BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF026A11

Length=660
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011069659.1|  PREDICTED: subtilisin-like protease                274   2e-83   Sesamum indicum [beniseed]
ref|XP_009771086.1|  PREDICTED: subtilisin-like protease                270   9e-82   Nicotiana sylvestris
ref|XP_009790288.1|  PREDICTED: subtilisin-like protease                269   3e-81   Nicotiana sylvestris
ref|XP_009800439.1|  PREDICTED: subtilisin-like protease                269   4e-81   Nicotiana sylvestris
ref|XP_004252763.1|  PREDICTED: subtilisin-like protease                269   4e-81   Solanum lycopersicum
ref|XP_006342631.1|  PREDICTED: subtilisin-like protease-like           267   1e-80   Solanum tuberosum [potatoes]
ref|XP_006342632.1|  PREDICTED: subtilisin-like protease-like           266   2e-80   Solanum tuberosum [potatoes]
ref|XP_010320328.1|  PREDICTED: subtilisin-like protease                262   7e-79   Solanum lycopersicum
ref|XP_009604890.1|  PREDICTED: subtilisin-like protease                258   5e-77   Nicotiana tomentosiformis
ref|XP_010263512.1|  PREDICTED: subtilisin-like protease                249   1e-73   Nelumbo nucifera [Indian lotus]
ref|XP_009595649.1|  PREDICTED: subtilisin-like protease                248   3e-73   Nicotiana tomentosiformis
gb|ACT34764.1|  subtilisin-like protease preproenzyme                   247   4e-73   Nicotiana tabacum [American tobacco]
ref|XP_002282841.2|  PREDICTED: uncharacterized protein LOC100259061    250   2e-72   
ref|XP_010112177.1|  Subtilisin-like protease                           245   3e-72   Morus notabilis
ref|XP_009359804.1|  PREDICTED: subtilisin-like protease                243   2e-71   Pyrus x bretschneideri [bai li]
gb|KCW62487.1|  hypothetical protein EUGRSUZ_H05125                     241   8e-71   Eucalyptus grandis [rose gum]
ref|XP_010059918.1|  PREDICTED: subtilisin-like protease                241   1e-70   Eucalyptus grandis [rose gum]
ref|XP_002267740.1|  PREDICTED: subtilisin-like protease                240   1e-70   Vitis vinifera
ref|XP_008393790.1|  PREDICTED: subtilisin-like protease                240   2e-70   
gb|KCW66398.1|  hypothetical protein EUGRSUZ_F00212                     239   2e-70   Eucalyptus grandis [rose gum]
ref|XP_010059917.1|  PREDICTED: subtilisin-like protease                240   2e-70   Eucalyptus grandis [rose gum]
ref|XP_010059919.1|  PREDICTED: subtilisin-like protease                240   2e-70   Eucalyptus grandis [rose gum]
ref|XP_008351993.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    239   3e-70   
gb|EYU45081.1|  hypothetical protein MIMGU_mgv1a002217mg                238   5e-70   Erythranthe guttata [common monkey flower]
gb|KCW66392.1|  hypothetical protein EUGRSUZ_F00206                     239   5e-70   Eucalyptus grandis [rose gum]
ref|XP_010025755.1|  PREDICTED: subtilisin-like protease                239   5e-70   
ref|XP_010059916.1|  PREDICTED: subtilisin-like protease                239   6e-70   Eucalyptus grandis [rose gum]
ref|XP_002310134.2|  subtilase family protein                           238   7e-70   Populus trichocarpa [western balsam poplar]
ref|XP_008220243.1|  PREDICTED: subtilisin-like protease                238   1e-69   Prunus mume [ume]
ref|XP_010263511.1|  PREDICTED: subtilisin-like protease                238   2e-69   Nelumbo nucifera [Indian lotus]
gb|EYU25437.1|  hypothetical protein MIMGU_mgv1a002005mg                237   2e-69   Erythranthe guttata [common monkey flower]
ref|XP_011043530.1|  PREDICTED: subtilisin-like protease                236   3e-69   Populus euphratica
ref|XP_009610212.1|  PREDICTED: subtilisin-like protease                236   6e-69   Nicotiana tomentosiformis
ref|XP_008221259.1|  PREDICTED: subtilisin-like protease                236   6e-69   Prunus mume [ume]
ref|XP_007221958.1|  hypothetical protein PRUPE_ppa001770mg             235   1e-68   Prunus persica
ref|XP_008220244.1|  PREDICTED: subtilisin-like protease                234   3e-68   Prunus mume [ume]
gb|KJB63881.1|  hypothetical protein B456_010G021600                    233   5e-68   Gossypium raimondii
ref|XP_002523606.1|  Cucumisin precursor, putative                      233   7e-68   
ref|XP_008357385.1|  PREDICTED: subtilisin-like protease                233   8e-68   
emb|CDP17956.1|  unnamed protein product                                231   2e-67   Coffea canephora [robusta coffee]
ref|XP_010263712.1|  PREDICTED: subtilisin-like protease                225   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_007017195.1|  Subtilisin-like serine endopeptidase family ...    229   2e-66   
ref|XP_008785865.1|  PREDICTED: subtilisin-like protease                228   4e-66   Phoenix dactylifera
ref|XP_008785920.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    228   4e-66   
ref|XP_004291093.1|  PREDICTED: subtilisin-like protease                226   2e-65   Fragaria vesca subsp. vesca
ref|XP_003548400.1|  PREDICTED: subtilisin-like protease-like           225   7e-65   Glycine max [soybeans]
ref|XP_006434737.1|  hypothetical protein CICLE_v10000364mg             225   8e-65   
gb|KDO84129.1|  hypothetical protein CISIN_1g004265mg                   225   8e-65   Citrus sinensis [apfelsine]
ref|XP_009345959.1|  PREDICTED: subtilisin-like protease                225   8e-65   
ref|XP_003626594.1|  Subtilisin-like protease                           224   1e-64   Medicago truncatula
ref|XP_004494864.1|  PREDICTED: subtilisin-like protease-like           224   2e-64   
gb|KDP41713.1|  hypothetical protein JCGZ_16120                         224   2e-64   Jatropha curcas
ref|XP_011029618.1|  PREDICTED: subtilisin-like protease                224   2e-64   Populus euphratica
ref|XP_009343175.1|  PREDICTED: subtilisin-like protease                223   3e-64   Pyrus x bretschneideri [bai li]
ref|XP_006425911.1|  hypothetical protein CICLE_v10024929mg             223   3e-64   Citrus clementina [clementine]
ref|XP_009799242.1|  PREDICTED: subtilisin-like protease                223   4e-64   Nicotiana sylvestris
ref|XP_006466594.1|  PREDICTED: subtilisin-like protease-like           223   5e-64   Citrus sinensis [apfelsine]
ref|XP_010912031.1|  PREDICTED: subtilisin-like protease                223   6e-64   Elaeis guineensis
ref|XP_007135315.1|  hypothetical protein PHAVU_010G119000g             220   1e-63   Phaseolus vulgaris [French bean]
ref|XP_010540359.1|  PREDICTED: subtilisin-like protease                221   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_008241490.1|  PREDICTED: subtilisin-like protease                221   1e-63   Prunus mume [ume]
ref|XP_007017194.1|  Subtilisin-like serine endopeptidase family ...    221   2e-63   
ref|XP_006374913.1|  subtilase family protein                           221   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_008785921.1|  PREDICTED: subtilisin-like protease                221   2e-63   Phoenix dactylifera
ref|XP_002510195.1|  Cucumisin precursor, putative                      221   3e-63   Ricinus communis
ref|XP_007204261.1|  hypothetical protein PRUPE_ppa001828mg             219   8e-63   
ref|XP_006374911.1|  subtilase family protein                           218   3e-62   
gb|ABK95622.1|  unknown                                                 218   3e-62   Populus trichocarpa [western balsam poplar]
ref|XP_002284864.1|  PREDICTED: subtilisin-like protease                217   5e-62   Vitis vinifera
ref|XP_010320531.1|  PREDICTED: subtilisin-like protease                217   5e-62   
emb|CDP01316.1|  unnamed protein product                                217   5e-62   Coffea canephora [robusta coffee]
ref|XP_006434738.1|  hypothetical protein CICLE_v10000411mg             216   6e-62   
gb|EYU25440.1|  hypothetical protein MIMGU_mgv1a0017511mg               215   7e-62   Erythranthe guttata [common monkey flower]
gb|KDO84130.1|  hypothetical protein CISIN_1g004809mg                   216   7e-62   Citrus sinensis [apfelsine]
ref|XP_011069662.1|  PREDICTED: subtilisin-like protease                217   7e-62   Sesamum indicum [beniseed]
ref|XP_010028239.1|  PREDICTED: subtilisin-like protease                216   1e-61   Eucalyptus grandis [rose gum]
gb|KCW54937.1|  hypothetical protein EUGRSUZ_I00910                     216   1e-61   Eucalyptus grandis [rose gum]
gb|KEH42928.1|  subtilisin-like serine protease                         216   1e-61   Medicago truncatula
emb|CAN60787.1|  hypothetical protein VITISV_034533                     215   3e-61   Vitis vinifera
ref|XP_002284869.3|  PREDICTED: subtilisin-like protease                215   3e-61   Vitis vinifera
gb|EYU36350.1|  hypothetical protein MIMGU_mgv1a001799mg                214   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_003529873.2|  PREDICTED: subtilisin-like protease-like           214   6e-61   
ref|XP_011017184.1|  PREDICTED: subtilisin-like protease                214   7e-61   Populus euphratica
gb|EPS63009.1|  subtilisin-like protease preproenzyme                   213   7e-61   Genlisea aurea
ref|XP_010320326.1|  PREDICTED: subtilisin-like protease                214   8e-61   
gb|KJB58523.1|  hypothetical protein B456_009G213500                    214   8e-61   Gossypium raimondii
ref|XP_011029640.1|  PREDICTED: subtilisin-like protease                214   1e-60   Populus euphratica
emb|CDP17236.1|  unnamed protein product                                213   1e-60   Coffea canephora [robusta coffee]
ref|XP_010320327.1|  PREDICTED: subtilisin-like protease                212   4e-60   Solanum lycopersicum
ref|XP_003548151.1|  PREDICTED: subtilisin-like protease-like           212   4e-60   Glycine max [soybeans]
ref|XP_010267360.1|  PREDICTED: subtilisin-like protease                211   6e-60   Nelumbo nucifera [Indian lotus]
ref|XP_002510194.1|  Xylem serine proteinase 1 precursor, putative      211   7e-60   Ricinus communis
gb|EYU19442.1|  hypothetical protein MIMGU_mgv1a001731mg                211   7e-60   Erythranthe guttata [common monkey flower]
ref|XP_009797476.1|  PREDICTED: subtilisin-like protease                211   9e-60   Nicotiana sylvestris
ref|XP_004229665.1|  PREDICTED: subtilisin-like protease                211   1e-59   
ref|XP_009608285.1|  PREDICTED: subtilisin-like protease                210   2e-59   Nicotiana tomentosiformis
ref|XP_008444560.1|  PREDICTED: subtilisin-like protease                210   2e-59   Cucumis melo [Oriental melon]
ref|XP_007147252.1|  hypothetical protein PHAVU_006G108700g             209   3e-59   Phaseolus vulgaris [French bean]
ref|XP_009769987.1|  PREDICTED: subtilisin-like protease isoform X1     209   3e-59   Nicotiana sylvestris
ref|XP_011074394.1|  PREDICTED: subtilisin-like protease                209   4e-59   
gb|KEH18575.1|  subtilisin-like serine protease                         209   4e-59   Medicago truncatula
ref|XP_006345406.1|  PREDICTED: subtilisin-like protease-like           209   4e-59   Solanum tuberosum [potatoes]
ref|XP_011464036.1|  PREDICTED: subtilisin-like protease                204   4e-59   Fragaria vesca subsp. vesca
gb|KEH18574.1|  subtilisin-like serine protease                         208   6e-59   Medicago truncatula
emb|CAA07059.1|  SBT4B protein                                          208   7e-59   Solanum lycopersicum
ref|XP_011074591.1|  PREDICTED: subtilisin-like protease                208   8e-59   Sesamum indicum [beniseed]
emb|CAA07062.1|  SBT4E protein                                          208   8e-59   Solanum lycopersicum
ref|NP_001234780.1|  subtilisin-like protease                           208   8e-59   Solanum lycopersicum
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg                208   8e-59   Erythranthe guttata [common monkey flower]
ref|XP_007047286.1|  Subtilisin-like serine endopeptidase family ...    208   1e-58   
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg                207   1e-58   Erythranthe guttata [common monkey flower]
ref|NP_001234774.1|  subtilisin-like protease precursor                 207   1e-58   Solanum lycopersicum
gb|KJB43733.1|  hypothetical protein B456_007G214100                    207   1e-58   Gossypium raimondii
ref|XP_009769989.1|  PREDICTED: subtilisin-like protease                207   2e-58   Nicotiana sylvestris
ref|XP_006345401.1|  PREDICTED: subtilisin-like protease-like           207   2e-58   Solanum tuberosum [potatoes]
ref|XP_009343011.1|  PREDICTED: subtilisin-like protease                207   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_004249504.1|  PREDICTED: subtilisin-like protease                207   2e-58   Solanum lycopersicum
gb|ACA64703.1|  subtilase                                               207   2e-58   Nicotiana tabacum [American tobacco]
ref|XP_009621569.1|  PREDICTED: subtilisin-like protease                207   2e-58   
ref|XP_004514927.1|  PREDICTED: subtilisin-like protease-like           207   2e-58   Cicer arietinum [garbanzo]
ref|XP_010484555.1|  PREDICTED: subtilisin-like protease                206   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_007207210.1|  hypothetical protein PRUPE_ppa001938mg             206   3e-58   
emb|CDP01315.1|  unnamed protein product                                207   3e-58   Coffea canephora [robusta coffee]
ref|XP_011069661.1|  PREDICTED: subtilisin-like protease                207   3e-58   Sesamum indicum [beniseed]
ref|XP_011074393.1|  PREDICTED: subtilisin-like protease                206   3e-58   Sesamum indicum [beniseed]
gb|KDO79191.1|  hypothetical protein CISIN_1g004824mg                   206   3e-58   Citrus sinensis [apfelsine]
ref|XP_011069660.1|  PREDICTED: subtilisin-like protease                206   4e-58   Sesamum indicum [beniseed]
gb|KDP41714.1|  hypothetical protein JCGZ_16121                         206   5e-58   Jatropha curcas
ref|XP_010093626.1|  Subtilisin-like protease                           206   5e-58   
gb|EYU36342.1|  hypothetical protein MIMGU_mgv1a001789mg                206   5e-58   Erythranthe guttata [common monkey flower]
ref|XP_003590866.1|  Subtilisin-like protease                           206   6e-58   
gb|AES61117.2|  subtilisin-like serine protease                         206   6e-58   Medicago truncatula
ref|XP_006345405.1|  PREDICTED: subtilisin-like protease-like           205   2e-57   
gb|EYU36339.1|  hypothetical protein MIMGU_mgv1a001782mg                204   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_006345494.1|  PREDICTED: subtilisin-like protease-like           204   2e-57   
ref|XP_008370910.1|  PREDICTED: subtilisin-like protease                203   2e-57   
ref|XP_004249505.1|  PREDICTED: subtilisin-like protease                204   3e-57   Solanum lycopersicum
gb|EYU36337.1|  hypothetical protein MIMGU_mgv1a020902mg                203   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_006339058.1|  PREDICTED: subtilisin-like protease-like           204   3e-57   Solanum tuberosum [potatoes]
ref|XP_009771925.1|  PREDICTED: subtilisin-like protease                204   3e-57   Nicotiana sylvestris
ref|XP_008218400.1|  PREDICTED: subtilisin-like protease                204   3e-57   Prunus mume [ume]
ref|XP_002510196.1|  Cucumisin precursor, putative                      204   4e-57   Ricinus communis
ref|XP_004514928.1|  PREDICTED: subtilisin-like protease-like           203   4e-57   
ref|XP_010464539.1|  PREDICTED: subtilisin-like protease                203   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006393907.1|  hypothetical protein EUTSA_v10005646mg             202   6e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009419397.1|  PREDICTED: subtilisin-like protease                203   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006345400.1|  PREDICTED: subtilisin-like protease-like           203   6e-57   Solanum tuberosum [potatoes]
ref|XP_009338017.1|  PREDICTED: subtilisin-like protease                202   8e-57   Pyrus x bretschneideri [bai li]
ref|XP_003552427.1|  PREDICTED: subtilisin-like protease-like           202   8e-57   Glycine max [soybeans]
ref|XP_009342993.1|  PREDICTED: subtilisin-like protease                202   1e-56   Pyrus x bretschneideri [bai li]
gb|AAO62352.1|  subtilase                                               202   1e-56   Casuarina glauca
ref|XP_009787984.1|  PREDICTED: subtilisin-like protease                202   1e-56   Nicotiana sylvestris
gb|ACA64702.1|  subtilase                                               202   1e-56   Nicotiana tabacum [American tobacco]
ref|XP_009337959.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    202   1e-56   
gb|KEH18578.1|  subtilisin-like serine protease                         202   1e-56   Medicago truncatula
ref|XP_004229661.1|  PREDICTED: subtilisin-like protease                201   2e-56   
ref|XP_003624105.1|  Xylem serine proteinase                            201   2e-56   Medicago truncatula
ref|XP_009608286.1|  PREDICTED: subtilisin-like protease                201   3e-56   Nicotiana tomentosiformis
ref|XP_006345402.1|  PREDICTED: subtilisin-like protease-like           201   3e-56   Solanum tuberosum [potatoes]
ref|XP_004156411.1|  PREDICTED: subtilisin-like protease-like           201   3e-56   
ref|XP_004143027.1|  PREDICTED: subtilisin-like protease-like           201   3e-56   
ref|XP_007139763.1|  hypothetical protein PHAVU_008G057000g             201   4e-56   Phaseolus vulgaris [French bean]
ref|XP_006345404.1|  PREDICTED: subtilisin-like protease-like           200   5e-56   Solanum tuberosum [potatoes]
ref|NP_569044.1|  Subtilisin-like serine endopeptidase family pro...    200   5e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KJB59847.1|  hypothetical protein B456_009G275900                    200   6e-56   Gossypium raimondii
ref|XP_009595146.1|  PREDICTED: subtilisin-like protease                200   7e-56   Nicotiana tomentosiformis
ref|XP_004229664.2|  PREDICTED: subtilisin-like protease                200   8e-56   Solanum lycopersicum
ref|XP_011464023.1|  PREDICTED: subtilisin-like protease                199   9e-56   Fragaria vesca subsp. vesca
ref|XP_010687642.1|  PREDICTED: subtilisin-like protease                199   1e-55   
gb|ACA64704.1|  subtilase                                               199   1e-55   Nicotiana tabacum [American tobacco]
ref|XP_004492811.1|  PREDICTED: subtilisin-like protease-like           199   1e-55   Cicer arietinum [garbanzo]
ref|XP_011468374.1|  PREDICTED: uncharacterized protein LOC101302380    202   1e-55   Fragaria vesca subsp. vesca
ref|XP_002865029.1|  subtilase family protein                           198   2e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_008355893.1|  PREDICTED: subtilisin-like protease                198   3e-55   
ref|XP_003535388.1|  PREDICTED: subtilisin-like protease-like           198   4e-55   Glycine max [soybeans]
ref|XP_006386505.1|  hypothetical protein POPTR_0002s12610g             197   5e-55   
emb|CAA59964.1|  subtilisin-like protease                               197   5e-55   Alnus glutinosa
ref|XP_002277899.1|  PREDICTED: subtilisin-like protease                197   6e-55   Vitis vinifera
ref|XP_004249811.1|  PREDICTED: subtilisin-like protease                197   6e-55   
ref|XP_008370912.1|  PREDICTED: subtilisin-like protease                197   8e-55   
emb|CDY09336.1|  BnaA02g26740D                                          197   8e-55   Brassica napus [oilseed rape]
gb|KHN40450.1|  Subtilisin-like protease                                197   1e-54   Glycine soja [wild soybean]
emb|CAA07060.1|  SBT4C protein                                          197   1e-54   Solanum lycopersicum
gb|KHN15887.1|  Subtilisin-like protease                                196   1e-54   Glycine soja [wild soybean]
ref|XP_006847104.1|  hypothetical protein AMTR_s00017p00218650          196   2e-54   
ref|XP_009129098.1|  PREDICTED: subtilisin-like protease                195   2e-54   Brassica rapa
ref|XP_007135313.1|  hypothetical protein PHAVU_010G118800g             195   3e-54   Phaseolus vulgaris [French bean]
gb|KHN15890.1|  Subtilisin-like protease                                195   3e-54   Glycine soja [wild soybean]
ref|XP_010446286.1|  PREDICTED: subtilisin-like protease                192   4e-54   
ref|XP_008657904.1|  PREDICTED: subtilisin-like protease                195   4e-54   
gb|AFW84453.1|  putative subtilase family protein                       195   5e-54   
gb|EYU36338.1|  hypothetical protein MIMGU_mgv1a002690mg                194   6e-54   Erythranthe guttata [common monkey flower]
ref|XP_003595551.1|  Subtilisin-like serine protease                    194   9e-54   Medicago truncatula
ref|XP_006280074.1|  hypothetical protein CARUB_v10025957mg             194   9e-54   
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like           193   2e-53   Cicer arietinum [garbanzo]
ref|XP_010547521.1|  PREDICTED: subtilisin-like protease SDD1           193   2e-53   Tarenaya hassleriana [spider flower]
gb|KEH18576.1|  subtilisin-like serine protease                         192   5e-53   Medicago truncatula
ref|XP_007139760.1|  hypothetical protein PHAVU_008G056700g             192   6e-53   Phaseolus vulgaris [French bean]
ref|XP_003566210.2|  PREDICTED: subtilisin-like protease                191   1e-52   
ref|XP_003553772.1|  PREDICTED: subtilisin-like protease-like           191   2e-52   Glycine max [soybeans]
ref|XP_004961962.1|  PREDICTED: subtilisin-like protease-like           190   2e-52   Setaria italica
gb|KHN15886.1|  Subtilisin-like protease                                189   3e-52   Glycine soja [wild soybean]
gb|ABD28577.1|  Proteinase inhibitor I9, subtilisin propeptide          190   3e-52   Medicago truncatula
ref|XP_007143987.1|  hypothetical protein PHAVU_007G119500g             189   4e-52   Phaseolus vulgaris [French bean]
dbj|BAJ88882.1|  predicted protein                                      189   4e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87233.1|  predicted protein                                      189   4e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006847097.1|  hypothetical protein AMTR_s00017p00216950          188   1e-51   
ref|XP_002282856.2|  PREDICTED: subtilisin-like protease                188   1e-51   
emb|CAN60788.1|  hypothetical protein VITISV_034534                     188   1e-51   Vitis vinifera
gb|KHN06360.1|  Subtilisin-like protease                                189   2e-51   Glycine soja [wild soybean]
dbj|BAJ90426.1|  predicted protein                                      187   3e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003624104.1|  Subtilisin-like protease                           190   3e-51   
dbj|BAJ88973.1|  predicted protein                                      187   3e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP41712.1|  hypothetical protein JCGZ_16119                         187   3e-51   Jatropha curcas
gb|ABR16566.1|  unknown                                                 184   3e-51   Picea sitchensis
ref|XP_007017191.1|  Subtilisin-like serine protease 2, putative        186   5e-51   
dbj|BAD82002.1|  putative subtilase                                     186   7e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008382901.1|  PREDICTED: subtilisin-like protease                184   8e-51   
emb|CDM85158.1|  unnamed protein product                                186   9e-51   Triticum aestivum [Canadian hard winter wheat]
gb|ABN05870.1|  Proteinase inhibitor I9, subtilisin propeptide          183   1e-50   Medicago truncatula
gb|KEH23384.1|  subtilisin-like serine protease                         182   1e-50   Medicago truncatula
ref|XP_008357007.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    184   2e-50   
ref|XP_010647877.1|  PREDICTED: subtilisin-like protease                184   2e-50   
gb|KDP41709.1|  hypothetical protein JCGZ_16116                         184   3e-50   Jatropha curcas
ref|XP_006847107.1|  hypothetical protein AMTR_s00017p00219220          184   3e-50   
