDGQRN----ESARKTRQLAEENEMGNVSTKGRDQETG  546
               KEP+G VYS N +    +AS  ++N    +++    QL E  E  +        E  
Sbjct  64   RTLKEPVGAVYSNNMVHLDPDASAIEQNSTDGQASAHDLQLPESREYKSTRALSTTNENV  123

Query  547  RAVDDDPLRQVTEE  588
             ++ ++ +RQ+T++
Sbjct  124  SSISENHVRQITDQ  137



>gb|KGN65009.1| hypothetical protein Csa_1G179740 [Cucumis sativus]
Length=649

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 75/134 (56%), Gaps = 7/134 (5%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEE-VSAFTLGGEIRPLNVLPQEPN  378
            R  VLF+L +TV+API+LYT+    FN S SR EF+E+  S+FTL      LN+LP E  
Sbjct  4    RNLVLFMLFITVIAPILLYTNRLGSFNFSSSRGEFLEDDFSSFTLSSHSEHLNILPLEST  63

Query  379  TITKEPLGVVYSENSILSHSEASDGQRN----ESARKTRQLAEENEMGNVSTKGRDQETG  546
               KEP+G VYS N +    +AS  ++N    +++    QL E  E  +        E  
Sbjct  64   RTLKEPVGAVYSNNMVHLDPDASAIEQNSTDGQASAHDLQLPESREYKSTRALSTTNENV  123

Query  547  RAVDDDPLRQVTEE  588
             ++ ++ +RQ+T++
Sbjct  124  SSISENHVRQITDQ  137



>ref|XP_010052506.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010052507.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Eucalyptus 
grandis]
 gb|KCW76573.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
Length=654

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 76/131 (58%), Gaps = 24/131 (18%)
 Frame = +1

Query  247  APIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNTITKEPLGVVYSEN  420
            API+LYTD    F S+ SR+EFIEEV++FT  G+   LNVLPQE +   KEP+G+VY++N
Sbjct  18   APIILYTDRIGTFKSASSRNEFIEEVTSFTFSGDAGRLNVLPQESSATLKEPIGLVYTDN  77

Query  421  SILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAVDDDPLRQVTEEGNNS  600
            +        +G  ++SAR      ++++               A  ++P+RQVT+  N  
Sbjct  78   T------TKEGVEHKSARVLSATTDDSQ---------------AQKENPIRQVTDGNNQG  116

Query  601  VKSDHISDDSS  633
            V+S  IS+ S+
Sbjct  117  VQSG-ISEKST  126



>gb|KJB67440.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=603

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 66/100 (66%), Gaps = 5/100 (5%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD---TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  VL LL ++V+API LYTD   +  N S SR +F+++VSAFT+ G+ R LNVL QE +
Sbjct  4    RHIVLGLLSISVIAPIFLYTDRVGSFVNPSSSRRDFLDDVSAFTVSGDTRHLNVLHQETS  63

Query  379  TITKEPLGVVYSENSILS--HSEASDGQRNESARKTRQLA  492
            T  KEP+GVVYS++S ++  H  A      +  R+ +QL+
Sbjct  64   TALKEPIGVVYSDHSTVTREHKSARVLSATDEERQQQQLS  103



>ref|XP_007026431.1| Galacturonosyltransferase 4 isoform 2 [Theobroma cacao]
 gb|EOY29053.1| Galacturonosyltransferase 4 isoform 2 [Theobroma cacao]
Length=624

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 7/101 (7%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNT  381
            R  VL LL VTV+API LYTD    FN S S  +F+++V+ FTL G+ R LNVLPQE +T
Sbjct  4    RHLVLGLLSVTVIAPIFLYTDRVATFNPSSSGRDFLDDVATFTLLGDTRRLNVLPQETST  63

Query  382  ITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENE  504
              KEP G+VYS+     HS  S  +     + TR L+  +E
Sbjct  64   AIKEPAGIVYSD-----HSNNSFRKETREHKSTRVLSATDE  99



>gb|KJB67437.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=620

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 66/100 (66%), Gaps = 5/100 (5%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD---TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  VL LL ++V+API LYTD   +  N S SR +F+++VSAFT+ G+ R LNVL QE +
Sbjct  4    RHIVLGLLSISVIAPIFLYTDRVGSFVNPSSSRRDFLDDVSAFTVSGDTRHLNVLHQETS  63

Query  379  TITKEPLGVVYSENSILS--HSEASDGQRNESARKTRQLA  492
            T  KEP+GVVYS++S ++  H  A      +  R+ +QL+
Sbjct  64   TALKEPIGVVYSDHSTVTREHKSARVLSATDEERQQQQLS  103



>ref|XP_010052508.1| PREDICTED: probable galacturonosyltransferase 4 isoform X5 [Eucalyptus 
grandis]
 ref|XP_010052509.1| PREDICTED: probable galacturonosyltransferase 4 isoform X6 [Eucalyptus 
grandis]
 gb|KCW76574.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
Length=653

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 76/131 (58%), Gaps = 25/131 (19%)
 Frame = +1

Query  247  APIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNTITKEPLGVVYSEN  420
            API+LYTD    F S+ SR+EFIEEV++FT  G+   LNVLPQE +   KEP+G+VY++N
Sbjct  18   APIILYTDRIGTFKSASSRNEFIEEVTSFTFSGDAGRLNVLPQESSATLKEPIGLVYTDN  77

Query  421  SILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAVDDDPLRQVTEEGNNS  600
            +       + G  ++SAR      ++++               A  ++P+RQVT+  N  
Sbjct  78   T-------TKGVEHKSARVLSATTDDSQ---------------AQKENPIRQVTDGNNQG  115

Query  601  VKSDHISDDSS  633
            V+S  IS+ S+
Sbjct  116  VQSG-ISEKST  125



>ref|XP_004499343.1| PREDICTED: probable galacturonosyltransferase 4-like [Cicer arietinum]
Length=658

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGG-EIRPLNVLPQEPN  378
            R  V  LL +TV+ PI+LYTD  T FN   +  EFI++V+AF +GG +   LN+LPQE +
Sbjct  5    RNIVFLLLCITVVTPILLYTDRLTDFNYPSAEHEFIQDVTAFAVGGAKSSHLNLLPQETS  64

Query  379  TITKEPLGVVYSENS  423
            TI KEP+GVVYSE++
Sbjct  65   TILKEPIGVVYSEDT  79



>ref|XP_002525229.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF37195.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=647

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 79/131 (60%), Gaps = 8/131 (6%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNSSPSRD---EFIEEVSAFTLGGEIR-PLNVLPQEP  375
            R  V+ +LLVTV+API+LYTD RF++  S     EF+E+V++ TL G+ R  LNVLPQE 
Sbjct  6    RNLVVGMLLVTVIAPIILYTDNRFSTFNSSSSTTEFLEDVASLTLSGDSRDHLNVLPQES  65

Query  376  NTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAV  555
             ++ KEP+G+VY++NS +S    S  Q + S     Q   E++   V +   DQ   +  
Sbjct  66   TSLLKEPIGIVYTDNSTISPPHTSTIQFHSSPLP--QDTREHKSTRVLSATNDQHQSQT-  122

Query  556  DDDPLRQVTEE  588
             D  +RQVT +
Sbjct  123  -DTIIRQVTNQ  132



>emb|CAN70213.1| hypothetical protein VITISV_038741 [Vitis vinifera]
Length=759

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 92/146 (63%), Gaps = 17/146 (12%)
 Frame = +1

Query  187  QGEMRFRRKSVLFLLLVTVLAPIVLYTDT---RFNSSPSR-DEFIEEVSAFTLGGEIRPL  354
            +G+   +RK+VLFLLLVTV +PIVLYTDT    F +S S  DEF E+V+A TLGG    L
Sbjct  118  RGKEMIKRKTVLFLLLVTVXSPIVLYTDTLGRSFKTSFSAADEFDEDVTALTLGGVDAKL  177

Query  355  NVLPQEPNTITKEPLGVVYSENSILSHSE-ASDGQRNESA-RKTRQLAEENEMGNVSTKG  528
            N+LPQE +T  KEP+G+VYS+N  L   E A+D Q   S   KTR L+   E G+     
Sbjct  178  NLLPQESSTTLKEPIGIVYSDNDSLDVDESAADLQLGGSVEHKTRXLSTTYEEGD-----  232

Query  529  RDQETGRAVDDDPLRQVTEEGNNSVK  606
                  R+  ++P+RQVT+  ++S++
Sbjct  233  ------RSQRENPIRQVTDGKDDSLQ  252