emb|CDP01318.1|  unnamed protein product                                184   3e-50   Coffea canephora [robusta coffee]
gb|EYU45084.1|  hypothetical protein MIMGU_mgv1a001942mg                184   4e-50   Erythranthe guttata [common monkey flower]
gb|KDO84128.1|  hypothetical protein CISIN_1g047470mg                   183   5e-50   Citrus sinensis [apfelsine]
ref|XP_006473885.1|  PREDICTED: subtilisin-like protease-like           183   5e-50   Citrus sinensis [apfelsine]
ref|XP_004972264.1|  PREDICTED: subtilisin-like protease-like           183   8e-50   
ref|XP_010068558.1|  PREDICTED: subtilisin-like protease                183   9e-50   Eucalyptus grandis [rose gum]
gb|KCW63975.1|  hypothetical protein EUGRSUZ_G01657                     182   9e-50   Eucalyptus grandis [rose gum]
ref|XP_006434736.1|  hypothetical protein CICLE_v10003898mg             182   9e-50   Citrus clementina [clementine]
gb|EMT18650.1|  Subtilisin-like protease                                182   1e-49   
gb|EMS48839.1|  Subtilisin-like protease                                184   2e-49   Triticum urartu
emb|CAN64996.1|  hypothetical protein VITISV_001780                     182   2e-49   Vitis vinifera
gb|EMT29812.1|  hypothetical protein F775_42283                         181   2e-49   
ref|XP_008220348.1|  PREDICTED: subtilisin-like protease                181   3e-49   
ref|NP_001055646.1|  Os05g0435800                                       181   3e-49   
ref|XP_007224572.1|  hypothetical protein PRUPE_ppa1027224mg            181   4e-49   
ref|XP_008352138.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    180   5e-49   
ref|XP_010233560.1|  PREDICTED: subtilisin-like protease                180   9e-49   
ref|XP_006374912.1|  hypothetical protein POPTR_0014s02640g             179   1e-48   
ref|XP_011029629.1|  PREDICTED: subtilisin-like protease                179   1e-48   Populus euphratica
ref|XP_006655358.1|  PREDICTED: subtilisin-like protease-like           179   2e-48   
ref|XP_008793983.1|  PREDICTED: subtilisin-like protease                179   3e-48   
gb|ACN40199.1|  unknown                                                 178   4e-48   Picea sitchensis
gb|ABR18065.1|  unknown                                                 178   5e-48   Picea sitchensis
emb|CAN64995.1|  hypothetical protein VITISV_001779                     177   8e-48   Vitis vinifera
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease                177   8e-48   Fragaria vesca subsp. vesca
ref|XP_006487072.1|  PREDICTED: subtilisin-like protease-like           176   1e-47   Citrus sinensis [apfelsine]
emb|CDY67452.1|  BnaCnng55020D                                          176   2e-47   Brassica napus [oilseed rape]
ref|XP_006487073.1|  PREDICTED: subtilisin-like protease-like           176   2e-47   
emb|CDY63302.1|  BnaCnng41810D                                          176   2e-47   Brassica napus [oilseed rape]
gb|ACN39811.1|  unknown                                                 175   3e-47   Picea sitchensis
gb|KDO59723.1|  hypothetical protein CISIN_1g046220mg                   176   4e-47   Citrus sinensis [apfelsine]
gb|EYU44466.1|  hypothetical protein MIMGU_mgv1a0020561mg               168   5e-47   Erythranthe guttata [common monkey flower]
ref|XP_006487074.1|  PREDICTED: subtilisin-like protease-like           173   7e-47   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                174   9e-47   Nicotiana sylvestris
ref|XP_006847103.1|  hypothetical protein AMTR_s00017p00218470          169   1e-46   
ref|XP_002446493.1|  hypothetical protein SORBIDRAFT_06g016860          174   1e-46   Sorghum bicolor [broomcorn]
ref|XP_006495263.1|  PREDICTED: subtilisin-like protease-like           174   1e-46   Citrus sinensis [apfelsine]
ref|XP_006487124.1|  PREDICTED: subtilisin-like protease-like           174   1e-46   Citrus sinensis [apfelsine]
ref|XP_008669405.1|  PREDICTED: subtilisin-like protease                173   2e-46   Zea mays [maize]
ref|XP_006422997.1|  hypothetical protein CICLE_v10027850mg             173   2e-46   Citrus clementina [clementine]
gb|KJB84343.1|  hypothetical protein B456_N019600                       171   2e-46   Gossypium raimondii
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                173   3e-46   Nicotiana tomentosiformis
ref|XP_004975630.1|  PREDICTED: subtilisin-like protease-like           173   3e-46   Setaria italica
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like           172   3e-46   Cicer arietinum [garbanzo]
ref|XP_003579757.1|  PREDICTED: subtilisin-like protease                173   3e-46   Brachypodium distachyon [annual false brome]
gb|EEE55729.1|  hypothetical protein OsJ_04215                          172   4e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010927456.1|  PREDICTED: subtilisin-like protease                172   6e-46   Elaeis guineensis
ref|XP_011000657.1|  PREDICTED: subtilisin-like protease                172   6e-46   Populus euphratica
ref|XP_002313857.1|  hypothetical protein POPTR_0009s10340g             172   7e-46   
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease                172   7e-46   Sesamum indicum [beniseed]
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             172   7e-46   Prunus persica
emb|CDP02570.1|  unnamed protein product                                172   7e-46   Coffea canephora [robusta coffee]
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like           171   1e-45   Cicer arietinum [garbanzo]
ref|NP_001052820.1|  Os04g0430700                                       171   1e-45   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                171   1e-45   
emb|CAH67004.1|  OSIGBa0160I14.2                                        171   1e-45   
emb|CAE03027.1|  OSJNBa0084A10.2                                        171   1e-45   
ref|XP_003636375.1|  Subtilisin-like protease                           171   2e-45   
ref|XP_003605881.1|  Subtilisin-like protease                           171   2e-45   
ref|XP_003608462.1|  Subtilisin-like protease                           171   2e-45   
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           171   2e-45   
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         170   2e-45   
ref|XP_006652296.1|  PREDICTED: subtilisin-like protease-like           170   3e-45   
emb|CDY43570.1|  BnaC02g16670D                                          160   3e-45   
dbj|BAJ99639.1|  predicted protein                                      170   3e-45   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             170   3e-45   
ref|NP_566473.2|  Subtilase family protein                              170   4e-45   
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             170   4e-45   
emb|CDY29697.1|  BnaA04g17300D                                          169   5e-45   
emb|CDX97540.1|  BnaA05g25390D                                          162   5e-45   
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                169   5e-45   
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease                169   5e-45   
ref|XP_006381615.1|  subtilase family protein                           169   5e-45   
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    169   7e-45   
ref|XP_006847080.1|  hypothetical protein AMTR_s00017p00213920          160   8e-45   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease                169   8e-45   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                169   9e-45   
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                169   9e-45   
gb|EYU25438.1|  hypothetical protein MIMGU_mgv1a001996mg                168   9e-45   
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease                168   9e-45   
ref|XP_004142885.1|  PREDICTED: subtilisin-like protease-like iso...    168   1e-44   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                169   1e-44   
emb|CDY63300.1|  BnaCnng41800D                                          168   1e-44   
ref|XP_002885009.1|  subtilase family protein                           168   1e-44   
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...    168   1e-44   
gb|KJB43875.1|  hypothetical protein B456_007G221100                    168   1e-44   
gb|KJB58612.1|  hypothetical protein B456_009G218000                    168   1e-44   
emb|CDY18653.1|  BnaA09g07420D                                          167   2e-44   
ref|XP_007018544.1|  Xylem serine proteinase 1, putative isoform 2      167   2e-44   
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like           167   2e-44   
emb|CDY18654.1|  BnaA09g07410D                                          167   2e-44   
gb|KCW44171.1|  hypothetical protein EUGRSUZ_L024072                    158   2e-44   
ref|XP_007018543.1|  Xylem serine proteinase 1, putative isoform 1      167   3e-44   
ref|XP_006422999.1|  hypothetical protein CICLE_v10027863mg             167   3e-44   
ref|XP_007047459.1|  Subtilase family protein                           167   3e-44   
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like           167   4e-44   
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like           167   4e-44   
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease                167   4e-44   
ref|XP_002282304.3|  PREDICTED: subtilisin-like protease                167   4e-44   
gb|KDO36993.1|  hypothetical protein CISIN_1g043644mg                   158   5e-44   
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             166   6e-44   
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                166   6e-44   
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                166   7e-44   
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                166   8e-44   
emb|CDY55359.1|  BnaCnng28690D                                          166   9e-44   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           166   9e-44   
ref|XP_009362303.1|  PREDICTED: subtilisin-like protease                166   9e-44   
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g             166   9e-44   
emb|CDY12840.1|  BnaC07g15930D                                          166   1e-43   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                166   1e-43   
gb|KDO59722.1|  hypothetical protein CISIN_1g037455mg                   166   1e-43   
emb|CBI21415.3|  unnamed protein product                                166   1e-43   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             165   2e-43   
gb|KJB82990.1|  hypothetical protein B456_013G223900                    165   2e-43   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     165   2e-43   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             165   2e-43   
ref|XP_006487123.1|  PREDICTED: subtilisin-like protease-like           165   2e-43   
gb|ABR17987.1|  unknown                                                 165   2e-43   
dbj|BAJ89456.1|  predicted protein                                      165   3e-43   
ref|XP_003597117.1|  Subtilisin-like protease                           164   3e-43   
ref|XP_002282333.2|  PREDICTED: subtilisin-like protease                164   3e-43   
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             164   3e-43   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                164   3e-43   
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                164   3e-43   
ref|XP_006847082.1|  hypothetical protein AMTR_s00017p00214530          164   3e-43   
ref|XP_002441162.1|  hypothetical protein SORBIDRAFT_09g021490          164   3e-43   
emb|CDY57437.1|  BnaAnng14520D                                          164   3e-43   
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                164   3e-43   
gb|KCW63761.1|  hypothetical protein EUGRSUZ_G01423                     164   4e-43   
ref|XP_007156742.1|  hypothetical protein PHAVU_002G013500g             164   4e-43   
ref|XP_010105478.1|  Subtilisin-like protease                           164   4e-43   
ref|XP_006651839.1|  PREDICTED: subtilisin-like protease-like           164   4e-43   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative      164   4e-43   
emb|CAN68827.1|  hypothetical protein VITISV_029978                     164   4e-43   
ref|XP_008372210.1|  PREDICTED: subtilisin-like protease                164   5e-43   
ref|XP_007017192.1|  Subtilisin-like serine protease 2, putative        166   5e-43   
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g             164   5e-43   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     164   5e-43   
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg             166   5e-43   
gb|KDP41644.1|  hypothetical protein JCGZ_16051                         164   5e-43   
emb|CDY33251.1|  BnaC01g37240D                                          164   5e-43   
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                   164   6e-43   
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like           164   6e-43   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                164   7e-43   
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                164   7e-43   
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg             163   7e-43   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                163   8e-43   
ref|NP_001051353.1|  Os03g0761500                                       163   8e-43   
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             163   8e-43   
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease                163   8e-43   
ref|XP_010647741.1|  PREDICTED: subtilisin-like protease                163   9e-43   
ref|XP_006374838.1|  hypothetical protein POPTR_0014s01910g             163   9e-43   
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease                163   1e-42   
ref|XP_010923357.1|  PREDICTED: subtilisin-like protease                163   1e-42   
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease                163   1e-42   
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                163   1e-42   
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease                163   1e-42   
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like           163   1e-42   
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease                163   1e-42   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                163   1e-42   
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           162   1e-42   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    162   1e-42   
gb|KJB08038.1|  hypothetical protein B456_001G060600                    162   2e-42   
ref|XP_010090170.1|  Subtilisin-like protease                           162   2e-42   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    162   2e-42   
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                162   2e-42   
gb|KJB29423.1|  hypothetical protein B456_005G099900                    162   2e-42   
gb|EMT30759.1|  Subtilisin-like protease                                162   2e-42   
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         162   2e-42   
ref|XP_010927458.1|  PREDICTED: subtilisin-like protease                162   3e-42   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                162   3e-42   
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                162   3e-42   
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                162   3e-42   
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                162   3e-42   
ref|NP_001234282.1|  SBT1 protein precursor                             161   4e-42   
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease                162   4e-42   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                161   5e-42   
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             161   5e-42   
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like           161   5e-42   
dbj|BAJ96698.1|  predicted protein                                      161   6e-42   
ref|NP_001044922.1|  Os01g0868900                                       161   6e-42   
dbj|BAJ86110.1|  predicted protein                                      161   6e-42   
gb|KHG16003.1|  Subtilisin-like protease                                161   6e-42   
gb|AAM10321.1|  AT5g67360/K8K14_8                                       161   6e-42   
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                161   7e-42   
ref|NP_569048.1|  subtilisin-like protease                              160   7e-42   
ref|NP_567972.1|  subtilisin-like serine protease 2                     161   7e-42   
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                161   7e-42   
emb|CDO96926.1|  unnamed protein product                                161   7e-42   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                160   7e-42   
emb|CDY39093.1|  BnaA01g29630D                                          161   7e-42   
emb|CDY22001.1|  BnaC09g01070D                                          160   7e-42   
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease                160   8e-42   
emb|CDY18651.1|  BnaA09g07440D                                          160   8e-42   
dbj|BAJ88205.1|  predicted protein                                      161   8e-42   
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           160   9e-42   
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             160   9e-42   
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease                160   9e-42   
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease                160   9e-42   
emb|CDY52259.1|  BnaC05g52030D                                          160   1e-41   
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg             160   1e-41   
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           160   1e-41   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             160   1e-41   
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like           160   1e-41   
ref|XP_006651591.1|  PREDICTED: subtilisin-like protease-like           157   1e-41   
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease                160   1e-41   
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like           160   1e-41   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                160   1e-41   
emb|CDY63219.1|  BnaAnng18730D                                          160   1e-41   
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg             160   1e-41   
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                160   2e-41   
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease                160   2e-41   
ref|XP_002301156.2|  hypothetical protein POPTR_0002s12130g             160   2e-41   
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease                160   2e-41   
ref|XP_006841997.1|  hypothetical protein AMTR_s00144p00078130          159   2e-41   
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                159   2e-41   
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease                159   2e-41   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     159   2e-41   
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     159   2e-41   
gb|KJB58524.1|  hypothetical protein B456_009G213600                    159   3e-41   
ref|XP_010066012.1|  PREDICTED: subtilisin-like protease                159   3e-41   
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like           159   3e-41   
gb|KHN12975.1|  Subtilisin-like protease                                159   4e-41   
ref|NP_001151463.1|  LOC100285096 precursor                             159   4e-41   
tpg|DAA51518.1|  TPA: putative subtilase family protein                 159   4e-41   
emb|CDY40653.1|  BnaA03g53100D                                          159   4e-41   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           159   4e-41   
ref|NP_001050634.1|  Os03g0605300                                       159   4e-41   
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             159   4e-41   
gb|EYU40429.1|  hypothetical protein MIMGU_mgv1a001733mg                159   4e-41   
ref|XP_010103418.1|  Subtilisin-like protease                           159   4e-41   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    159   5e-41   
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease                159   5e-41   
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                159   5e-41   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like           158   6e-41   
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease                158   6e-41   
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg                158   6e-41   
ref|XP_003544482.1|  PREDICTED: subtilisin-like protease-like           158   6e-41   
emb|CAA59963.1|  subtilisin-like protease                               158   7e-41   
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      158   7e-41   
ref|XP_004499011.1|  PREDICTED: subtilisin-like protease-like           158   7e-41   
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease                158   8e-41   
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159             158   8e-41   
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                158   9e-41   
ref|XP_007012625.1|  Subtilase family protein                           157   9e-41   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           157   1e-40   
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          157   1e-40   
gb|KJB27211.1|  hypothetical protein B456_004G284900                    156   1e-40   
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      157   2e-40   
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease                157   2e-40   
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease                157   2e-40   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                157   2e-40   
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease                157   2e-40   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                157   2e-40   
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                157   2e-40   
gb|KJB27210.1|  hypothetical protein B456_004G284900                    156   3e-40   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             156   3e-40   
emb|CDY44380.1|  BnaA02g29970D                                          155   3e-40   
ref|XP_003516516.1|  PREDICTED: subtilisin-like protease-like           156   3e-40   
gb|KEH30495.1|  subtilisin-like serine protease                         156   3e-40   
gb|EPS65791.1|  hypothetical protein M569_08985                         156   3e-40   
ref|NP_001145972.1|  uncharacterized protein LOC100279499 precursor     156   3e-40   
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             156   4e-40   
gb|AFW81831.1|  putative subtilase family protein                       156   4e-40   
emb|CBI27801.3|  unnamed protein product                                155   4e-40   
ref|XP_011069783.1|  PREDICTED: subtilisin-like protease                156   4e-40   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease                156   4e-40   
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                156   4e-40   
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                156   4e-40   
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                155   4e-40   
ref|XP_006369129.1|  subtilase family protein                           155   5e-40   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                155   5e-40   
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                156   5e-40   
gb|EPS74243.1|  subtilase family protein                                155   6e-40   
ref|XP_003562295.2|  PREDICTED: subtilisin-like protease                155   6e-40   



>ref|XP_011069659.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=754

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 157/194 (81%), Gaps = 7/194 (4%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  267
            L   L F++ T  Q+ S    S+TYIVHMDL+ MP+AF+SH++W+S TLSS+SN      
Sbjct  7    LCLCLCFLAITVPQLMSTSTDSDTYIVHMDLTAMPKAFSSHRTWYSTTLSSVSNSNKATT  66

Query  268  ---LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  438
               LVYAYT AI+GFSAVLS +EL+AIK S GY+ S +D +VKVDT+ +  FLGL+SD+G
Sbjct  67   TSNLVYAYTTAINGFSAVLSSSELDAIKNSAGYVSSIRDTTVKVDTTQSYRFLGLNSDNG  126

Query  439  AWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIG  618
            AWPA+DYG+DVI+GV+DTGVWPES+SF DDGM EIPARW+GEC+SGTQF  S+CNKKLIG
Sbjct  127  AWPASDYGKDVIVGVVDTGVWPESRSFNDDGMTEIPARWRGECESGTQFNTSLCNKKLIG  186

Query  619  ARYFNKGLLAKNPN  660
            ARYFNKGLLAKNPN
Sbjct  187  ARYFNKGLLAKNPN  200



>ref|XP_009771086.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=772

 Score =   270 bits (691),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 161/210 (77%), Gaps = 15/210 (7%)
 Frame = +1

Query  61   FSILA*EMANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSA  240
            FS+L   MANH  L   L F    F+ I S+  +SETYI+HMD S MP+AF+SH +W+  
Sbjct  8    FSVLL-NMANHITLCIWLLFF---FISIISL-AKSETYIIHMDFSAMPKAFSSHHNWYLT  62

Query  241  TLSSISNRG----------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKV  390
            TLSS+S+            LVY+YTNAIHGFSA LSP+ELEAIK SPGY+ S KD SVK+
Sbjct  63   TLSSVSDSSTNYKDFLSSKLVYSYTNAIHGFSASLSPSELEAIKNSPGYVSSIKDISVKI  122