>ref|XP_010647084.1| PREDICTED: probable galacturonosyltransferase 4 [Vitis vinifera]
Length=638

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 76/126 (60%), Gaps = 17/126 (13%)
 Frame = +1

Query  247  APIVLYTDT---RFNSSPSR-DEFIEEVSAFTLGGEIRPLNVLPQEPNTITKEPLGVVYS  414
            +PIVLYTDT    F +S S  DEF E+V+A TLGG    LN+LPQE +T  KEP+G+VYS
Sbjct  17   SPIVLYTDTLGRSFKTSFSAADEFDEDVTALTLGGVDAKLNLLPQESSTTLKEPIGIVYS  76

Query  415  ENSILSHSE-ASDGQRNESA-RKTRQLAEENEMGNVSTKGRDQETGRAVDDDPLRQVTEE  588
            +N  L   E A+D Q   S   KTR L+   E G+           R+  ++P+RQVT+ 
Sbjct  77   DNDSLDVDESAADLQLGGSVEHKTRVLSTTYEEGD-----------RSQRENPIRQVTDG  125

Query  589  GNNSVK  606
             ++S++
Sbjct  126  KDDSLQ  131



>ref|XP_004486385.1| PREDICTED: probable galacturonosyltransferase 4-like [Cicer arietinum]
Length=660

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 5/78 (6%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNS-SPSRDEFIEEVSAFTL-GGEIRPLNVLPQEP  375
            R  VLFLL +TV+APIVLYTD  + F+S S ++ EFIE+V+AF+    +   LN+LPQE 
Sbjct  5    RNIVLFLLCITVVAPIVLYTDRLSSFDSPSSTKQEFIEDVTAFSFSAADSSHLNLLPQET  64

Query  376  NTITKEPLGVVYS-ENSI  426
            +T+ KEP+GVVY+ E+SI
Sbjct  65   STVLKEPIGVVYTNEDSI  82



>ref|XP_010942525.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Elaeis 
guineensis]
Length=659

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 67/122 (55%), Gaps = 15/122 (12%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAF-TLGGEIRPLNVLPQEPN  378
            RK VL LL  TVLAPIVLYTD  + F  S S ++FIE+VS     G E+  LN LPQE  
Sbjct  4    RKPVLVLLCFTVLAPIVLYTDRLSSFPGSLSNNDFIEDVSNVQAFGNEVGKLNALPQELT  63

Query  379  TITKEPLGVVYSENSILSHS---EASDG---------QRNESARKTRQLAEENEMGNVST  522
             + KEP+G+VY +NS  ++    ++ DG         QR     K+R L+  +E      
Sbjct  64   NVVKEPIGIVYPDNSSNAYQIWVQSRDGSASSNAQVPQRKSGELKSRMLSTMDERNLSEK  123

Query  523  KG  528
            KG
Sbjct  124  KG  125



>ref|XP_011460080.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=648

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 84/142 (59%), Gaps = 25/142 (18%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD------TRFNSSPSRDEFIEEVSAFTL----GGEIRPLN  357
            R  V+ LL VTV+API+LYTD      T  +SS ++DEF+E+V+AF      GG    LN
Sbjct  4    RNVVMILLFVTVIAPIILYTDRLGSIHTSSSSSSAQDEFVEDVTAFPFNAHSGGR---LN  60

Query  358  VLPQEPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQ  537
            +LPQE +T+ KEP+GVVYS+NS  S  E  + Q   S   + Q++       +ST   +Q
Sbjct  61   LLPQELSTL-KEPIGVVYSDNSTESFPETKESQ--ASTNHSHQVSAR----VLSTTTNEQ  113

Query  538  ETGRAVDDDPLRQVTE---EGN  594
            +  +   D+P+ QVT+   +GN
Sbjct  114  DLSQ--KDNPIIQVTQTLDQGN  133



>ref|XP_011460082.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=644

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 84/142 (59%), Gaps = 25/142 (18%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD------TRFNSSPSRDEFIEEVSAFTL----GGEIRPLN  357
            R  V+ LL VTV+API+LYTD      T  +SS ++DEF+E+V+AF      GG    LN
Sbjct  4    RNVVMILLFVTVIAPIILYTDRLGSIHTSSSSSSAQDEFVEDVTAFPFNAHSGGR---LN  60

Query  358  VLPQEPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQ  537
            +LPQE +T+ KEP+GVVYS+NS  S  E  + Q   S   + Q++       +ST   +Q
Sbjct  61   LLPQELSTL-KEPIGVVYSDNSTESFPETKESQ--ASTNHSHQVSAR----VLSTTTNEQ  113

Query  538  ETGRAVDDDPLRQVTE---EGN  594
            +  +   D+P+ QVT+   +GN
Sbjct  114  DLSQ--KDNPIIQVTQTLDQGN  133



>ref|XP_010942524.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
Length=660

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 67/123 (54%), Gaps = 16/123 (13%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAF-TLGGEIRPLNVLPQEPN  378
            RK VL LL  TVLAPIVLYTD  + F  S S ++FIE+VS     G E+  LN LPQE  
Sbjct  4    RKPVLVLLCFTVLAPIVLYTDRLSSFPGSLSNNDFIEDVSNVQAFGNEVGKLNALPQELT  63

Query  379  TITKEPLGVVYSENSILSHS---EASDG----------QRNESARKTRQLAEENEMGNVS  519
             + KEP+G+VY +NS  ++    ++ DG          QR     K+R L+  +E     
Sbjct  64   NVVKEPIGIVYPDNSSNAYQIWVQSRDGSASSNAQEVPQRKSGELKSRMLSTMDERNLSE  123

Query  520  TKG  528
             KG
Sbjct  124  KKG  126



>gb|EPS65589.1| hypothetical protein M569_09187 [Genlisea aurea]
Length=625

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 85/150 (57%), Gaps = 19/150 (13%)
 Frame = +1

Query  199  RFRRKSVLFLLLVTVLAPIVLYTDT---RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQ  369
            RFRR  V   L++TV+APIVLYTDT    F +SPS+DE + ++      G+IRPLNVLP 
Sbjct  4    RFRR-FVFCSLVLTVVAPIVLYTDTLGPHF-ASPSKDELVNDLPTSAFSGDIRPLNVLPP  61

Query  370  EPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGR  549
                 + +   +V S N      ++S+    E+ R TRQL EE+  G         ++  
Sbjct  62   HVRISSSKSKALVGSVNL----EDSSNFSTGENTRITRQLTEESRDG--------VKSSS  109

Query  550  AVDDDPLRQVTEEGNNSVKSD--HISDDSS  633
            ++D++P+++VT+E N +   D   ISD SS
Sbjct  110  SLDENPIKRVTDEANLNKIGDPKGISDGSS  139



>ref|XP_010647025.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010647026.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Vitis 
vinifera]
 emb|CBI18781.3| unnamed protein product [Vitis vinifera]
Length=638

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 76/126 (60%), Gaps = 17/126 (13%)
 Frame = +1

Query  247  APIVLYTDT---RFNSSPSR-DEFIEEVSAFTLGGEIRPLNVLPQEPNTITKEPLGVVYS  414
            +PIVLYTDT    F +S S  DEF E+V+A TLGG    LN+LPQE +T  KEP+G+VYS
Sbjct  17   SPIVLYTDTLGRSFKTSFSAADEFDEDVTALTLGGVDAKLNLLPQESSTTLKEPIGIVYS  76

Query  415  ENSILSHSE-ASDGQRNESA-RKTRQLAEENEMGNVSTKGRDQETGRAVDDDPLRQVTEE  588
            +N  L   E A+D Q   S   KTR L+   E G+           R+  ++P+RQVT+ 
Sbjct  77   DNDSLDVDESAADLQLGGSVEHKTRVLSTTYEEGD-----------RSQRENPIRQVTDG  125

Query  589  GNNSVK  606
             +++++
Sbjct  126  KDDNLQ  131



>ref|XP_011460081.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=647

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 26/142 (18%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNS------SPSRDEFIEEVSAFTL----GGEIRPLN  357
            R  V+ LL VTV+API+LYTD R  S      S S+DEF+E+V+AF      GG    LN
Sbjct  4    RNVVMILLFVTVIAPIILYTD-RLGSIHTSSSSSSQDEFVEDVTAFPFNAHSGGR---LN  59

Query  358  VLPQEPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQ  537
            +LPQE +T+ KEP+GVVYS+NS  S  E  + Q   S   + Q++       +ST   +Q
Sbjct  60   LLPQELSTL-KEPIGVVYSDNSTESFPETKESQ--ASTNHSHQVSAR----VLSTTTNEQ  112

Query  538  ETGRAVDDDPLRQVTE---EGN  594
            +  +   D+P+ QVT+   +GN
Sbjct  113  DLSQ--KDNPIIQVTQTLDQGN  132



>ref|XP_003594361.1| Galacturonosyltransferase [Medicago truncatula]
 gb|AES64612.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=667

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 77/138 (56%), Gaps = 16/138 (12%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPS-RDEFIEEVSAFTLG-GEIRPLNVLPQEP  375
            R  VL LL +TV+APIVLYTD    F SSPS + EFIEEV+   L   +   LN+LPQE 
Sbjct  5    RNIVLLLLCITVVAPIVLYTDRLGSFESSPSTKQEFIEEVTVLPLSTADSGHLNLLPQET  64

Query  376  NTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAV  555
            +T+ KEP+GVVY+       +E S  +RN    +  QLA+  E  +        +  +A 
Sbjct  65   STVLKEPIGVVYT-------NEDSINRRN--LPRGLQLAKTREHVSARVLSATTKEDQAE  115

Query  556  DDDPLRQVTEE---GNNS  600
             D  ++ VT+E   GN S
Sbjct  116  KDATIKLVTDEIKQGNQS  133



>gb|KDO78643.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=576

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 79/134 (59%), Gaps = 22/134 (16%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNSSPSRDE---FIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  V+ +L  TVLAPI+++T T  +S PS  E   F+E+++AFT+GG+ R LN+LPQE +
Sbjct  4    RNLVVGMLCATVLAPILIFTSTFKDSYPSSSESGEFLEDLTAFTVGGDARHLNLLPQESS  63

Query  379  TI--TKEPLGVV---YSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQET  543
            T    K+P+ V+    +++S  S S++     ++SAR          + + +T G DQ  
Sbjct  64   TTLSLKQPILVISDKIAQHSAHSQSQSQGSWEHKSAR----------VLSATTNGLDQSK  113

Query  544  GRAVDDDPLRQVTE  585
                 D+P+RQVT+
Sbjct  114  T----DNPIRQVTD  123



>ref|XP_006467237.1| PREDICTED: probable galacturonosyltransferase 4-like [Citrus 
sinensis]
 gb|KDO78640.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=646

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 79/134 (59%), Gaps = 22/134 (16%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNSSPSRDE---FIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  V+ +L  TVLAPI+++T T  +S PS  E   F+E+++AFT+GG+ R LN+LPQE +
Sbjct  4    RNLVVGMLCATVLAPILIFTSTFKDSYPSSSESGEFLEDLTAFTVGGDARHLNLLPQESS  63

Query  379  TI--TKEPLGVV---YSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQET  543
            T    K+P+ V+    +++S  S S++     ++SAR          + + +T G DQ  
Sbjct  64   TTLSLKQPILVISDKIAQHSAHSQSQSQGSWEHKSAR----------VLSATTNGLDQSK  113

Query  544  GRAVDDDPLRQVTE  585
                 D+P+RQVT+
Sbjct  114  T----DNPIRQVTD  123



>gb|KDO78641.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=717

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 79/134 (59%), Gaps = 22/134 (16%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNSSPSRDE---FIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  V+ +L  TVLAPI+++T T  +S PS  E   F+E+++AFT+GG+ R LN+LPQE +
Sbjct  4    RNLVVGMLCATVLAPILIFTSTFKDSYPSSSESGEFLEDLTAFTVGGDARHLNLLPQESS  63

Query  379  TI--TKEPLGVV---YSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQET  543
            T    K+P+ V+    +++S  S S++     ++SAR          + + +T G DQ  
Sbjct  64   TTLSLKQPILVISDKIAQHSAHSQSQSQGSWEHKSAR----------VLSATTNGLDQSK  113

Query  544  GRAVDDDPLRQVTE  585
                 D+P+RQVT+
Sbjct  114  T----DNPIRQVTD  123



>ref|XP_008782990.1| PREDICTED: probable galacturonosyltransferase 4 [Phoenix dactylifera]
Length=659

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 84/148 (57%), Gaps = 18/148 (12%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            RRK+VL LL +TVLAPIVLYTD  + F++S S D+FI+ VS  ++G E+  LNVLPQE  
Sbjct  3    RRKAVLVLLCLTVLAPIVLYTDRLSSFSNSISNDDFIDNVSNLSVGKELGKLNVLPQEST  62

Query  379  TITKEPLGVVYSENSILSHS---EASDGQ----------RNESARKTRQLAEENEMGNVS  519
               KEP+G+VY +N   SH    ++SDG           R  +  K+R L+   + GN+S
Sbjct  63   NAVKEPIGIVYLDNLRKSHQVSVQSSDGSAALESQEMPLRKSAEHKSRMLSATYK-GNLS  121

Query  520  TKGR--DQETGRAVDDDPLRQVTEEGNN  597
             K    +Q   R +  D L +   E  N
Sbjct  122  EKEGVIEQVVDRKIGKDDLEKSNAEEEN  149



>ref|XP_003535002.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
1 [Glycine max]
Length=657

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 72/135 (53%), Gaps = 15/135 (11%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTL-GGEIRPLNVLPQEPN  378
            R  VL LL +TV+APIVLYTD    F S  ++ EFIE+V+AF     +   LN+LPQE +
Sbjct  5    RNIVLLLLCITVVAPIVLYTDRLGTFESPSNKQEFIEDVTAFAFSAADFSHLNLLPQETS  64

Query  379  TITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAVD  558
            T  KEP+ VVY+E       E S  +RN    +  QL +  E           E   A  
Sbjct  65   TAVKEPVRVVYTE-------EDSTNKRN--LPQGLQLVKSREHVFARMLSTTTEEDLAKK  115

Query  559  DDPLRQVTE---EGN  594
            ++P++ VT+   +GN
Sbjct  116  ENPIKLVTDGIKQGN  130



>gb|KHN40761.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=652

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 72/135 (53%), Gaps = 15/135 (11%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTL-GGEIRPLNVLPQEPN  378
            R  VL LL +TV+APIVLYTD    F S  ++ EFIE+V+AF     +   LN+LPQE +
Sbjct  5    RNIVLLLLCITVVAPIVLYTDRLGTFESPSNKQEFIEDVTAFAFSAADFSHLNLLPQETS  64

Query  379  TITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAVD  558
            T  KEP+ VVY+E       E S  +RN    +  QL +  E           E   A  
Sbjct  65   TAVKEPVRVVYTE-------EDSTNKRN--LPQGLQLVKSREHVFARMLSTTTEEDLAKK  115

Query  559  DDPLRQVTE---EGN  594
            ++P++ VT+   +GN
Sbjct  116  ENPIKLVTDGIKQGN  130



>ref|XP_006449976.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
 gb|ESR63216.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
Length=646

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 78/134 (58%), Gaps = 22/134 (16%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNSSPSRDE---FIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  V+ +L  TV API+++T T  +S PS  E   F+E+++AFT+GG+ R LN+LPQE +
Sbjct  4    RNLVVGMLCATVFAPILIFTSTFKDSYPSSSESGEFLEDLTAFTVGGDARHLNLLPQESS  63

Query  379  TI--TKEPLGVV---YSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQET  543
            T    K+P+ V+    +++S  S S++     ++SAR          + + +T G DQ  
Sbjct  64   TTLSLKQPILVISDKIAQHSAHSQSQSQGSWEHKSAR----------VLSATTNGLDQSK  113

Query  544  GRAVDDDPLRQVTE  585
                 D+P+RQVT+
Sbjct  114  T----DNPIRQVTD  123



>ref|XP_006449975.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
 gb|ESR63215.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
Length=717

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 78/134 (58%), Gaps = 22/134 (16%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNSSPSRDE---FIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  V+ +L  TV API+++T T  +S PS  E   F+E+++AFT+GG+ R LN+LPQE +
Sbjct  4    RNLVVGMLCATVFAPILIFTSTFKDSYPSSSESGEFLEDLTAFTVGGDARHLNLLPQESS  63

Query  379  TI--TKEPLGVV---YSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQET  543
            T    K+P+ V+    +++S  S S++     ++SAR          + + +T G DQ  
Sbjct  64   TTLSLKQPILVISDKIAQHSAHSQSQSQGSWEHKSAR----------VLSATTNGLDQSK  113

Query  544  GRAVDDDPLRQVTE  585
                 D+P+RQVT+
Sbjct  114  T----DNPIRQVTD  123



>ref|XP_008224656.1| PREDICTED: probable galacturonosyltransferase 4 [Prunus mume]
 ref|XP_008224657.1| PREDICTED: probable galacturonosyltransferase 4 [Prunus mume]
Length=658