Query  391  DTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQ  570
            DT+HT  FLGL+S+ G WP ++YG+D+IIG++DTG+WPESKS+ DDG+ E+P+RWKGEC+
Sbjct  123  DTTHTSQFLGLNSESGVWPTSEYGKDIIIGLVDTGIWPESKSYSDDGISEVPSRWKGECE  182

Query  571  SGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            SGT+F  S+CNKKLIGARYFNKGLLA NPN
Sbjct  183  SGTEFNSSLCNKKLIGARYFNKGLLANNPN  212



>ref|XP_009790288.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 149/183 (81%), Gaps = 15/183 (8%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---------NRG------LVYAYTNA  291
             QSETYI+HMDLS MP+AF+SHQ+W+  TL+S+S         NR       LVYAYTNA
Sbjct  25   AQSETYIIHMDLSAMPKAFSSHQNWYLTTLASVSDSSNLGTASNRNSFSSTKLVYAYTNA  84

Query  292  IHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDV  471
            IHGFSA LSP+ELE +K SPGYL STKD +VK+DT+HT  FLGL+S+ GAWP +DYG+DV
Sbjct  85   IHGFSASLSPSELEVVKNSPGYLTSTKDMTVKIDTTHTSQFLGLNSNSGAWPKSDYGKDV  144

Query  472  IIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAK  651
            I+G++DTG+WPESKS+ D+GM E+P+RWKGEC+SGTQF  S+CNKKLIGARYFNKGL+A 
Sbjct  145  IVGLVDTGIWPESKSYNDNGMTEVPSRWKGECESGTQFNSSLCNKKLIGARYFNKGLIAN  204

Query  652  NPN  660
            NPN
Sbjct  205  NPN  207



>ref|XP_009800439.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 149/183 (81%), Gaps = 15/183 (8%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---------NRG------LVYAYTNA  291
             QSETYI+HMDLS MP+AF+SHQ+W+  TL+S+S         NR       LVYAYTNA
Sbjct  25   AQSETYIIHMDLSAMPKAFSSHQNWYLTTLASVSDSSNLGTASNRNSFSSTKLVYAYTNA  84

Query  292  IHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDV  471
            IHGFSA LSP+ELE +K SPGYL STKD +VK+DT+HT  FLGL+S+ GAWP +DYG+DV
Sbjct  85   IHGFSASLSPSELEVVKNSPGYLSSTKDMTVKIDTTHTSQFLGLNSNSGAWPKSDYGKDV  144

Query  472  IIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAK  651
            I+G++DTG+WPESKS+ D+GM E+P+RWKGEC+SGTQF  S+CNKKLIGARYFNKGL+A 
Sbjct  145  IVGLVDTGIWPESKSYNDNGMTEVPSRWKGECESGTQFNSSLCNKKLIGARYFNKGLIAN  204

Query  652  NPN  660
            NPN
Sbjct  205  NPN  207



>ref|XP_004252763.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 165/208 (79%), Gaps = 9/208 (4%)
 Frame = +1

Query  49   IPS*FSILA*EMANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQS  228
            IP+  S L   MAN+ AL+  L F++  F   FS+  + ETYI+HMDLS MP AF+SH S
Sbjct  16   IPTSISFLQKNMANYIALW--LCFLAILF--PFSM-SKLETYIIHMDLSAMPIAFSSHHS  70

Query  229  WFSATLSSIS---NRG-LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDT  396
            W+ +TL+SIS   N G LVYAYTNAIHGFSA LS +EL+ IK+  GYL STKD +VK+DT
Sbjct  71   WYLSTLASISDSSNHGSLVYAYTNAIHGFSARLSLSELQVIKRCQGYLSSTKDMTVKIDT  130

Query  397  SHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSG  576
            +HT  FLGLSS+ GAWP +DYGRDVIIG++DTGVWPESKS+ D+GM ++P+RWKGEC+SG
Sbjct  131  THTSQFLGLSSNSGAWPKSDYGRDVIIGLVDTGVWPESKSYNDNGMNDVPSRWKGECESG  190

Query  577  TQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            TQF  SMCNKKLIGARYFNKGL+A NPN
Sbjct  191  TQFNSSMCNKKLIGARYFNKGLIASNPN  218



>ref|XP_006342631.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=755

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 158/203 (78%), Gaps = 15/203 (7%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN  261
            MAN  AL   L F S  F    S   QSETYI+HMDLS MP+AF+SH SW+ +TL+S+S+
Sbjct  1    MANCVALC--LWFFSILFPITMS---QSETYIIHMDLSAMPKAFSSHHSWYLSTLASVSD  55

Query  262  ----------RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
                        LVYAYTNAIHGFSA+LSP+EL+ IK S GYL STKD +VK+DT+HT  
Sbjct  56   SSNLDYASNKNSLVYAYTNAIHGFSAILSPSELQVIKNSQGYLSSTKDMTVKIDTTHTSQ  115

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FLGL+S+ GAWP +DYGRDVIIG++DTGVWPESKS+ D+GM ++P+RWKGEC+SGTQF  
Sbjct  116  FLGLNSNSGAWPKSDYGRDVIIGLVDTGVWPESKSYNDNGMIDVPSRWKGECESGTQFNS  175

Query  592  SMCNKKLIGARYFNKGLLAKNPN  660
            S+CNKKLIGARYFNKGL+A NPN
Sbjct  176  SLCNKKLIGARYFNKGLIASNPN  198



>ref|XP_006342632.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 159/197 (81%), Gaps = 9/197 (5%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-  258
            MAN+ AL F   F++  F    S   +SETYI+HMDLS MP+AF+SH SW+ +TL+SIS 
Sbjct  1    MANYIALCF--CFLAILFPFTMS---KSETYIIHMDLSAMPKAFSSHHSWYLSTLASISD  55

Query  259  --NRG-LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
              N G LVYAYTNAIHGFSA L+P+EL+ IKKS GYL STKD +VK+DT+HT  FLGL+S
Sbjct  56   STNHGSLVYAYTNAIHGFSASLTPSELQVIKKSQGYLSSTKDMTVKIDTTHTSQFLGLNS  115

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
            + GAWP +DYGRDVIIG++DTGVWPESKS+ D+GM ++P+RWKGEC+SGTQF  S CNKK
Sbjct  116  NSGAWPKSDYGRDVIIGLVDTGVWPESKSYNDNGMTDVPSRWKGECESGTQFNSSSCNKK  175

Query  610  LIGARYFNKGLLAKNPN  660
            LIGAR FNKGL+A NPN
Sbjct  176  LIGARSFNKGLIASNPN  192



>ref|XP_010320328.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=751

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 154/199 (77%), Gaps = 14/199 (7%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN  261
            MAN+ AL   L       L I  +  +SETYI+HMDLS MP+AF+SH +W+  TL S+S+
Sbjct  1    MANYIALCIWL-------LSIIQL-AKSETYIIHMDLSAMPKAFSSHYNWYLTTLFSVSD  52

Query  262  RG------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                    LVY YTNAI+GFSA LSP+E+EAIK SPGY+ S KD SVKVDT+HT  FLGL
Sbjct  53   SKDLLSSKLVYTYTNAINGFSASLSPSEIEAIKNSPGYVSSIKDMSVKVDTTHTSQFLGL  112

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +S+ G WP +DYG+DVI+G++DTG+WPES+S+ DDGM E+P+RWKGEC+SGTQF  S+CN
Sbjct  113  NSESGVWPKSDYGKDVIVGLVDTGIWPESRSYSDDGMNEVPSRWKGECESGTQFNTSLCN  172

Query  604  KKLIGARYFNKGLLAKNPN  660
            KKLIGARYFNKGLLA NPN
Sbjct  173  KKLIGARYFNKGLLANNPN  191



>ref|XP_009604890.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=755

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 157/210 (75%), Gaps = 15/210 (7%)
 Frame = +1

Query  61   FSILA*EMANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSA  240
            F+IL   MA+H  L   L F    F+ I S+  + ETYI+HMDLS MP+AF SH +W+  
Sbjct  8    FNILL-NMASHITLCIWLLFF---FISIISL-AKPETYIIHMDLSAMPKAFASHHNWYLT  62

Query  241  TLSSISNRG----------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKV  390
            TL+S+S+            LVYAYTNAI+GFSA LSP+E EAIK SPGY+ S KD SVK+
Sbjct  63   TLASLSDSSTNHKEFLSSKLVYAYTNAINGFSASLSPSEFEAIKNSPGYVSSIKDMSVKI  122

Query  391  DTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQ  570
            DT+HT  FLGL+S+ G WP +DYG+D+IIG++DTG+WPESKS+ D G+ E+P+RWKGEC+
Sbjct  123  DTTHTSQFLGLNSESGVWPTSDYGKDIIIGLVDTGIWPESKSYSDYGISEVPSRWKGECE  182

Query  571  SGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            SG +F  S+CNKK+IGARYFNKGLLA NPN
Sbjct  183  SGIEFNSSLCNKKIIGARYFNKGLLANNPN  212



>ref|XP_010263512.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=767

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 151/197 (77%), Gaps = 15/197 (8%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR---------  264
            L FI+ T  ++ S   QS+ YI+HMD++ MP+AF+SH +W++ATLSS+SN          
Sbjct  15   LLFIT-TVSRLSSTLAQSDMYIIHMDMAAMPKAFSSHHTWYAATLSSVSNNSVANSNTDA  73

Query  265  -----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
                  LVY YTNAIHGFSA LSP+EL+++KK PGY+ ST+D  V V T+HTP FL L+ 
Sbjct  74   TIPTPNLVYTYTNAIHGFSARLSPSELDSLKKLPGYISSTRDIPVTVHTTHTPEFLDLNP  133

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
            ++GAWPA++YG+DVI+G++DTG+WPES+SF DDGM E+P+RWKGEC + TQF+ SMCNKK
Sbjct  134  NYGAWPASNYGQDVIVGLVDTGIWPESESFNDDGMSEVPSRWKGECVNATQFSSSMCNKK  193

Query  610  LIGARYFNKGLLAKNPN  660
            LIGAR+FNKGL  K PN
Sbjct  194  LIGARFFNKGLSGKYPN  210



>ref|XP_009595649.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=763

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 156/208 (75%), Gaps = 17/208 (8%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-  258
            MAN   L+F    I  T L  F I  QSETYI+HMDLS MP AF+SHQ+W+  TL+S+S 
Sbjct  1    MANCITLYFLFLAILLT-LNPF-IMAQSETYIIHMDLSAMPTAFSSHQNWYLTTLASVSD  58

Query  259  --------NRG------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDT  396
                    NR       +VYAYTNAIHGFSA LS +ELE IK SPGYL STKD +VK DT
Sbjct  59   SSSLGTASNRNSLSSSKIVYAYTNAIHGFSASLSSSELEVIKNSPGYLSSTKDMTVKSDT  118

Query  397  SHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSG  576
            +HT  FLGL+S+ G WP +DYG+DVI+G++DTG+WPESKS+ D+GM E+P+RWKGEC+SG
Sbjct  119  THTSQFLGLNSNSGVWPKSDYGKDVIVGLVDTGIWPESKSYTDNGMTEVPSRWKGECESG  178

Query  577  TQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            TQF  S+CNKKLIGARYFNKGL+A NPN
Sbjct  179  TQFNSSLCNKKLIGARYFNKGLIATNPN  206



>gb|ACT34764.1| subtilisin-like protease preproenzyme [Nicotiana tabacum]
Length=763

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 156/208 (75%), Gaps = 17/208 (8%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-  258
            MAN   L+F    I  T L  F I  QSETY++HMDLS MP AF+SHQ+W+  TL+S+S 
Sbjct  1    MANCITLYFLFLAILLT-LNPF-IMAQSETYVIHMDLSAMPTAFSSHQNWYLTTLASVSD  58

Query  259  --------NRG------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDT  396
                    NR       +VYAYTNAIHGFSA LS +ELE IK SPGYL STKD +VK DT
Sbjct  59   SSSLGTASNRNSLSSSKIVYAYTNAIHGFSASLSSSELEVIKNSPGYLSSTKDMTVKSDT  118

Query  397  SHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSG  576
            +HT  FLGL+S+ G WP +DYG+DVI+G++DTG+WPESKS+ D+GM E+P+RWKGEC+SG
Sbjct  119  THTSQFLGLNSNSGVWPKSDYGKDVIVGLVDTGIWPESKSYTDNGMTEVPSRWKGECESG  178

Query  577  TQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            TQF  S+CNKKLIGARYFNKGL+A NPN
Sbjct  179  TQFNSSLCNKKLIGARYFNKGLIATNPN  206



>ref|XP_002282841.2| PREDICTED: uncharacterized protein LOC100259061 [Vitis vinifera]
Length=1529

 Score =   250 bits (639),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 145/188 (77%), Gaps = 14/188 (7%)
 Frame = +1

Query  139  QIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--------------GLVY  276
             + S   QS+TYIVHMDLS MP+AF+ H SW+ ATL+S+S+                L+Y
Sbjct  785  HLVSTLAQSDTYIVHMDLSAMPKAFSGHHSWYMATLASVSDNTAATANPYSSSYSSKLIY  844

Query  277  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATD  456
            +YTN IHGFSA+LSP+ELEA+K  PGY+ S  D  VK DT+H+  FLGL+S+ GAWP ++
Sbjct  845  SYTNVIHGFSAILSPSELEALKSFPGYISSFPDLPVKADTTHSAKFLGLNSNSGAWPMSN  904

Query  457  YGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNK  636
            YG+DVIIG++DTG+WPES+SF DDGM EIP+RWKG C+SGTQF  SMCNKKLIGAR+FNK
Sbjct  905  YGKDVIIGLVDTGIWPESESFNDDGMTEIPSRWKGACESGTQFNSSMCNKKLIGARFFNK  964

Query  637  GLLAKNPN  660
            GL+AK+PN
Sbjct  965  GLIAKHPN  972


 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 129/185 (70%), Gaps = 12/185 (6%)
 Frame = +1

Query  139  QIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SNRGLVYAY  282
            Q  S+ G+  TYI+HMD S MP+ F +H  W+S+ L +I            S   L+Y Y
Sbjct  26   QARSMSGERSTYIIHMDKSVMPKVFATHHHWYSSILHAIKTDTPTTSAGLQSTARLIYTY  85

Query  283  TNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYG  462
             +A+HGFSA+LS  ELE++++SPG++ + +D +V +DT+HT  FL L+   G WPA+DYG
Sbjct  86   DHALHGFSALLSSQELESLRESPGFVSAYRDRAVTLDTTHTFEFLKLNPVTGLWPASDYG  145