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 76/139 (55%), Gaps = 12/139 (9%)
 Frame = +1

Query  229  LLVTVLAPIVLYTDT----RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNTITKEP  396
            L VTV+API+LYTD     + +SS S D+F+E+V+A         LN+LPQE +T  KEP
Sbjct  11   LFVTVIAPIILYTDRLGSFQVSSSSSGDDFVEDVTAVAANAHTGRLNLLPQESSTTLKEP  70

Query  397  LGVVYSENSILSHSE--ASDGQRNESARKTRQL-AEENEMGNVSTKGRDQETGRAVDDDP  567
            +GVVYS NS  S+ E   S    N   +    + + E+    V +   DQ   +   D+P
Sbjct  71   VGVVYSNNSTNSYPETRGSSAHPNHIHKDGPSVDSMEHVSARVLSTTNDQNLSQT--DNP  128

Query  568  LRQVT---EEGNNSVKSDH  615
            +RQVT   E+GN  +   H
Sbjct  129  IRQVTQTLEQGNQFMSDLH  147



>gb|KHN40223.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=664

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 19/153 (12%)
 Frame = +1

Query  196  MRFRRKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQ  369
            M   R  VL LL +T +APIVLYTD    F    +  EFI+ V+AF    +   LN+LPQ
Sbjct  1    MVVTRNIVLLLLSITFVAPIVLYTDRFGTFKYPFAEQEFIDAVTAFVSAADSGHLNLLPQ  60

Query  370  EPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGR  549
            E +T+ KEP+G+VY+E          D    ++       A+  E  +       ++ G+
Sbjct  61   ETSTVFKEPIGLVYTE----------DAANTKNLLHGLHFAKPGEHVSARVLSATKDEGQ  110

Query  550  AVDDDPLRQVTE---EGNNS---VKSDHISDDS  630
               ++P++ VT+   +GN +   VK+D I+ DS
Sbjct  111  TKGENPIKLVTDGINQGNQNSYLVKAD-ITGDS  142



>ref|XP_006584115.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X1 [Glycine max]
 ref|XP_006584116.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X2 [Glycine max]
Length=664

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 19/153 (12%)
 Frame = +1

Query  196  MRFRRKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQ  369
            M   R  VL LL +T +APIVLYTD    F    +  EFI+ V+AF    +   LN+LPQ
Sbjct  1    MVVTRNIVLLLLSITFVAPIVLYTDRFGTFKYPFAEQEFIDAVTAFVSAADSGHLNLLPQ  60

Query  370  EPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGR  549
            E +T+ KEP+G+VY+E          D    ++       A+  E  +       ++ G+
Sbjct  61   ETSTVFKEPIGLVYTE----------DAANTKNLLHGLHFAKPGEHVSARVLSATKDEGQ  110

Query  550  AVDDDPLRQVTE---EGNNS---VKSDHISDDS  630
               ++P++ VT+   +GN +   VK+D I+ DS
Sbjct  111  TKGENPIKLVTDGINQGNQNSYLVKAD-ITGDS  142



>ref|XP_006600275.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X1 [Glycine max]
 ref|XP_006600276.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X2 [Glycine max]
Length=661

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 75/151 (50%), Gaps = 18/151 (12%)
 Frame = +1

Query  196  MRFRRKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQ  369
            M   R  VL LL +T +APIVL+TD    F    +  EFIE V+AF    +   LN+LPQ
Sbjct  1    MVVTRNIVLLLLSITFVAPIVLFTDRLGTFKYPFAEQEFIEAVTAFVSAADSGHLNLLPQ  60

Query  370  EPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGR  549
            E +T+ KEP+G+VY+E          D    E+       A+  E  +        + G+
Sbjct  61   ESSTVFKEPIGLVYTE----------DTSNTENLLHGLHFAKPGEHVSARVLSATNDEGQ  110

Query  550  AVDDDPLRQVTE---EGNNS---VKSDHISD  624
               ++P++ VT+   +GN +   VK+D   D
Sbjct  111  TKGENPIKLVTDGINQGNQNSYMVKADTTGD  141



>ref|XP_010910633.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010910634.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010910635.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
Length=659

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 82/152 (54%), Gaps = 17/152 (11%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            RRK VL LL +TVLAPIVLYTD  + F++S S D+FI+ V + ++G E+  LN LPQE  
Sbjct  3    RRKPVLLLLCLTVLAPIVLYTDRLSSFSNSISNDDFIDNVFSLSVGKEVVKLNALPQEST  62

Query  379  TITKEPLGVVYSENSILSHS---EASDGQ----------RNESARKTRQLAEENEMGNVS  519
               KEP+G++Y +NS  SH    ++ DG           R  +  K+R L+  +      
Sbjct  63   NAVKEPIGIIYVDNSRNSHQVSVQSRDGSAALESQEFPLRKSAEHKSRMLSATDNGSLSE  122

Query  520  TKGRD-QETGRAVD-DDPLRQVTEEGNNSVKS  609
             KG   Q   R +  DDP +   EE N  V S
Sbjct  123  KKGMIVQVVNRKIGMDDPKKSKAEEENKEVGS  154



>gb|ABN08854.1| Glycosyl transferase, family 8 [Medicago truncatula]
Length=680

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 77/151 (51%), Gaps = 29/151 (19%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPS-RDEFIEEVSAFTLGGEIRP---------  351
            R  VL LL +TV+APIVLYTD    F SSPS + EFIEEV+       + P         
Sbjct  5    RNIVLLLLCITVVAPIVLYTDRLGSFESSPSTKQEFIEEVTVLVSDYLLMPFSDSLPLST  64

Query  352  -----LNVLPQEPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNV  516
                 LN+LPQE +T+ KEP+GVVY+       +E S  +RN    +  QLA+  E  + 
Sbjct  65   ADSGHLNLLPQETSTVLKEPIGVVYT-------NEDSINRRN--LPRGLQLAKTREHVSA  115

Query  517  STKGRDQETGRAVDDDPLRQVTEE---GNNS  600
                   +  +A  D  ++ VT+E   GN S
Sbjct  116  RVLSATTKEDQAEKDATIKLVTDEIKQGNQS  146



>gb|KHG17315.1| putative galacturonosyltransferase 4 -like protein [Gossypium 
arboreum]
Length=611

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 66/102 (65%), Gaps = 5/102 (5%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYT---DTRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  VL LL V+V +PI +YT    T F+ S SR +F+++V+AFTL G+   L+V+P E +
Sbjct  6    RHIVLNLLWVSVFSPIFIYTYMVGTFFDPSFSRLDFLDDVAAFTLSGDTSHLHVVPLETS  65

Query  379  TITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENE  504
            T  K+P+GVVYS++S  ++S  S+   ++S R     +EE +
Sbjct  66   TALKKPVGVVYSDHS--ANSFPSEVTEHKSTRVLSAASEERQ  105



>ref|XP_011005780.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Populus 
euphratica]
 ref|XP_011005781.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Populus 
euphratica]
Length=655

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNSSPS-RDEFIEEVSAFTLGGEIRPLNVLPQ-EPNT  381
            R  V  LLL++VLAPI+LYTD+  + +PS + EF+E+V+AF L  +   LNVLPQ E + 
Sbjct  4    RNLVFGLLLLSVLAPILLYTDSFSSFTPSFKQEFLEDVTAFILPADTSNLNVLPQGESSA  63

Query  382  ITKEPLGVVYSEN  420
            + K P+G++Y++N
Sbjct  64   VLKAPIGILYTDN  76



>ref|XP_011005782.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Populus 
euphratica]
Length=648

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNSSPS-RDEFIEEVSAFTLGGEIRPLNVLPQ-EPNT  381
            R  V  LLL++VLAPI+LYTD+  + +PS + EF+E+V+AF L  +   LNVLPQ E + 
Sbjct  4    RNLVFGLLLLSVLAPILLYTDSFSSFTPSFKQEFLEDVTAFILPADTSNLNVLPQGESSA  63

Query  382  ITKEPLGVVYSEN  420
            + K P+G++Y++N
Sbjct  64   VLKAPIGILYTDN  76



>ref|XP_006373556.1| hypothetical protein POPTR_0016s00360g [Populus trichocarpa]
 gb|ERP51353.1| hypothetical protein POPTR_0016s00360g [Populus trichocarpa]
Length=665

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 16/105 (15%)
 Frame = +1

Query  196  MRFRRKSVLFLLLVTVLAPIVLYTD---TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLP  366
            MR R   V+ LL +TVL+PI+LYTD   + F  S S+    E+V+AFTL  + R LNVLP
Sbjct  22   MRMR-NLVMGLLFLTVLSPILLYTDKLSSSFTPSTSKQ---EDVNAFTLPTDTRHLNVLP  77

Query  367  Q-EPNTITKEPLGVVY------SENSILSH--SEASDGQRNESAR  474
            Q E +T+ KEP+G+VY      S N+IL+   S+  D + ++ AR
Sbjct  78   QEESSTVIKEPIGIVYTDHINSSSNTILTEKDSQLPDAREHKYAR  122



>gb|KJB57893.1| hypothetical protein B456_009G185300 [Gossypium raimondii]
Length=526

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 3/75 (4%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYT---DTRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  VL LL V+V +PI +YT    T F+ S SR +F+++V+AFTL G+   L+V+P E +
Sbjct  8    RYIVLNLLWVSVFSPIFIYTYVVGTFFDPSFSRLDFLDDVAAFTLSGDTSHLHVVPLETS  67

Query  379  TITKEPLGVVYSENS  423
            T  K+P+GVVYS++S
Sbjct  68   TALKKPVGVVYSDHS  82



>ref|XP_007147564.1| hypothetical protein PHAVU_006G135100g [Phaseolus vulgaris]
 gb|ESW19558.1| hypothetical protein PHAVU_006G135100g [Phaseolus vulgaris]
Length=661

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 3/73 (4%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTL-GGEIRPLNVLPQEPN  378
            R  VL LL +TV+APIVLYTD    F    ++ EF+E+V+AF     +   LN+LPQE +
Sbjct  5    RNIVLLLLCITVVAPIVLYTDRLGTFEPPSNKQEFVEDVTAFAFSAADSSHLNLLPQETS  64

Query  379  TITKEPLGVVYSE  417
            T  KEP+ VVY+E
Sbjct  65   TTVKEPVRVVYTE  77



>ref|XP_011040102.1| PREDICTED: probable galacturonosyltransferase 4 [Populus euphratica]
Length=660

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 78/156 (50%), Gaps = 24/156 (15%)
 Frame = +1

Query  196  MRFRRKSVLFLLLVTVLAPIVLYTDTRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQ-E  372
            MR R   V+ LL +TVL+PI+LYTD   +S        E+V+AFTL  + R LNVLPQ E
Sbjct  22   MRMR-NLVIGLLFLTVLSPILLYTDKLSSSFTPSSSKQEDVNAFTLPTDTRHLNVLPQEE  80

Query  373  PNTITKEPLGVVY------SENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRD  534
             +T+ KEP+G+VY      S N+IL+              K  QL +  E          
Sbjct  81   SSTVIKEPIGIVYTDHINSSSNTILT-------------EKDLQLPDAREHIYARVLSAT  127

Query  535  QETGRAVDDDPLRQVTEEGNN---SVKSDHISDDSS  633
             E G +  D+ ++Q+ +  N      +SD+ SD  S
Sbjct  128  DEEGHSQTDNIIKQIIQTTNQEEEESQSDNRSDQES  163



>ref|XP_011016525.1| PREDICTED: probable galacturonosyltransferase 4 [Populus euphratica]
Length=660

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 78/156 (50%), Gaps = 24/156 (15%)
 Frame = +1

Query  196  MRFRRKSVLFLLLVTVLAPIVLYTDTRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQ-E  372
            MR R   V+ LL +TVL+PI+LYTD   +S        E+V+AFTL  + R LNVLPQ E
Sbjct  22   MRMR-NLVIGLLFLTVLSPILLYTDKLSSSFTPSSSKQEDVNAFTLPTDTRHLNVLPQEE  80

Query  373  PNTITKEPLGVVY------SENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRD  534
             +T+ KEP+G+VY      S N+IL+              K  QL +  E          
Sbjct  81   SSTVIKEPIGIVYTDHINSSSNTILT-------------EKDLQLPDAREHIYARVLSAT  127

Query  535  QETGRAVDDDPLRQVTEEGNN---SVKSDHISDDSS  633
             E G +  D+ ++Q+ +  N      +SD+ SD  S
Sbjct  128  DEEGHSQTDNIIKQIIQTTNQEEEESQSDNRSDQES  163



>ref|XP_006857626.1| hypothetical protein AMTR_s00061p00126570 [Amborella trichopoda]
 gb|ERN19093.1| hypothetical protein AMTR_s00061p00126570 [Amborella trichopoda]
Length=672

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +1

Query  196  MRFRRKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQ  369
            M+FR   VL LL  +VLAPIVLYTD    F+SS ++  F EE S    G +I  L VLPQ
Sbjct  1    MKFRM-PVLLLLCFSVLAPIVLYTDRLGSFSSSIAKAGFSEEFSPINYGRDINKLKVLPQ  59

Query  370  EPNTITKEPLGVVY  411
            E     KEP GVVY
Sbjct  60   ESVNALKEPSGVVY  73



>gb|KDO78642.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=656

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 78/144 (54%), Gaps = 32/144 (22%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNSSPSRDE---FIEEVSAFTL----------GGEIR  348
            R  V+ +L  TVLAPI+++T T  +S PS  E   F+E+++AFT           GG+ R
Sbjct  4    RNLVVGMLCATVLAPILIFTSTFKDSYPSSSESGEFLEDLTAFTFSRVVISLQTVGGDAR  63

Query  349  PLNVLPQEPNTI--TKEPLGVV---YSENSILSHSEASDGQRNESARKTRQLAEENEMGN  513
             LN+LPQE +T    K+P+ V+    +++S  S S++     ++SAR          + +
Sbjct  64   HLNLLPQESSTTLSLKQPILVISDKIAQHSAHSQSQSQGSWEHKSAR----------VLS  113

Query  514  VSTKGRDQETGRAVDDDPLRQVTE  585
             +T G DQ       D+P+RQVT+
Sbjct  114  ATTNGLDQSKT----DNPIRQVTD  133



>ref|XP_010942295.1| PREDICTED: probable galacturonosyltransferase 4 [Elaeis guineensis]
Length=670

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 4/76 (5%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTDTRFNSSPS---RDEFIEEVSAFTLGGEIRPLNVLPQEP  375
            RR+  L LL VTVLAPIVL+TD R  ++P+      F+++VS  + G E   LN+LPQE 
Sbjct  3    RRRLFLVLLCVTVLAPIVLFTD-RLATTPNSIVNGGFVDDVSNLSFGNETERLNILPQES  61

Query  376  NTITKEPLGVVYSENS  423
            +   KEP+  V+S++S
Sbjct  62   SVSVKEPIQTVHSDSS  77



>ref|XP_010686598.1| PREDICTED: probable galacturonosyltransferase 4 [Beta vulgaris 
subsp. vulgaris]
Length=640

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 49/138 (36%), Positives = 68/138 (49%), Gaps = 27/138 (20%)
 Frame = +1

Query  196  MRFR-RKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEF--IEEVSAFTLGGEIRPLNV  360
            M+ R RK VL LL VTV++PI+LYTD    F    ++DE   IE++  F        LN+
Sbjct  1    MKMRLRKPVLCLLFVTVVSPILLYTDKLGSFFPPSTKDELTQIEDIPTFAFTHTTGKLNL  60

Query  361  LPQEPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQE  540
            LPQE   + KEP+G+VY       H  A      ++  K R L+        S       
Sbjct  61   LPQESGMVVKEPVGIVY------PHKPA------QTLHKNRVLSTTTTTTTTS-------  101

Query  541  TGRAVDDDPLRQVTEEGN  594
               A  ++P+RQVT +GN
Sbjct  102  ---AEVENPIRQVTTDGN  116



>ref|XP_002308736.1| hypothetical protein POPTR_0006s00320g [Populus trichocarpa]
 gb|EEE92259.1| hypothetical protein POPTR_0006s00320g [Populus trichocarpa]
Length=648

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 76/129 (59%), Gaps = 14/129 (11%)
 Frame = +1

Query  196  MRFRRKSVLFLLLVTVLAPIVLYTDTRFNSSPS-RDEFIEEVSAFTLGGEIRPLNVLPQ-  369
            MR R   V  LL ++VLAPI+LY D+  + +PS + EF+E+V+A  L  +   LNVLPQ 
Sbjct  1    MRLR-NLVFGLLSLSVLAPILLYIDSFSSFTPSFKQEFLEDVTALILPADTSNLNVLPQD  59

Query  370  EPNTITKEPLGVVYSEN---SILSHS--------EASDGQRNESARKTRQLAEENEMGNV  516
            E + + KEP+G++Y++N   +IL+          E +  ++++  ++  Q A + +    
Sbjct  60   ESSAVLKEPIGILYTDNHSKTILTDKGRALSATDEDAQSRKDDIIKQVIQSANQEKEETR  119