Query  463  RDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGL  642
             DVI+GVID+GVWPES SF DDGM +IPARWKG C+ G  F  SMCN+KLIGAR F KGL
Sbjct  146  EDVIVGVIDSGVWPESPSFKDDGMTQIPARWKGTCEEGEDFNSSMCNRKLIGARSFIKGL  205

Query  643  LAKNP  657
            +A NP
Sbjct  206  IAANP  210



>ref|XP_010112177.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32843.1| Subtilisin-like protease [Morus notabilis]
Length=767

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 154/208 (74%), Gaps = 16/208 (8%)
 Frame = +1

Query  82   MANHRALF----FHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLS  249
            MA+H A      +HL F+S   L    +  Q+E YI+HMDLS MP+AF +H SW+SATL+
Sbjct  1    MASHHARTPLHNYHLYFLSFLALSRL-VSAQTENYIIHMDLSTMPKAFANHHSWYSATLA  59

Query  250  SIS-----------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDT  396
            ++S           +  L+Y+YT+ I+GFSA L+P+ELEA+K SPGY+ S +D  VKVDT
Sbjct  60   TLSKTVPKTISLDLSSKLIYSYTHVINGFSASLTPSELEAVKGSPGYISSMRDLPVKVDT  119

Query  397  SHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSG  576
            +H+  FLGL+S+ GAW  ++YG +VIIG++DTGVWPES SF DDGM EIP+RWKGEC++G
Sbjct  120  THSFKFLGLNSNSGAWRESNYGENVIIGLVDTGVWPESASFNDDGMSEIPSRWKGECETG  179

Query  577  TQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            TQF  S+CNKKLIGAR FNKGLLAK PN
Sbjct  180  TQFNSSLCNKKLIGARIFNKGLLAKYPN  207



>ref|XP_009359804.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=765

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 149/206 (72%), Gaps = 16/206 (8%)
 Frame = +1

Query  91   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--  264
            H +L+F L+  + + L I S   QS+ YI+HMD S MP+AF+ H SW+ ATL S   +  
Sbjct  6    HVSLYFWLSIATISHLAIVSTFAQSQNYIIHMDSSVMPKAFSDHHSWYLATLDSALGKFT  65

Query  265  --------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSH  402
                           L+Y+YT+A++GFSA L+ +ELEA+K SPGY+ S KD  VK DT+H
Sbjct  66   PSTTATSSSSALSSKLIYSYTHAMNGFSASLTASELEALKSSPGYISSVKDLPVKKDTTH  125

Query  403  TPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQ  582
            T  FLGL+S  GAWP  +YG+DVIIG++DTGVWPES+SF +DGM +IP RWKGEC+SGTQ
Sbjct  126  TSQFLGLNSKSGAWPVANYGKDVIIGLVDTGVWPESESFNEDGMSKIPPRWKGECESGTQ  185

Query  583  FTPSMCNKKLIGARYFNKGLLAKNPN  660
            F  S+CNKKLIGA++FNKGL+A+NPN
Sbjct  186  FNSSLCNKKLIGAKFFNKGLVAQNPN  211



>gb|KCW62487.1| hypothetical protein EUGRSUZ_H05125 [Eucalyptus grandis]
Length=768

 Score =   241 bits (615),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 148/207 (71%), Gaps = 19/207 (9%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIF---SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI----  255
            A+  H + ++   L +F   S  GQS+ YI+HMDLS MP+AF+ H SWF AT+SS+    
Sbjct  2    AVRVHSSLMTLLILTMFCFASTMGQSDNYIIHMDLSSMPKAFSDHHSWFLATVSSLVQSP  61

Query  256  ------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTS  399
                        ++  L+Y+YT  + GFSA LSP+ELEA+K SPGY+ S KD   KVDT+
Sbjct  62   NPKVRAKATITPTSSKLIYSYTYVMQGFSASLSPSELEALKNSPGYISSMKDLPGKVDTT  121

Query  400  HTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGT  579
            H+  FLGL+S+ GAWP +DYG+DVI+G++DTGVWPES SF DDGM  IP++WKGEC+ G 
Sbjct  122  HSTQFLGLNSNSGAWPTSDYGKDVIVGLVDTGVWPESPSFNDDGMTTIPSKWKGECEVGI  181

Query  580  QFTPSMCNKKLIGARYFNKGLLAKNPN  660
            QF  SMCNKKLIGAR+FNK L+AKNPN
Sbjct  182  QFNASMCNKKLIGARFFNKALVAKNPN  208



>ref|XP_010059918.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66394.1| hypothetical protein EUGRSUZ_F00208 [Eucalyptus grandis]
Length=768

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 145/207 (70%), Gaps = 19/207 (9%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSID---GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---  258
            A+F H        L IF       Q + YI+HMDLSFMP+AF+ H SW+ AT+SS++   
Sbjct  2    AVFVHSLMTGLLTLIIFCFVLTLEQPDNYIIHMDLSFMPKAFSDHHSWYLATVSSLTQSP  61

Query  259  -------------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTS  399
                         +  L+Y+YT+ I GFSA LSP+ELEA+K  PGY+ S KD  VKVDT+
Sbjct  62   NPKVRARADATPTSSRLIYSYTHVIRGFSASLSPSELEALKNYPGYISSMKDLPVKVDTT  121

Query  400  HTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGT  579
            H+  FLGL+S+ GAWP +DYG+DVI+G++DTGVWPES SF D GM  IP++WKGEC+ GT
Sbjct  122  HSTQFLGLNSNSGAWPISDYGKDVIVGLVDTGVWPESPSFNDGGMTTIPSKWKGECEVGT  181

Query  580  QFTPSMCNKKLIGARYFNKGLLAKNPN  660
            QF  SMCNKKLIGARYFNK L+AKNPN
Sbjct  182  QFNSSMCNKKLIGARYFNKALMAKNPN  208



>ref|XP_002267740.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=762

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 139/175 (79%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  SETYIVHMDLSFMPRAFTSHQSWFSATLSSISN---------RGLVYAYTNAIHGFSAVL  315
            ++TYIVHMD S MP+ F+SH +WFSA +S+IS+           L+Y+YT++IHGFSA+L
Sbjct  29   ADTYIVHMDSSAMPKPFSSHHTWFSAIVSAISDDSAPPPTTTNKLIYSYTSSIHGFSAIL  88

Query  316  SPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTG  495
            +P+ELE++K +PGYL ST D  +K+ T+HTP FLGLS DHGAWPA+ YG  VIIGV+DTG
Sbjct  89   TPSELESLKNTPGYLSSTPDFPLKLHTTHTPQFLGLSYDHGAWPASSYGDGVIIGVVDTG  148

Query  496  VWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            VWPES+S  D+GM E+PARWKGEC++GTQF  S+CNKKLIGAR+FNKG  A  PN
Sbjct  149  VWPESESLKDNGMSEVPARWKGECETGTQFNSSLCNKKLIGARFFNKGFTANKPN  203



>ref|XP_008393790.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=766

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 148/207 (71%), Gaps = 16/207 (8%)
 Frame = +1

Query  88   NHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-  264
            +H +L+F L+  + + L I S   QS+ YI+HMD S MP+AF  H SW+ ATL S   + 
Sbjct  5    DHVSLYFWLSIATISHLAIVSTFAQSQNYIIHMDSSVMPKAFXDHHSWYLATLDSTLGKF  64

Query  265  ---------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTS  399
                            L+Y+YT+A++GFSA L+ +ELEA+K SPGY+ S KD  VK DT+
Sbjct  65   XPXTTATSSSSXLSSXLIYSYTHAMNGFSASLTASELEALKSSPGYISSVKDLPVKKDTT  124

Query  400  HTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGT  579
            HT  FLGL+S  G WP  +YG+DVIIG++DTGVWPES+SF +DGM EIP RWKGEC+SGT
Sbjct  125  HTSQFLGLNSKSGVWPVANYGKDVIIGLVDTGVWPESESFNEDGMSEIPPRWKGECESGT  184

Query  580  QFTPSMCNKKLIGARYFNKGLLAKNPN  660
            QF  S+CNKKLIGA++FNKGL+A+NPN
Sbjct  185  QFNSSLCNKKLIGAKFFNKGLVAQNPN  211



>gb|KCW66398.1| hypothetical protein EUGRSUZ_F00212 [Eucalyptus grandis]
Length=728

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 146/209 (70%), Gaps = 24/209 (11%)
 Frame = +1

Query  97   ALFFH------LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  255
            A+F H      LA I   F+       QS+ YI+HMD SFMP+AF+ H SW+ AT+SS+ 
Sbjct  2    AVFVHSFVTGVLALIILCFVPTLE---QSDNYIIHMDSSFMPKAFSDHHSWYLATVSSLA  58

Query  256  --------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  393
                          S   L+Y+YT+ I GFSA LSP+ELEA+KK PGY+ S KD  VK D
Sbjct  59   QSRSPNVRARASAASTSRLIYSYTHVIQGFSASLSPSELEALKKRPGYVSSLKDLPVKAD  118

Query  394  TSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQS  573
            T+H+  FLGL+S+ GAWP +DYG+D+IIG++DTGVWPES SF DDGM  IP++WKGEC+ 
Sbjct  119  TTHSTQFLGLNSNAGAWPTSDYGKDIIIGLVDTGVWPESPSFNDDGMTAIPSKWKGECEV  178

Query  574  GTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            GTQF  SMCN+KLIGAR+FNK L+AK PN
Sbjct  179  GTQFNASMCNRKLIGARFFNKALIAKYPN  207



>ref|XP_010059917.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66393.1| hypothetical protein EUGRSUZ_F00207 [Eucalyptus grandis]
Length=768

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 147/203 (72%), Gaps = 19/203 (9%)
 Frame = +1

Query  109  HLAFISATFLQIF---SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  255
            H + ++   L +F   S  GQS+ YI+HMDLS MP+AF+ H SWF AT+SS+        
Sbjct  6    HSSLMTLLILTMFCFASTMGQSDNYIIHMDLSSMPKAFSDHHSWFLATVSSLVQSPNPKV  65

Query  256  --------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
                    ++  L+Y+YT+ + GFSA LSP+EL+A+K SPGY+ S KD   KVDT+H+  
Sbjct  66   RAKATTTPTSSKLIYSYTHVMQGFSASLSPSELKALKNSPGYISSMKDLPGKVDTTHSTQ  125

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FLGL+S+ GAWP +DYG+DVI+G++DTGVWPES SF DDGM  IP++WKGEC+ GTQF  
Sbjct  126  FLGLNSNSGAWPTSDYGKDVIVGLVDTGVWPESPSFNDDGMTTIPSKWKGECEVGTQFNA  185

Query  592  SMCNKKLIGARYFNKGLLAKNPN  660
            SMCNKKLIGAR+FNK L+ KNPN
Sbjct  186  SMCNKKLIGARFFNKALVTKNPN  208



>ref|XP_010059919.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=766

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 146/209 (70%), Gaps = 24/209 (11%)
 Frame = +1

Query  97   ALFFH------LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  255
            A+F H      LA I   F+       QS+ YI+HMD SFMP+AF+ H SW+ AT+SS+ 
Sbjct  2    AVFVHSFVTGVLALIILCFVPTLE---QSDNYIIHMDSSFMPKAFSDHHSWYLATVSSLA  58

Query  256  --------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  393
                          S   L+Y+YT+ I GFSA LSP+ELEA+KK PGY+ S KD  VK D
Sbjct  59   QSRSPNVRARASAASTSRLIYSYTHVIQGFSASLSPSELEALKKRPGYVSSLKDLPVKAD  118

Query  394  TSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQS  573
            T+H+  FLGL+S+ GAWP +DYG+D+IIG++DTGVWPES SF DDGM  IP++WKGEC+ 
Sbjct  119  TTHSTQFLGLNSNAGAWPTSDYGKDIIIGLVDTGVWPESPSFNDDGMTAIPSKWKGECEV  178

Query  574  GTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            GTQF  SMCN+KLIGAR+FNK L+AK PN
Sbjct  179  GTQFNASMCNRKLIGARFFNKALIAKYPN  207



>ref|XP_008351993.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=764

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 147/205 (72%), Gaps = 15/205 (7%)
 Frame = +1

Query  91   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--  264
            H +L+F L+  + + L I S   QS+ YI+HMD S MP+AF+ H SW+ ATL S   +  
Sbjct  6    HVSLYFWLSIATISHLAIVSTFAQSQNYIIHMDSSVMPKAFSDHHSWYLATLDSTLGKFS  65

Query  265  -------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHT  405
                          L+Y+YT+A++GFSA L+ +ELEA+K SPGY+ S KD  VK DT+HT
Sbjct  66   PNTTATSSSALSSKLIYSYTHAMNGFSASLTASELEALKSSPGYISSVKDLPVKKDTTHT  125

Query  406  PGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQF  585
              FLGL+S  GAWP  +YG+DVIIG++DTGVWPES SF +DGM EIP RWKGEC+SGTQF
Sbjct  126  SQFLGLNSKSGAWPVANYGKDVIIGLVDTGVWPESGSFNEDGMSEIPPRWKGECESGTQF  185

Query  586  TPSMCNKKLIGARYFNKGLLAKNPN  660
              S+CNKKLIGA++FNKGL+A+ PN
Sbjct  186  NSSLCNKKLIGAKFFNKGLVAQIPN  210



>gb|EYU45081.1| hypothetical protein MIMGU_mgv1a002217mg [Erythranthe guttata]
Length=700

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 147/193 (76%), Gaps = 9/193 (5%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  267
            +F    F+S    Q  SI    ETYIVHMD+S MP+ FTSH SW++++L+++++      
Sbjct  8    VFLCFFFLSVASQQ--SISKAYETYIVHMDVSLMPKPFTSHHSWYTSSLATVADSSSPPS  65

Query  268  ---LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  438
               L+Y Y+NAI+GFSA+LS AELEA+K  PGYL STKD  VK+DT+H+  FLGL+ DHG
Sbjct  66   SSRLLYTYSNAINGFSAILSSAELEAVKTLPGYLSSTKDKPVKLDTTHSYRFLGLNHDHG  125

Query  439  AWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIG  618
            AWPA++YG +VIIG++DTG+WPESKSF DDG+GEIP+RW+G C+S + F  S+CN+KLIG
Sbjct  126  AWPASNYGDNVIIGLVDTGIWPESKSFKDDGIGEIPSRWRGVCESCSDFNSSLCNRKLIG  185