Query  517  STKGRDQET  543
            + +G DQE+
Sbjct  120  TDRGADQES  128



>ref|XP_007213869.1| hypothetical protein PRUPE_ppa018681mg [Prunus persica]
 gb|EMJ15068.1| hypothetical protein PRUPE_ppa018681mg [Prunus persica]
Length=659

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 68/135 (50%), Gaps = 22/135 (16%)
 Frame = +1

Query  229  LLVTVLAPIVLYTDTRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNTITKEPLGVV  408
            L VTV+API+LYTD               + +F +      LN+LPQE +T  KEP+GVV
Sbjct  11   LFVTVIAPIILYTD--------------RLGSFQVSSSSCRLNLLPQESSTTLKEPVGVV  56

Query  409  YSENSILSHSE--ASDGQRNESARKTRQL-AEENEMGNVSTKGRDQETGRAVDDDPLRQV  579
            YS+NS  S+ E   S    N S +    + + E+    V +   DQ   +   D+P+RQV
Sbjct  57   YSDNSTNSYPETRGSSAHPNHSHKDGPSVDSMEHVSARVLSTTNDQNLSQT--DNPIRQV  114

Query  580  T---EEGNNSVKSDH  615
            T   E+GN  +   H
Sbjct  115  TQTLEQGNQFMSDLH  129



>ref|XP_010538434.1| PREDICTED: probable galacturonosyltransferase 4 [Tarenaya hassleriana]
Length=649

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 73/130 (56%), Gaps = 12/130 (9%)
 Frame = +1

Query  238  TVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNTITKEPLGVVY  411
            TV AP++ YTD  + F +  SR +F+E+V+A T   +   LN+LPQE  T  + P+GVVY
Sbjct  15   TVAAPLLFYTDNASTFKTPSSRRDFLEDVTALTFNSDAVRLNLLPQETPTTIRGPVGVVY  74

Query  412  SENSILSHSEASDGQRNESARKTRQLAEENEMGN---VSTKGRDQETGRAVDDDPLRQVT  582
            S+ S     ++ +G  + S  +   L+E  E  +   +ST G D ++     ++P+RQVT
Sbjct  75   SKKS----EDSLNGFASSSLSQDLPLSETREHVSARVLSTTGVDDQSQ---TENPIRQVT  127

Query  583  EEGNNSVKSD  612
            +      K+D
Sbjct  128  DAAAGIDKND  137



>ref|XP_009363241.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
4 [Pyrus x bretschneideri]
Length=667

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 74/144 (51%), Gaps = 26/144 (18%)
 Frame = +1

Query  229  LLVTVLAPIVLYTD--------TRFNSSPSRDEFIEEVSAFTLGGE--IRPLNVLPQEPN  378
            L VTV+API LYTD           +SS   D+F+E+V+AF          LN+LPQE +
Sbjct  11   LFVTVIAPITLYTDRLASISIQAPSSSSSGDDDFVEDVTAFPANAAHTTAHLNLLPQESS  70

Query  379  TIT--KEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEE-----NEMGNVSTKGRDQ  537
            T T  KEP+GVVYS+NS    +++  G +  SA        +     + M +VS +    
Sbjct  71   TTTRPKEPVGVVYSDNS----TDSLPGAKGTSAHPNHSHPHQDGRLVDSMEHVSARMLST  126

Query  538  ETGRAVDD--DPLRQVT---EEGN  594
             T   +    DP+RQVT   E+GN
Sbjct  127  TTDPDLSQTYDPIRQVTKTLEQGN  150



>ref|XP_009407928.1| PREDICTED: probable galacturonosyltransferase 4 [Musa acuminata 
subsp. malaccensis]
Length=661

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTDTRFNSS--PSRDEFIEEVSAFTLG-GEIRPLNVLPQEP  375
            RR  VL LL +TVLAPIVLYTD    +S   S DE ++E S  + G  ++   + L QE 
Sbjct  3    RRNLVLALLCLTVLAPIVLYTDRLSAASEPSSNDEVLDEASGLSFGTNQVGEPHALSQEL  62

Query  376  NTITKEPLGVVYSENS  423
                KEP+GV+YS+NS
Sbjct  63   TNSVKEPVGVIYSDNS  78



>ref|XP_006597630.1| PREDICTED: probable galacturonosyltransferase 4-like [Glycine 
max]
 gb|KHN14400.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=657

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 65/122 (53%), Gaps = 15/122 (12%)
 Frame = +1

Query  247  APIVLYTDT--RFNSSPSRDEFIEEVSAFTL-GGEIRPLNVLPQEPNTITKEPLGVVYSE  417
            APIVLYTD    F S  ++ EFIE+V+AFT    +   LN+LPQE +T  KEP+  VY+E
Sbjct  18   APIVLYTDRLGTFESPSNKQEFIEDVTAFTFSAADSSHLNLLPQETSTAVKEPVRAVYTE  77

Query  418  NSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAVDDDPLRQVTE---E  588
                   E S  +RN    +  QL E  E  +        E  +  +++P++ VT+   +
Sbjct  78   -------EDSTNRRN--LPQGLQLVESREHVSARMLSTTTEEDQTKNENPIKLVTDGIKQ  128

Query  589  GN  594
            GN
Sbjct  129  GN  130



>ref|XP_004158838.1| PREDICTED: probable galacturonosyltransferase 4-like [Cucumis 
sativus]
 gb|KGN49014.1| hypothetical protein Csa_6G510320 [Cucumis sativus]
Length=641

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 66/128 (52%), Gaps = 9/128 (7%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTDTRFNS--SPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNT  381
            R  V  +L  TV+API+LYTD R  S    S+ + +E  +          LN++  + ++
Sbjct  4    RNLVALMLFFTVIAPILLYTD-RLASLKFSSKGDLVEGFATSGFNSNYGHLNLVDGKSSS  62

Query  382  ITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAVDD  561
              KEP+ +VYS+N +L+ S ASD Q N+  +   +      +     +G  Q      ++
Sbjct  63   SVKEPVAIVYSDNKLLTDSGASDWQSNDGIQGVIERKSTRVLSTTDDEGLSQ------NE  116

Query  562  DPLRQVTE  585
            +P++QVT+
Sbjct  117  NPIKQVTD  124



>gb|KHN03562.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=656

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 70/151 (46%), Gaps = 23/151 (15%)
 Frame = +1

Query  196  MRFRRKSVLFLLLVTVLAPIVLYTDT--RFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQ  369
            M   R  VL LL +T +APIVL+TD    F    +  EFIE V+AF    +   LN+LPQ
Sbjct  1    MVVTRNIVLLLLSITFVAPIVLFTDRLGTFKYPFAEQEFIEAVTAFVSAADSGHLNLLPQ  60

Query  370  EPNTITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGR  549
            E       P+G+VY+E          D    E+       A+  E  +        + G+
Sbjct  61   E-----SLPIGLVYTE----------DTSNTENLLHGLHFAKPGEHVSARVLSATNDEGQ  105

Query  550  AVDDDPLRQVTE---EGNNS---VKSDHISD  624
               ++P++ VT+   +GN +   VK+D   D
Sbjct  106  TKGENPIKLVTDGINQGNQNSYMVKADTTGD  136



>ref|XP_009398763.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=663

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 81/146 (55%), Gaps = 20/146 (14%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLG----GEIRPLNVLP  366
            RR+ VL LL +TVL+PIVLYTD  +  ++  S +E  +E S+ + G    GE+R    L 
Sbjct  3    RRRLVLALLCLTVLSPIVLYTDRLSASSNPSSNNEVGDEASSLSFGTSDAGELR---ALA  59

Query  367  QEPNTITKEPLGVVYSENS-----ILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGR  531
            QE     KEP+GVVYS+NS     IL+  E  DG ++ +A++      E     V +   
Sbjct  60   QELTNSVKEPIGVVYSDNSNNSNQILTTPE--DGSKDSTAKELPLGKSEEHKSRVLSAAV  117

Query  532  DQETGRAVDDDPLRQVTE--EGNNSV  603
            D+ +    ++  +++VT+   GNNS+
Sbjct  118  DERS--LPEEGVIKEVTDGVTGNNSL  141



>ref|XP_008384215.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Malus 
domestica]
Length=669

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 74/146 (51%), Gaps = 28/146 (19%)
 Frame = +1