Query  619  ARYFNKGLLAKNP  657
            AR F KG+LAK P
Sbjct  186  ARSFGKGMLAKKP  198



>gb|KCW66392.1| hypothetical protein EUGRSUZ_F00206 [Eucalyptus grandis]
Length=756

 Score =   239 bits (609),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 144/203 (71%), Gaps = 19/203 (9%)
 Frame = +1

Query  109  HLAFISATFLQIF---SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  264
            H + ++   L +F   S  GQS+ YI+HMDLS MP+AF+ H SWF AT+SS+        
Sbjct  6    HSSLMTLLILTMFCFASTTGQSDNYIIHMDLSSMPKAFSDHHSWFLATVSSLVQSPNPKV  65

Query  265  -----------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
                        L+Y+YT+ + GFSA LSP ELEA+K SPGY+ S KD   KVDT+H+  
Sbjct  66   RAKTTATPTFAKLIYSYTHVMQGFSASLSPLELEALKNSPGYISSMKDLPGKVDTTHSTQ  125

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FLGL+S+ GAWP +DYG+DVI+G++DTGVWPES SF D GM  IP++WKGEC+ GTQF  
Sbjct  126  FLGLNSNSGAWPTSDYGKDVIVGLVDTGVWPESPSFSDGGMTTIPSKWKGECEVGTQFNA  185

Query  592  SMCNKKLIGARYFNKGLLAKNPN  660
            SMCNKKLIGAR+FNK L+AKNPN
Sbjct  186  SMCNKKLIGARFFNKALVAKNPN  208



>ref|XP_010025755.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=759

 Score =   239 bits (609),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 142/199 (71%), Gaps = 16/199 (8%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------  255
            +  +  T     S  GQS+ YI+HMDLS MP+AF+ H SWF AT+SS+            
Sbjct  1    MTLLILTMFCFASTMGQSDNYIIHMDLSSMPKAFSDHHSWFLATVSSLVQSPNPKVRAKA  60

Query  256  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                ++  L+Y+YT  + GFSA LSP+ELEA+K SPGY+ S KD   KVDT+H+  FLGL
Sbjct  61   TITPTSSKLIYSYTYVMQGFSASLSPSELEALKNSPGYISSMKDLPGKVDTTHSTQFLGL  120

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +S+ GAWP +DYG+DVI+G++DTGVWPES SF DDGM  IP++WKGEC+ G QF  SMCN
Sbjct  121  NSNSGAWPTSDYGKDVIVGLVDTGVWPESPSFNDDGMTTIPSKWKGECEVGIQFNASMCN  180

Query  604  KKLIGARYFNKGLLAKNPN  660
            KKLIGAR+FNK L+AKNPN
Sbjct  181  KKLIGARFFNKALVAKNPN  199



>ref|XP_010059916.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=768

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 144/203 (71%), Gaps = 19/203 (9%)
 Frame = +1

Query  109  HLAFISATFLQIF---SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  264
            H + ++   L +F   S  GQS+ YI+HMDLS MP+AF+ H SWF AT+SS+        
Sbjct  6    HSSLMTLLILTMFCFASTTGQSDNYIIHMDLSSMPKAFSDHHSWFLATVSSLVQSPNPKV  65

Query  265  -----------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
                        L+Y+YT+ + GFSA LSP ELEA+K SPGY+ S KD   KVDT+H+  
Sbjct  66   RAKTTATPTFAKLIYSYTHVMQGFSASLSPLELEALKNSPGYISSMKDLPGKVDTTHSTQ  125

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FLGL+S+ GAWP +DYG+DVI+G++DTGVWPES SF D GM  IP++WKGEC+ GTQF  
Sbjct  126  FLGLNSNSGAWPTSDYGKDVIVGLVDTGVWPESPSFSDGGMTTIPSKWKGECEVGTQFNA  185

Query  592  SMCNKKLIGARYFNKGLLAKNPN  660
            SMCNKKLIGAR+FNK L+AKNPN
Sbjct  186  SMCNKKLIGARFFNKALVAKNPN  208



>ref|XP_002310134.2| subtilase family protein [Populus trichocarpa]
 gb|EEE90584.2| subtilase family protein [Populus trichocarpa]
Length=757

 Score =   238 bits (608),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 146/196 (74%), Gaps = 16/196 (8%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL--  270
            +L F ++ +++T         QS+TYI+HMD S MP+AFT H +W+ AT+SS+S+     
Sbjct  11   SLVFTISLLASTL-------AQSDTYIIHMDRSAMPKAFTDHHNWYLATISSVSDTAKST  63

Query  271  -------VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
                   +Y YT+++ GFSA L+ +ELEA+KKSPGY+ ST+D  +KV T+HT  FLGLSS
Sbjct  64   FTRTSKHIYTYTSSVQGFSASLTKSELEALKKSPGYISSTRDRKIKVHTTHTSEFLGLSS  123

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
              GAWP  +YG D+IIG++DTG+WPES+SF D+GM E+P+RWKG+C+ GTQF  SMCNKK
Sbjct  124  SSGAWPTANYGEDMIIGLVDTGIWPESESFSDEGMTEVPSRWKGKCEPGTQFNSSMCNKK  183

Query  610  LIGARYFNKGLLAKNP  657
            LIGARY+NKGLLA +P
Sbjct  184  LIGARYYNKGLLANDP  199



>ref|XP_008220243.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 142/206 (69%), Gaps = 23/206 (11%)
 Frame = +1

Query  91   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--  264
            H   +  +A IS T         Q   YI+HMD + MP+AF  H SW+ AT++S  ++  
Sbjct  8    HLCFWLAVAIISTTL-------AQPNNYIIHMDATMMPKAFADHHSWYLATVNSALSKFR  60

Query  265  --------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSH  402
                           L+Y+YT+ I+GFSA LS +ELEAIK SPGY+ S KD  VK DT+H
Sbjct  61   PNTTTTSSSSALSSKLIYSYTHVINGFSASLSLSELEAIKTSPGYISSVKDLPVKPDTTH  120

Query  403  TPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQ  582
            +  FLGLSS  GAWP  DYG+DVIIGV+DTGVWPES+SF DDGM EIP RWKGEC+SGTQ
Sbjct  121  SFQFLGLSSKSGAWPVADYGKDVIIGVVDTGVWPESESFSDDGMSEIPPRWKGECESGTQ  180

Query  583  FTPSMCNKKLIGARYFNKGLLAKNPN  660
            F  S+CNKKLIGAR+FNKGL+A+NPN
Sbjct  181  FNSSLCNKKLIGARFFNKGLIAQNPN  206



>ref|XP_010263511.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 140/196 (71%), Gaps = 12/196 (6%)
 Frame = +1

Query  109  HLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN---------  261
            H   +  TF  + SI  QS  YIVHMDLS MP  F+SH SW+ A LSS+S          
Sbjct  6    HHLLLFITFSCLSSILAQSNVYIVHMDLSAMPETFSSHDSWYMAMLSSVSEATYAVASTT  65

Query  262  ---RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSD  432
                 L+Y Y+NAIHGF+A LSP+EL+ +K SPGY+ ST+D  +  DT+HT  FLGL+SD
Sbjct  66   SKASKLIYTYSNAIHGFAAALSPSELDLLKSSPGYVSSTQDVPLAADTTHTSEFLGLNSD  125

Query  433  HGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKL  612
            +GAWPA++YG DVIIG++DTG+WPES +F DDGM ++P RWKGEC +GT F  SMCN+KL
Sbjct  126  YGAWPASNYGADVIIGLVDTGIWPESATFRDDGMTQVPKRWKGECMNGTDFNSSMCNRKL  185

Query  613  IGARYFNKGLLAKNPN  660
            IGAR+FNKGL A  P+
Sbjct  186  IGARFFNKGLAANTPS  201



>gb|EYU25437.1| hypothetical protein MIMGU_mgv1a002005mg [Erythranthe guttata]
Length=728

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 12/171 (7%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHGFSAVLSPAE  327
            MDLS MP++F++H SW+  TLSSIS++             L+Y YTNAI GF+A+LSP+E
Sbjct  1    MDLSLMPKSFSTHHSWYLNTLSSISDQVSTTDYSSSSSNKLIYTYTNAISGFTALLSPSE  60

Query  328  LEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPE  507
             EAIK SPGY+ STKD +VK DT+H+  FLGL+  +G WP +DYG DVIIG++DTGVWPE
Sbjct  61   FEAIKNSPGYISSTKDKTVKTDTTHSYKFLGLNPQNGLWPVSDYGNDVIIGLVDTGVWPE  120

Query  508  SKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            S+SF D GM  +PARWKGEC+ GTQF PSMCNKKLIGARYFNKGL+AK PN
Sbjct  121  SRSFDDGGMAVVPARWKGECERGTQFDPSMCNKKLIGARYFNKGLMAKYPN  171



>ref|XP_011043530.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=757

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 146/196 (74%), Gaps = 16/196 (8%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----  261
            +L F ++ +++T         +S+TYI+HMD S MP+AFT H +W+ AT+SSIS+     
Sbjct  11   SLVFTISLLASTL-------AKSDTYIIHMDRSAMPKAFTDHHNWYLATISSISDTVKST  63

Query  262  ----RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
                   +Y YT+++ GFSA L+ +ELEA+KKSPGY+ ST+D  +KV T+HT  FLGLSS
Sbjct  64   FTRSSKHIYTYTSSVQGFSASLTKSELEALKKSPGYISSTRDRKIKVHTTHTSEFLGLSS  123

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
              GAWP  +YG D+IIG++DTG+WPES+SF D+GM E+P+RWKG+C+ GTQF  SMCNKK
Sbjct  124  SSGAWPTANYGEDMIIGLVDTGIWPESESFSDEGMTEVPSRWKGKCEPGTQFNSSMCNKK  183

Query  610  LIGARYFNKGLLAKNP  657
            LIGARY+NKGLLA +P
Sbjct  184  LIGARYYNKGLLANDP  199



>ref|XP_009610212.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=756

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 140/178 (79%), Gaps = 12/178 (7%)
 Frame = +1

Query  163  SETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SNRGLVYAYTNAIHGFS  306
            S++YI+HMD S MP+AF+S  SW+ ATL+S+            S+  L+Y+YTNAIHGFS
Sbjct  26   SDSYIIHMDASAMPKAFSSPHSWYLATLASVLDSSSVGSRNTLSSSKLIYSYTNAIHGFS  85

Query  307  AVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVI  486
            A LSP+E EAIK SPGY+ ST+D +VK+ T+H+  FLGL+S  G+WP ++YG+ VIIGV+
Sbjct  86   ASLSPSEHEAIKNSPGYVSSTEDMTVKIHTTHSSHFLGLNSMSGSWPKSNYGKGVIIGVV  145

Query  487  DTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            DTGVWPESKSF DDGM ++P+RWKG CQ+GTQF  S+CNKKLIGARYFNKGLLAK  N
Sbjct  146  DTGVWPESKSFDDDGMTQVPSRWKGLCQTGTQFNSSLCNKKLIGARYFNKGLLAKVKN  203



>ref|XP_008221259.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 145/211 (69%), Gaps = 25/211 (12%)
 Frame = +1

Query  82   MANHRALFFHLAF--ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI  255
            + +H  L F LA   IS T         Q   YI+HMD + MP+AF  H SW+ AT++S 
Sbjct  3    IGHHVRLCFGLAIAIISTTL-------AQPNNYIIHMDATMMPKAFADHHSWYLATVNSA  55

Query  256  SNR----------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  387
             ++                 L+Y+YT+ I+GFSA LS +ELEA+K SPGY+ S KD  VK
Sbjct  56   LSKFRPNTTTTSSSSALSSKLIYSYTHVINGFSASLSLSELEALKTSPGYISSVKDLPVK  115

Query  388  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGEC  567
             DT+H+  FLGLSS  GAWP  DYG+DVIIGV+D+GVWPES+SF DDGM EIP RWKGEC
Sbjct  116  PDTTHSSQFLGLSSKSGAWPVADYGKDVIIGVVDSGVWPESESFSDDGMSEIPPRWKGEC  175

Query  568  QSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +SGTQF  S+CNKKLIGAR+FNKGL+A+NPN
Sbjct  176  ESGTQFNSSLCNKKLIGARFFNKGLIAQNPN  206



>ref|XP_007221958.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
 gb|EMJ23157.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
Length=767

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 145/211 (69%), Gaps = 25/211 (12%)
 Frame = +1

Query  82   MANHRALFFHLAF--ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI  255
            + +H  L F LA   IS T         Q   YI+HMD + MP+AF  H SW+ AT++S 
Sbjct  3    IGHHVRLCFWLAIAIISTTL-------AQPNNYIIHMDSTMMPKAFADHHSWYLATVNSA  55

Query  256  SNR----------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  387
             ++                 L+Y+YT+ I+GFSA LS +ELEA+K SPGY+ S KD  VK
Sbjct  56   LSKFRPNTTTTTSSSALSSKLIYSYTHVINGFSASLSLSELEALKTSPGYISSVKDLPVK  115

Query  388  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGEC  567
             DT+H+  FLGLSS  GAWP  DYG+DVIIG++DTGVWPES+SF DDGM EIP RWKGEC
Sbjct  116  PDTTHSSQFLGLSSKSGAWPVADYGKDVIIGLVDTGVWPESESFSDDGMSEIPPRWKGEC  175

Query  568  QSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +SGTQF  S+CNKKLIGAR+FNKGL+A+NPN
Sbjct  176  ESGTQFNSSLCNKKLIGARFFNKGLIAQNPN  206



>ref|XP_008220244.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 143/211 (68%), Gaps = 25/211 (12%)
 Frame = +1

Query  82   MANHRALFFHL--AFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI  255
            + +H  L F L  A IS T         Q   YI+HMD + MP+AF  H SW+ AT+ S 
Sbjct  3    IGHHGRLCFWLSIAIISTTL-------AQPNNYIIHMDSTMMPKAFADHHSWYLATVISA  55

Query  256  SNR----------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  387
             ++                 L+Y+YT+ I GFSA LS +ELEA+K SPGY+ S KD  VK
Sbjct  56   LSKFRPNTTTTSSSSALSSKLIYSYTHVITGFSASLSLSELEALKTSPGYISSVKDLPVK  115

Query  388  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGEC  567
             DT+H+  FLGLSS  GAWP  DYG+DVIIGV+DTGVWPES+SF DDGM EIP RWKGEC
Sbjct  116  PDTTHSSQFLGLSSKSGAWPVADYGKDVIIGVVDTGVWPESESFSDDGMSEIPPRWKGEC  175

Query  568  QSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +SGTQF  S+CNKKLIGAR+FNKGL+A+NPN
Sbjct  176  ESGTQFNSSLCNKKLIGARFFNKGLIAQNPN  206



>gb|KJB63881.1| hypothetical protein B456_010G021600 [Gossypium raimondii]
Length=764

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 144/198 (73%), Gaps = 12/198 (6%)
 Frame = +1

Query  103  FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----  267
             +   ++S   L +F    +S+ YIVHMD+S MP+AF++  +W+ ATLSS+S +      
Sbjct  9    LYVYCWVSFCVLFMFIKLAKSDNYIVHMDISAMPKAFSNQHTWYLATLSSVSAKSKAETN  68

Query  268  -------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  426
                   L+Y Y + I GFSA L+PAELE++K SPGY+ S KD  VKVDT+H+  FL L+
Sbjct  69   PTTPFSKLIYTYNHVIQGFSASLTPAELESLKNSPGYVSSVKDRVVKVDTTHSFEFLDLN  128

Query  427  SDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNK  606
            S  GAWP + +G+DVI+GVIDTGVWPES+SF DDGM ++P+RWKGEC+SGTQF  S+CNK
Sbjct  129  SGTGAWPVSSFGKDVIVGVIDTGVWPESESFNDDGMSDVPSRWKGECESGTQFNSSLCNK  188

Query  607  KLIGARYFNKGLLAKNPN  660
            KLIGAR+FNKGL+A N N
Sbjct  189  KLIGARFFNKGLIAHNSN  206



>ref|XP_002523606.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38801.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   233 bits (594),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 146/197 (74%), Gaps = 11/197 (6%)
 Frame = +1

Query  94   RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL-  270
            +A+  +L  +  +FL   S+  +S+TYI+HMDLS MP+AF+ H +W+ AT+S++S+    
Sbjct  16   KAVLAYLFLLEVSFLN--SVLAKSDTYIIHMDLSAMPKAFSDHHNWYLATISAVSDTSKA  73

Query  271  --------VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  426
                    +Y YT+++HGFSA L+ +ELE++KK PGY+ ST+D  +KV T+HT  FLGLS
Sbjct  74   AVTPASKHIYTYTSSVHGFSASLTNSELESLKKYPGYISSTRDRPLKVHTTHTSQFLGLS  133

Query  427  SDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNK  606
            S  GAWPAT YG DVIIG++DTG+WPES+SF D GM  IP+RW+G+C SGT F  S+CNK
Sbjct  134  SVSGAWPATSYGEDVIIGLVDTGIWPESQSFSDVGMSSIPSRWRGKCSSGTHFNSSLCNK  193

Query  607  KLIGARYFNKGLLAKNP  657
            KLIGA +FNKGLLA NP
Sbjct  194  KLIGAHFFNKGLLANNP  210



>ref|XP_008357385.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   233 bits (594),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 145/206 (70%), Gaps = 16/206 (8%)
 Frame = +1

Query  91   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--  264
            +  L+F L+  + + L I S   QS+ YI+HMD S MP+AF+ H SW+ ATL S   +  
Sbjct  5    YHVLYFWLSITTISHLAIVSTFAQSQNYIIHMDSSMMPKAFSDHHSWYVATLHSTLGKFT  64

Query  265  --------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSH  402
                           L+Y+YT+ ++GFSA L+ +ELEA+K S GY+ S KD  V  DT+H
Sbjct  65   PITXGTSSSSALSSKLIYSYTHVMNGFSASLTASELEALKSSLGYISSVKDLPVMKDTTH  124

Query  403  TPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQ  582
            +  FLGL+S  GAWP ++YG+DVIIG++DTGVWPES+SF +DGM EIP RWKGEC+ GTQ
Sbjct  125  SSQFLGLNSRSGAWPVSNYGKDVIIGLVDTGVWPESESFNEDGMSEIPPRWKGECEXGTQ  184

Query  583  FTPSMCNKKLIGARYFNKGLLAKNPN  660
            F  S+CNKKLIGA++FNKGL+A+NPN
Sbjct  185  FNSSLCNKKLIGAKFFNKGLIAQNPN  210



>emb|CDP17956.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 133/166 (80%), Gaps = 12/166 (7%)
 Frame = +1

Query  199  MPRAFTSHQSWFSATLSSISN------------RGLVYAYTNAIHGFSAVLSPAELEAIK  342
            MP+AF+SHQSW+  TL SIS+              L+Y YTNA+HGFSA+LSP+EL A+K
Sbjct  1    MPKAFSSHQSWYLTTLESISDATSEATIDFPPSSKLLYTYTNALHGFSAILSPSELRAMK  60

Query  343  KSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFG  522
             SPG++ + KD SVK+DT+H+  FLGL+S +GAWP +DYG+DVIIG++D+GVWPESKS+ 
Sbjct  61   DSPGFVSAIKDKSVKMDTTHSSKFLGLNSKYGAWPNSDYGKDVIIGLVDSGVWPESKSYS  120

Query  523  DDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            DDGM EIP+RWKG+C+SGTQF  S CNKKLIGAR+FNKGLLAK PN
Sbjct  121  DDGMTEIPSRWKGQCESGTQFNSSSCNKKLIGARFFNKGLLAKFPN  166



>ref|XP_010263712.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=542

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 135/185 (73%), Gaps = 14/185 (8%)
 Frame = +1

Query  148  SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-------------LVYAYTN  288
            S+  +S+ YIVHMDLS MPRAF  H SW+ ATLSSI + G             L+Y Y N
Sbjct  23   SLLAKSDVYIVHMDLSAMPRAFADHHSWYEATLSSIKDGGNGVATITTTKPSYLIYTYNN  82

Query  289  AIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS-SDHGAWPATDYGR  465
            AIHGF+A LSP EL+ +K  PG++ ST D  +K DT+HTP FLGL+ S+ G WPA++YG 
Sbjct  83   AIHGFAASLSPLELDLLKHLPGFVSSTLDVLLKADTTHTPDFLGLNNSNSGPWPASNYGE  142

Query  466  DVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLL  645
            DVIIG++D+G+WPES SF DDGM ++P +WKGEC SGT F  +MCNKKLIGAR+FNKG+ 
Sbjct  143  DVIIGLVDSGIWPESASFRDDGMTQVPNKWKGECVSGTDFNSTMCNKKLIGARFFNKGIK  202

Query  646  AKNPN  660
            A +P+
Sbjct  203  AHSPD  207



>ref|XP_007017195.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14420.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=760

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 149/205 (73%), Gaps = 16/205 (8%)
 Frame = +1

Query  85   ANH-RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-  258
            A+H + LF  L+FI      IF+   +++ YIV MDLS  P+AF+  QSW+ ATL+S+S 
Sbjct  3    ADHTKILFVWLSFIVPF---IFTKLAEADNYIVQMDLSAKPKAFSGQQSWYLATLASLSA  59

Query  259  -----------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHT  405
                       +  L+Y Y + I GFSA L+PAELEA+K +PGY+ S +D +VKVDT+H+
Sbjct  60   NWRANTNATIPSSKLIYTYNHVIQGFSASLTPAELEALKNAPGYVSSIRDRTVKVDTTHS  119

Query  406  PGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQF  585
              FLGL+S  GAWP +++G+DVIIGVIDTGVWPES SF D+GM ++P++WKG C++GTQF
Sbjct  120  FKFLGLNSSTGAWPVSNFGKDVIIGVIDTGVWPESGSFNDNGMTDVPSKWKGGCENGTQF  179

Query  586  TPSMCNKKLIGARYFNKGLLAKNPN  660
              S+CNKKLIGAR FNKGL+A NPN
Sbjct  180  NSSLCNKKLIGARSFNKGLIAHNPN  204



>ref|XP_008785865.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 139/194 (72%), Gaps = 9/194 (5%)
 Frame = +1

Query  106  FHLAFISATFL--QIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  264
            FH  +++   L  Q+  I  +  TYIVHMDLS MPRAF+ H+SW+++ +S+ +       
Sbjct  7    FHYVWMAIAILTSQMIPISAEVATYIVHMDLSAMPRAFSGHRSWYTSVVSAAATSDSVFA  66

Query  265  --GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  438
               L+Y Y NAIHGFSA LSP +L+ +K+S G+L   +D  V VDT+HTP FL LSS  G
Sbjct  67   ASNLIYIYDNAIHGFSARLSPLQLQQLKRSHGFLSCYRDVPVTVDTTHTPEFLHLSSASG  126

Query  439  AWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIG  618
             WPA++YG DVIIGV+D+G+WPES+SF D GM ++PARWKG C+ GT F+ S CN+KLIG
Sbjct  127  LWPASNYGEDVIIGVVDSGIWPESESFSDYGMTDVPARWKGVCEQGTTFSSSACNRKLIG  186

Query  619  ARYFNKGLLAKNPN  660
            AR FNKGLLA NPN
Sbjct  187  ARSFNKGLLAANPN  200



>ref|XP_008785920.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=764

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 138/195 (71%), Gaps = 10/195 (5%)
 Frame = +1

Query  106  FHLAFISATFLQIFSIDGQSE--TYIVHMDLSFMPRAFTSHQSWFS-------ATLSSIS  258
            FH  +++   L    I   +E  TYIVHMDLS MPRAF+ H SW++       AT  SIS
Sbjct  7    FHYVWMAVAILTSHMIPTSAEVATYIVHMDLSAMPRAFSGHHSWYTSVVAAATATSDSIS  66

Query  259  -NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  435
                L+Y Y NAIHGFSA LSP +L+ +K+S GYL   ++  V VDT+HTP FL LSS  
Sbjct  67   PTSNLIYVYDNAIHGFSARLSPLQLQQLKRSHGYLSCYREMPVTVDTTHTPEFLHLSSGS  126

Query  436  GAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLI  615
            G WPA++YG DVIIGV+DTG+WPESKSF DDGM ++PARWKG C+ GT F+ S CN+KLI
Sbjct  127  GLWPASNYGEDVIIGVVDTGIWPESKSFSDDGMTDVPARWKGVCEQGTAFSSSACNRKLI  186

Query  616  GARYFNKGLLAKNPN  660
            GAR FNKGLLA +PN
Sbjct  187  GARSFNKGLLAAHPN  201



>ref|XP_004291093.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=767

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 145/196 (74%), Gaps = 6/196 (3%)
 Frame = +1

Query  91   HRALFFHLAFISATFLQIFSIDG-QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG  267
            H  L+F L+ ++ ++L I S    +S  YI+HMD SFMP+AF  H SW+ +T+ S+ +  
Sbjct  7    HVPLYFWLSIVTISYLAIVSTFAHESSNYIIHMDSSFMPKAFADHHSWYLSTVDSVLSTS  66

Query  268  -----LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSD  432
                 L+Y+YT+ ++GFSA LS +ELEA+K SPGY+ S +D   K DT+H+  FLGL+S 
Sbjct  67   SISSKLIYSYTHVLNGFSASLSVSELEALKTSPGYISSVRDLPAKPDTTHSSQFLGLNSK  126

Query  433  HGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKL  612
             GAWP ++YG+  IIG++DTGVWPE++SF D GM EIP+RWKGEC+SG QF+ S+CNKKL
Sbjct  127  TGAWPVSNYGKGTIIGLVDTGVWPENESFNDGGMSEIPSRWKGECESGMQFSSSLCNKKL  186

Query  613  IGARYFNKGLLAKNPN  660
            IGAR+FNKGL A +PN
Sbjct  187  IGARFFNKGLAAADPN  202



>ref|XP_003548400.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=753

 Score =   225 bits (573),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 144/206 (70%), Gaps = 20/206 (10%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---  252
            MA H  L   L F+  T L + S   QS+ YI+HMD+S MP+ F++  SW+ +TLSS   
Sbjct  1    MATHICL--SLCFLYITTLNLVSTLAQSDNYIIHMDISAMPKTFSTQHSWYLSTLSSALD  58

Query  253  ----------ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSH  402
                      +S+  L+Y YTNAI+GFSA LSP ELE++K SPGY+   +D   K DT+H
Sbjct  59   NSKATNNLNSVSSSKLIYTYTNAINGFSANLSPKELESLKTSPGYVSYMRDLPAKRDTTH  118

Query  403  TPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQ  582
            +P FLGL+ + GAWP +++G+DVI+G++DTG+WPESKSF D GM EIP+RWKG+C+S  +
Sbjct  119  SPQFLGLNPNEGAWPVSEFGKDVIVGLVDTGIWPESKSFNDKGMTEIPSRWKGQCESTIK  178

Query  583  FTPSMCNKKLIGARYFNKGLLAKNPN  660
                 CNKKLIGA++FNKG+LA +PN
Sbjct  179  -----CNKKLIGAQFFNKGMLANSPN  199



>ref|XP_006434737.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
 gb|ESR47977.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
Length=765

 Score =   225 bits (573),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 140/200 (70%), Gaps = 13/200 (7%)
 Frame = +1

Query  94   RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR---  264
            +   F L+++   F    S D +S TYIVHMD S MP+AF +H  W+S+ + S+ ++   
Sbjct  9    QLFLFVLSWLLLAFHANSSSDERS-TYIVHMDKSHMPKAFFNHHHWYSSVVHSLKSKKPA  67

Query  265  ---------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  417
                      LVY+Y NA HGFSAVLS  ELE +KKSPG++ +  D +V +DT+HTP FL
Sbjct  68   KSNHHRFSPSLVYSYDNAAHGFSAVLSKRELETLKKSPGFISAYADKTVTLDTTHTPEFL  127

Query  418  GLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSM  597
             L++ +G WPA+ YG DVI+GVIDTGVWPES S+ DDGMG +P RWKGECQ+G +F  S+
Sbjct  128  SLNTANGLWPASKYGEDVIVGVIDTGVWPESDSYNDDGMGSLPTRWKGECQAGQEFNSSL  187

Query  598  CNKKLIGARYFNKGLLAKNP  657
            CN KLIGARYFNKG++A NP
Sbjct  188  CNSKLIGARYFNKGIIAANP  207



>gb|KDO84129.1| hypothetical protein CISIN_1g004265mg [Citrus sinensis]
Length=765

 Score =   225 bits (573),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 140/200 (70%), Gaps = 13/200 (7%)
 Frame = +1

Query  94   RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR---  264
            +   F L+++   F    S D +S TYIVHMD S MP+AF +H  W+S+ + S+ ++   
Sbjct  9    QLFLFVLSWLLLAFHANSSSDERS-TYIVHMDKSHMPKAFFNHHHWYSSVVHSLKSKKPA  67

Query  265  ---------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  417
                      LVY+Y NA HGFSAVLS  ELE +KKSPG++ +  D +V +DT+HTP FL
Sbjct  68   KSNHHRFSPSLVYSYDNAAHGFSAVLSKRELETLKKSPGFISAYADKTVTLDTTHTPEFL  127