Query  229  LLVTVLAPIVLYTD----------TRFNSSPSRDEFIEEVSAFTLGGE--IRPLNVLPQE  372
            L VTV+API+LYTD          +  +SS   D+F E+V+AF          LN+LPQE
Sbjct  11   LFVTVIAPIILYTDRLASISIQASSSSSSSSGDDDFFEDVTAFPANSARTTARLNLLPQE  70

Query  373  PNTIT--KEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEE-----NEMGNVSTKGR  531
             +T T  KEP+GVVYS++S  S  E        SA     L  +     + M +VS +  
Sbjct  71   SSTTTRLKEPVGVVYSDDSTDSLPETX----GTSAHPNHSLQHQDGHSVDSMEHVSARVL  126

Query  532  DQETGRAVD--DDPLRQVT---EEGN  594
               T   +   D+P+RQVT   E+GN
Sbjct  127  STTTDPDLSQTDNPIRQVTQTLEQGN  152



>ref|XP_010096508.1| putative galacturonosyltransferase 4 [Morus notabilis]
 gb|EXB64628.1| putative galacturonosyltransferase 4 [Morus notabilis]
Length=657

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 18/105 (17%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD---TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  V+ +L VTV+APIVLYTD   T  + S S +EF+E+V+                EP+
Sbjct  4    RNVVIGMLFVTVIAPIVLYTDRLGTFQSYSASTNEFVEDVTTV--------------EPS  49

Query  379  TITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGN  513
            T  KEP+G+VYS+NS  S   + D  + ES+  T    ++ ++G+
Sbjct  50   TKIKEPIGIVYSDNSNQSLPNSGDAVK-ESSTDTSNSEQDWQLGD  93



>ref|XP_009395236.1| PREDICTED: probable galacturonosyltransferase 4 [Musa acuminata 
subsp. malaccensis]
Length=636

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 66/144 (46%), Gaps = 20/144 (14%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTDTRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNTI  384
            RRK VLFLL VTV+APIVL     F  +     F +++   +   E+  LN L QE    
Sbjct  3    RRKPVLFLLCVTVVAPIVLAITPGFVGN---SHFGDQIPILSSRNEVETLNALSQESVDA  59

Query  385  TKEPLGVVYSENSILS-HSEASD--------------GQRNESARKTRQLAEENEMGNVS  519
             KEP   VY ENS  S H  A                GQ  +   K+R L+E++E  N+ 
Sbjct  60   VKEPTWAVYPENSSNSDHVSAKSSNGVDASTTTEMPLGQSGQ--HKSRVLSEDSEGTNLQ  117

Query  520  TKGRDQETGRAVDDDPLRQVTEEG  591
            TK   Q+  ++   D   Q  E G
Sbjct  118  TKTVIQQVTKSESKDDGLQKPEMG  141



>ref|XP_009374812.1| PREDICTED: probable galacturonosyltransferase 4 [Pyrus x bretschneideri]
Length=671

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 73/144 (51%), Gaps = 22/144 (15%)
 Frame = +1

Query  229  LLVTVLAPIVLYTD------------TRFNSSPSRDEFIEEVSAFTLGGE--IRPLNVLP  366
            L VTV+API+LYTD            +  +SS   D+F E+V+AF          LN+LP
Sbjct  11   LFVTVIAPIILYTDRLASISIQASSSSSSSSSSGDDDFFEDVTAFPANSARTTARLNLLP  70

Query  367  QEPNTIT--KEPLGVVYSENSI--LSHSEASDGQRNESAR-KTRQLAEENEMGNVSTKGR  531
            QE +T T  KEP+GVVYS +S   L  ++ +    N S + +  Q  +  E  +      
Sbjct  71   QESSTTTRLKEPVGVVYSNDSTDSLPETKGTSAHPNHSLQHQDGQSVDSTEHVSARVLST  130

Query  532  DQETGRAVDDDPLRQVT---EEGN  594
              +   +  D+P+RQVT   E+GN
Sbjct  131  TADPDLSQTDNPIRQVTQTLEQGN  154



>ref|XP_008384214.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Malus 
domestica]
Length=671

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 74/148 (50%), Gaps = 30/148 (20%)
 Frame = +1

Query  229  LLVTVLAPIVLYTD------------TRFNSSPSRDEFIEEVSAFTLGGE--IRPLNVLP  366
            L VTV+API+LYTD            +  +SS   D+F E+V+AF          LN+LP
Sbjct  11   LFVTVIAPIILYTDRLASISIQASSSSSSSSSSGDDDFFEDVTAFPANSARTTARLNLLP  70

Query  367  QEPNTIT--KEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEE-----NEMGNVSTK  525
            QE +T T  KEP+GVVYS++S  S  E        SA     L  +     + M +VS +
Sbjct  71   QESSTTTRLKEPVGVVYSDDSTDSLPETX----GTSAHPNHSLQHQDGHSVDSMEHVSAR  126

Query  526  GRDQETGRAVD--DDPLRQVT---EEGN  594
                 T   +   D+P+RQVT   E+GN
Sbjct  127  VLSTTTDPDLSQTDNPIRQVTQTLEQGN  154



>ref|XP_008358828.1| PREDICTED: probable galacturonosyltransferase 4 [Malus domestica]
Length=669

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 72/144 (50%), Gaps = 26/144 (18%)
 Frame = +1

Query  229  LLVTVLAPIVLYTD--------TRFNSSPSRDEFIEEVSAFTLGGE--IRPLNVLPQEPN  378
            L VTV+API LYTD           +SS   D+F+E+V+AF          L++LPQE +
Sbjct  11   LFVTVIAPITLYTDRLASISIQASSSSSSGDDDFVEDVTAFPANAAHTTARLSLLPQESS  70

Query  379  TIT--KEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEE-----NEMGNVSTKGRDQ  537
              T  KEP GVVYS+NS    S++  G +  SA        +     + M +VS +    
Sbjct  71   ATTRLKEPEGVVYSDNS----SDSLPGAKGTSAHPNHSHPHQDGLLVDSMEHVSARMLST  126

Query  538  ETGRAVDD--DPLRQVT---EEGN  594
             T   +    DP+RQVT   E+GN
Sbjct  127  TTDPDLSQTYDPIRQVTQTLEQGN  150



>ref|XP_010481273.1| PREDICTED: probable galacturonosyltransferase 4 isoform X8 [Camelina 
sativa]
Length=618

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 5/86 (6%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNT  381
            R  VLF +L+TV+API+LYTD    F +  S+ +F+E+V+A T   +   LN+LP+E   
Sbjct  6    RNLVLFFMLLTVVAPILLYTDPAASFKTPFSKRDFLEDVTALTFNSDENRLNLLPRESPA  65

Query  382  ITKEPLG---VVYSENSILSHSEASD  450
            + +   G   VVYS +      EA D
Sbjct  66   VLRGGGGEEVVVYSVDKNSRRQEARD  91



>gb|KJB67439.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=606

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 19/100 (19%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD---TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPN  378
            R  VL LL ++V+API LYTD   +  N S SR +F+++VSAF              E +
Sbjct  4    RHIVLGLLSISVIAPIFLYTDRVGSFVNPSSSRRDFLDDVSAF--------------ETS  49

Query  379  TITKEPLGVVYSENSILS--HSEASDGQRNESARKTRQLA  492
            T  KEP+GVVYS++S ++  H  A      +  R+ +QL+
Sbjct  50   TALKEPIGVVYSDHSTVTREHKSARVLSATDEERQQQQLS  89



>ref|XP_002882844.1| hypothetical protein ARALYDRAFT_478777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59103.1| hypothetical protein ARALYDRAFT_478777 [Arabidopsis lyrata subsp. 
lyrata]
Length=601

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQE  372
            R  VLFL+L+TV API+LYTD    F +  S+ +F+E+V+A TL  +   LN+LP+E
Sbjct  5    RNLVLFLMLLTVAAPILLYTDPAASFKTPFSKRDFLEDVTALTLNSDGNRLNLLPRE  61



>ref|XP_010481267.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Camelina 
sativa]
 ref|XP_010481268.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Camelina 
sativa]
 ref|XP_010481269.1| PREDICTED: probable galacturonosyltransferase 4 isoform X5 [Camelina 
sativa]
Length=619

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 5/74 (7%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNT  381
            R  VLF +L+TV+API+LYTD    F +  S+ +F+E+V+A T   +   LN+LP+E   
Sbjct  6    RNLVLFFMLLTVVAPILLYTDPAASFKTPFSKRDFLEDVTALTFNSDENRLNLLPRESPA  65

Query  382  ITKEPLG---VVYS  414
            + +   G   VVYS
Sbjct  66   VLRGGGGEEVVVYS  79



>ref|NP_568688.1| probable galacturonosyltransferase 4 [Arabidopsis thaliana]
 sp|Q93ZX7.1|GAUT4_ARATH RecName: Full=Probable galacturonosyltransferase 4; AltName: 
Full=Like glycosyl transferase 3 [Arabidopsis thaliana]
 gb|AAL07051.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14333.1| unknown protein [Arabidopsis thaliana]
 gb|AED95571.1| probable galacturonosyltransferase 4 [Arabidopsis thaliana]
 gb|AHL38587.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=616

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 26/141 (18%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQE-PN  378
            R  VLF +L+TV+A I+LYTD    F +  S+ +F+E+V+A T   +   LN+LP+E P 
Sbjct  6    RNLVLFFMLLTVVAHILLYTDPAASFKTPFSKRDFLEDVTALTFNSDENRLNLLPRESPA  65

Query  379  TITKEPLGVVYSENS----------IL--------SHSEASDGQRNESARKTRQLAEENE  504
             +    +G VYS+ +          +L        SH++ S  Q    A     +  EN 
Sbjct  66   VLRGGLVGAVYSDKNSRRLDQLSARVLSATDDDTHSHTDISIKQVTHDAASDSHINRENM  125

Query  505  MGNVSTKGRDQETGRAVDDDP  567
               ++     Q+T   VD+ P
Sbjct  126  HVQLT-----QQTSEKVDEQP  141



>dbj|BAB11325.1| unnamed protein product [Arabidopsis thaliana]
Length=615

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 26/141 (18%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQE-PN  378
            R  VLF +L+TV+A I+LYTD    F +  S+ +F+E+V+A T   +   LN+LP+E P 
Sbjct  5    RNLVLFFMLLTVVAHILLYTDPAASFKTPFSKRDFLEDVTALTFNSDENRLNLLPRESPA  64

Query  379  TITKEPLGVVYSENS----------IL--------SHSEASDGQRNESARKTRQLAEENE  504
             +    +G VYS+ +          +L        SH++ S  Q    A     +  EN 
Sbjct  65   VLRGGLVGAVYSDKNSRRLDQLSARVLSATDDDTHSHTDISIKQVTHDAASDSHINRENM  124

Query  505  MGNVSTKGRDQETGRAVDDDP  567
               ++     Q+T   VD+ P
Sbjct  125  HVQLT-----QQTSEKVDEQP  140



>ref|XP_010495019.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Camelina 
sativa]
Length=623

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 66/137 (48%), Gaps = 36/137 (26%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQE-PN  378
            R  VLF +L+TV+API+LYTD    F +  S+ +F+E+V+A T   +   LN+LP+E P 
Sbjct  15   RNLVLFFMLLTVVAPILLYTDPAASFKTPFSKRDFLEDVTALTFNSDGNRLNLLPRESPA  74

Query  379  TITKEPLGVVYSENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQETGRAV-  555
             +      VVYS +         + +R E A                   RDQ + R + 
Sbjct  75   VLRGGEEVVVYSVD--------KNSRRQEEA-------------------RDQLSARVLS  107

Query  556  -----DDDPLRQVTEEG  591
                 DD+ ++QVT+  
Sbjct  108  ATDDDDDNSIKQVTDSA  124



>ref|XP_010441403.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Camelina 
sativa]
Length=613

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 61/111 (55%), Gaps = 12/111 (11%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNT  381
            R  VLF +L+TV+API+LYTD    F +  S+ +F+E+V+A T   +   LN+LP+E   
Sbjct  6    RNLVLFFMLLTVVAPILLYTDPAASFKTPFSKRDFLEDVTALTFNSDENRLNLLPRE---  62

Query  382  ITKEPLGVVYSENSILSHSEASDGQRNESAR---KTRQLAEENEMGNVSTK  525
                P  V+     ++ +S   + +R E AR     R L+  ++ G+ S K
Sbjct  63   ---SP-AVLRGGEEVVVYSVEKNSRRQEEARDQLSARVLSATDDDGDNSIK  109



>ref|XP_008440947.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008440949.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Cucumis 
melo]
Length=641

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 58/111 (52%), Gaps = 13/111 (12%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD----TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEP  375
            R  V  +L  TV+API+LYTD     +F+S   + + +E  +          LN++  + 
Sbjct  4    RNLVALMLFFTVIAPILLYTDRLASLKFSS---KGDLVEGFATSGFNSNYGHLNLVDGKS  60

Query  376  NTITKEPLGVVYSENSILSHSEASDGQRNESA------RKTRQLAEENEMG  510
            ++  KEP+ ++YS+N +L  S AS+ Q N+        + TR L+  +E G
Sbjct  61   SSSVKEPVAIIYSDNKLLPDSGASNWQSNDGIQGVIERKSTRVLSTTDEEG  111



>ref|XP_006279595.1| hypothetical protein CARUB_v10026096mg [Capsella rubella]
 gb|EOA12493.1| hypothetical protein CARUB_v10026096mg [Capsella rubella]
Length=614

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGGEIRPLNVLPQEPNT  381
            R  VLF +++TV API LYTD    F +  S+ +F+E+V+A T   +   LN+LP+E   
Sbjct  6    RNLVLFFMVLTVAAPIFLYTDPAASFKTPFSKRDFLEDVTALTFNSDENRLNLLPRESPA  65

Query  382  ITK--EPLGVVYS  414
            + K  E   VVY+
Sbjct  66   VVKGGEEEVVVYT  78



>ref|XP_009398761.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=675

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 84/156 (54%), Gaps = 28/156 (18%)
 Frame = +1

Query  205  RRKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLG----GEIRPLNVLP  366
            RR+ VL LL +TVL+PIVLYTD  +  ++  S +E  +E S+ + G    GE+R L  + 
Sbjct  3    RRRLVLALLCLTVLSPIVLYTDRLSASSNPSSNNEVGDEASSLSFGTSDAGELRALAQVA  62

Query  367  QE----------PNTITKEPLGVVYSENS-----ILSHSEASDGQRNESARKTRQLAEEN  501
             E           N++ KEP+GVVYS+NS     IL+  E  DG ++ +A++      E 
Sbjct  63   LEFSPKFSASELTNSV-KEPIGVVYSDNSNNSNQILTTPE--DGSKDSTAKELPLGKSEE  119

Query  502  EMGNVSTKGRDQETGRAVDDDPLRQVTE--EGNNSV  603
                V +   D+ +    ++  +++VT+   GNNS+
Sbjct  120  HKSRVLSAAVDERS--LPEEGVIKEVTDGVTGNNSL  153



>ref|XP_010481270.1| PREDICTED: probable galacturonosyltransferase 4 isoform X6 [Camelina 
sativa]
 ref|XP_010481271.1| PREDICTED: probable galacturonosyltransferase 4 isoform X7 [Camelina 
sativa]
Length=619

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNS--SPSRDEFIEEVSAFTLGGEIRPLNVLPQEP  375
            R  VLF +L+TV+API+LYTD    F +  S  RD F+E+V+A T   +   LN+LP+E 
Sbjct  6    RNLVLFFMLLTVVAPILLYTDPAASFKTPFSAKRD-FLEDVTALTFNSDENRLNLLPRES  64

Query  376  NTITKEPLG---VVYSENSILSHSEASD  450
              + +   G   VVYS +      EA D
Sbjct  65   PAVLRGGGGEEVVVYSVDKNSRRQEARD  92



>gb|KFK31342.1| hypothetical protein AALP_AA6G099900 [Arabis alpina]
Length=651

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 73/141 (52%), Gaps = 19/141 (13%)
 Frame = +1

Query  208  RKSVLFLLLVTVLAPIVLYTD--TRFNSSPSRDEFIEEVSAFTLGG-EIRPLNVLPQE-P  375
            R  VLF + +TV API LYTD    F +  S+ +F+E+V+A T    E R LN+LP+E P
Sbjct  5    RNLVLFFIFLTVAAPIFLYTDPTASFKTPFSKRDFLEDVTALTFNSDENRRLNLLPRESP  64

Query  376  NTITKEPLGVVYS----ENSILSHSEASDGQRNESARKTRQLAEENEMGNVSTKGRDQET  543
              +    +GVVYS    ++S L   + S+ +   SAR              +T+  D + 
Sbjct  65   QVVRGGVVGVVYSKQNPDSSSLDAHKISEPRDQLSARVLS-----------ATQDDDDDN  113

Query  544  GRAVDDDPLRQVTEEGNNSVK  606
             ++ +D+P+  VT+  +   K
Sbjct  114  KQSHNDNPIELVTDAASQMYK  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500