Query  418  GLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSM  597
             L++ +G WPA+ YG DVI+GVIDTGVWPES S+ DDGMG +P RWKGECQ+G +F  S+
Sbjct  128  SLNTANGLWPASKYGEDVIVGVIDTGVWPESDSYNDDGMGSLPTRWKGECQAGQEFNSSL  187

Query  598  CNKKLIGARYFNKGLLAKNP  657
            CN KLIGARYFNKG++A NP
Sbjct  188  CNSKLIGARYFNKGIIAANP  207



>ref|XP_009345959.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=767

 Score =   225 bits (573),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 136/187 (73%), Gaps = 8/187 (4%)
 Frame = +1

Query  121  ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------LVY  276
            I +    + S+  QS  YI+HMD S MP+AF+ H+ W+ ATL SIS+          +++
Sbjct  20   IVSAIAHLNSVSAQSHAYIIHMDSSAMPKAFSGHERWYLATLLSISDSAKSSNSTTKIIH  79

Query  277  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATD  456
             YTN+I GFSAVL+ +ELEA+KK PG++    D  +K+ T+HT  FLGL+S  GAWPA++
Sbjct  80   TYTNSIQGFSAVLTLSELEALKKCPGFVSFAHDGPLKLQTTHTSQFLGLTSSSGAWPASN  139

Query  457  YGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNK  636
            YG  VIIG++DTGVWPES SF D+GM E+P++WKGEC SGTQF  S+CNKKLIGAR+FNK
Sbjct  140  YGEGVIIGLLDTGVWPESDSFKDEGMTEVPSKWKGECVSGTQFNSSLCNKKLIGARFFNK  199

Query  637  GLLAKNP  657
            G +A NP
Sbjct  200  GYIANNP  206



>ref|XP_003626594.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES82812.1| subtilisin-like serine protease [Medicago truncatula]
Length=765

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 144/209 (69%), Gaps = 18/209 (9%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFS---IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS  252
            MA+H   +  L+F     L +FS    D     YI+HM+LS MP+ F S QSW+ ATLSS
Sbjct  1    MASHIHHYLLLSF--NIILHLFSSTLCDQNFNNYIIHMNLSAMPKPFLSQQSWYLATLSS  58

Query  253  I----SNRG---------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  393
            +    SN           L Y YTN ++GFSA LSP +LEA+K +PGY+ S +D  +K D
Sbjct  59   LLDITSNNDQLSYIFSPKLTYTYTNVMNGFSASLSPLKLEALKTTPGYISSIRDLPIKPD  118

Query  394  TSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQS  573
            T+H+P F+GL+   G WP T YG+++IIG+ID+G+WPES+SF DD M  IP+RWKG+C++
Sbjct  119  TTHSPHFIGLNPVFGTWPTTQYGKNIIIGLIDSGIWPESESFKDDEMPNIPSRWKGKCEN  178

Query  574  GTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            GTQF  S+CNKKLIGAR+FNKGLLA NPN
Sbjct  179  GTQFDSSLCNKKLIGARFFNKGLLANNPN  207



>ref|XP_004494864.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=777

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 140/207 (68%), Gaps = 19/207 (9%)
 Frame = +1

Query  94   RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------  255
            R L F    I+   +    +D  S  YI+HM+LS MP  F++ QSW+ + +SS+      
Sbjct  12   RYLLFSF-IITTHLVSSILVDQNSNNYIIHMNLSAMPTPFSNQQSWYLSIISSLLQITSD  70

Query  256  ------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTS  399
                        S+  LVY YTN ++GF A LSP ELEA+K SP Y+ S KD  +K+DT+
Sbjct  71   QVTINNHQLNHLSSSKLVYTYTNVMNGFCANLSPLELEALKTSPEYISSIKDLPIKLDTT  130

Query  400  HTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGT  579
            H+P  +GL+   GAWP T YG++VIIG+ID+G+WPES+SF DD + +IP+RWKG+C+ GT
Sbjct  131  HSPQSIGLNPVSGAWPTTQYGKNVIIGLIDSGIWPESESFKDDEISDIPSRWKGQCEKGT  190

Query  580  QFTPSMCNKKLIGARYFNKGLLAKNPN  660
            QF PS+CNKKLIGAR+FNKGLLA NPN
Sbjct  191  QFDPSLCNKKLIGARFFNKGLLANNPN  217



>gb|KDP41713.1| hypothetical protein JCGZ_16120 [Jatropha curcas]
Length=767

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 149/210 (71%), Gaps = 25/210 (12%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSIDGQ--SETYIVHMDLSFMPRAFTSHQSWFSATLSSIS----  258
            A F  L+FIS   + +F I G   S+ YIVHMDLS MP+AF++H SW+ ATLSSIS    
Sbjct  2    ATFLWLSFIS---VSLFIIPGLTLSDNYIVHMDLSAMPKAFSTHHSWYLATLSSISAVSN  58

Query  259  ---------------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  393
                           +  ++Y+YT+ I+GFSA LSP E EA+KKSPGY+ S KD  VK+D
Sbjct  59   NGGGGGGGGSGSAIADSKILYSYTHVINGFSAHLSPFEHEALKKSPGYISSFKDLPVKLD  118

Query  394  TSHTPGFLGLSSDHG-AWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQ  570
            T+ +P FLGL+S+ G AW  ++YG D+IIGV+DTG+WPES+S+ D G+  IP +WKGEC+
Sbjct  119  TTRSPTFLGLTSNSGGAWLPSNYGEDIIIGVVDTGIWPESESYSDKGISGIPKKWKGECE  178

Query  571  SGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            SGT+F  S+CN KLIGAR+FNKGL+A NPN
Sbjct  179  SGTRFNSSLCNNKLIGARFFNKGLIASNPN  208



>ref|XP_011029618.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=775

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 143/211 (68%), Gaps = 18/211 (9%)
 Frame = +1

Query  82   MANHR-ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS  258
            MA+HR  L + L     T L       Q++ YIVHMDLS MP++F+    W+ ATL+S+S
Sbjct  1    MASHRNVLLYKLWICFITILYFTETLSQTDNYIVHMDLSVMPKSFSGQHHWYLATLASVS  60

Query  259  NRG-----------------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  387
            +                   L+Y+YT+ ++GFSA L+P+ELEA+K+SPGY+ S KD  VK
Sbjct  61   DVADSSTARASEATLTASSKLLYSYTHVVNGFSASLTPSELEALKRSPGYISSIKDLPVK  120

Query  388  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGEC  567
             DT+H+P +LGL+    AW A++YG  +IIG++DTG WPES+S+ D GM EIP  WKGEC
Sbjct  121  HDTTHSPKYLGLTPQSPAWKASNYGDGIIIGLVDTGAWPESESYNDHGMPEIPKTWKGEC  180

Query  568  QSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +SGTQF   MCNKKLIGAR+FNKGL+AK PN
Sbjct  181  ESGTQFNSLMCNKKLIGARFFNKGLIAKYPN  211



>ref|XP_009343175.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=761

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 136/187 (73%), Gaps = 8/187 (4%)
 Frame = +1

Query  121  ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------LVY  276
            I +    + S+  QS  YI+HMD S MP+AF+ H+ W+ ATL SIS+          +++
Sbjct  20   IVSAIAHLNSVSAQSHAYIIHMDSSAMPKAFSGHERWYLATLLSISDSAKSSNSTTKIIH  79

Query  277  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATD  456
             YTN+I GFSAVL+ +ELEA+KK PG++    D  +K+ T+HT  FLGL+S  GAWPA++
Sbjct  80   TYTNSIQGFSAVLTLSELEALKKCPGFVSFAHDGPLKLQTTHTSQFLGLTSSSGAWPASN  139

Query  457  YGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNK  636
            YG  VIIG++DTGVWPES SF D+GM E+P++WKG+C SGTQF  S+CNKKLIGAR+FNK
Sbjct  140  YGEGVIIGLLDTGVWPESDSFKDEGMTEVPSKWKGKCVSGTQFNSSLCNKKLIGARFFNK  199

Query  637  GLLAKNP  657
            G +A NP
Sbjct  200  GYIANNP  206



>ref|XP_006425911.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
 gb|ESR39151.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
Length=786

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 142/200 (71%), Gaps = 14/200 (7%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWF-------------S  237
            A    L F+  T   + S   +S+TYI+HMD S MP+A++S  +W+             +
Sbjct  30   ATLITLKFLLLTAFHLSSTLAKSDTYIIHMDTSAMPKAYSSLYTWYLFMLCSVSESSKAT  89

Query  238  ATLSSISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  417
            AT ++IS++ L+Y Y N+IHGFSA L+ +ELE +KK PGY+ ST D  + V T+HT  FL
Sbjct  90   ATSTTISSK-LIYTYANSIHGFSATLTVSELETLKKLPGYISSTPDRPLTVHTTHTSQFL  148

Query  418  GLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSM  597
            GLSS  GAWPA++YG+ VIIG++DTG+WPES+SF D+GM ++P RWKGEC SG QF  S+
Sbjct  149  GLSSLSGAWPASNYGKGVIIGLVDTGIWPESQSFSDEGMAKVPPRWKGECMSGVQFNSSL  208

Query  598  CNKKLIGARYFNKGLLAKNP  657
            CNKKLIGAR+FNKGL+A NP
Sbjct  209  CNKKLIGARFFNKGLIANNP  228



>ref|XP_009799242.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=757

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 139/180 (77%), Gaps = 12/180 (7%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SNRGLVYAYTNAIHG  300
             +S++YI+HMD S MP+AF+S  SW+ ATL+S+            ++  L+Y+Y NA+HG
Sbjct  24   AESDSYIIHMDTSAMPKAFSSPHSWYLATLASVLDSSSAGSKNTLASSKLIYSYKNAMHG  83

Query  301  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  480
            FSA LS +E +A+K SPGY+ S++D +VK+ T+H+  FLGL+S  G+WP ++YG+ VIIG
Sbjct  84   FSASLSSSEYKAMKNSPGYVSSSEDMTVKLHTTHSSHFLGLNSMSGSWPKSNYGKYVIIG  143

Query  481  VIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            V+DTGVWPES+SF DDGM ++P+RWKG CQ+GTQF  S+CNKKLIGARYFNKGLLAK  N
Sbjct  144  VVDTGVWPESRSFDDDGMTQVPSRWKGICQTGTQFNSSLCNKKLIGARYFNKGLLAKVKN  203



>ref|XP_006466594.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=786

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 141/200 (71%), Gaps = 14/200 (7%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWF-------------S  237
            A    L F+      + S   +S+TYI+HMD S MP+A++S  +W+             +
Sbjct  30   ATLITLKFLLLAAFHLSSTLAKSDTYIIHMDTSAMPKAYSSLYTWYLFMLCSVSESSKAT  89

Query  238  ATLSSISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  417
            AT S+IS++ LVY Y N+IHGFSA L+ +ELE +KK PGY+ ST D  + V T+HT  FL
Sbjct  90   ATSSTISSK-LVYTYANSIHGFSATLTVSELETLKKLPGYISSTPDRPLAVHTTHTSEFL  148

Query  418  GLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSM  597
            GLSS  GAWPA++YG+ VIIG++DTG+WPES+SF D+GM ++P RWKGEC SG QF  S+
Sbjct  149  GLSSLSGAWPASNYGKGVIIGLVDTGIWPESQSFSDEGMAKVPPRWKGECMSGVQFNSSL  208

Query  598  CNKKLIGARYFNKGLLAKNP  657
            CNKKLIGAR+FNKGL+A NP
Sbjct  209  CNKKLIGARFFNKGLIANNP  228



>ref|XP_010912031.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=765

 Score =   223 bits (567),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 142/203 (70%), Gaps = 19/203 (9%)
 Frame = +1

Query  103  FFHLAFISATFLQIFSIDGQSE--TYIVHMDLSFMPRAFTSHQSWFSA------------  240
            F  + +++ T L    I   +E  TYIVHMDLS MP+AF+ H SW+++            
Sbjct  7    FHCVLWMALTILTSHMILASAEVATYIVHMDLSAMPKAFSGHHSWYTSVVAAVAATTTAT  66

Query  241  ---TLSSISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
               ++S  SN  L+Y Y +AIHGFSA LSP++LE +KKS GYL S +D    VDT+HTP 
Sbjct  67   TSDSISLTSN--LIYVYDHAIHGFSARLSPSQLEQLKKSHGYLSSYRDTPATVDTTHTPE  124

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FL LS + G WPA+++G+DVIIGV+DTG+WPES+SF DDGM  +PARWKG C+ GT F+ 
Sbjct  125  FLHLSPNSGLWPASNFGKDVIIGVVDTGIWPESQSFNDDGMTPVPARWKGVCEQGTDFSS  184

Query  592  SMCNKKLIGARYFNKGLLAKNPN  660
            S CN+KLIGAR+FNKGLLA NPN
Sbjct  185  SACNRKLIGARFFNKGLLAANPN  207



>ref|XP_007135315.1| hypothetical protein PHAVU_010G119000g [Phaseolus vulgaris]
 gb|ESW07309.1| hypothetical protein PHAVU_010G119000g [Phaseolus vulgaris]
Length=658

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 137/197 (70%), Gaps = 19/197 (10%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS-------------  252
            L F S   L +     QS  YI+HMD S MP+AF++  SW  +TLSS             
Sbjct  9    LWFSSIIILNLVHTLAQSRNYIIHMDASAMPKAFSTQHSWHLSTLSSVLDNAHTSNHNNL  68

Query  253  -ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
             I++  L+Y YTNA++GFSA LSP E EA+K SPGY+ ST D   K+DTSH+P FLGL+ 
Sbjct  69   NIASSKLIYTYTNAMNGFSANLSPKEFEALKISPGYVSSTPDLLAKIDTSHSPKFLGLNR  128

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
            + GAWPA  +G DVI+GV+DTG+WPES+SF D+GM E+P+RWKG+C+S  +     CNKK
Sbjct  129  NTGAWPAAKFGEDVIVGVVDTGIWPESESFRDEGMSEVPSRWKGQCESSIK-----CNKK  183

Query  610  LIGARYFNKGLLAKNPN  660
            LIGAR+FN+G+LAK+PN
Sbjct  184  LIGARFFNRGMLAKHPN  200



>ref|XP_010540359.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=768

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 139/189 (74%), Gaps = 6/189 (3%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-LV  273
             LFF L FI       FS     + YIVHMDLS MP+AF+S  SW+ +TL+SIS+    +
Sbjct  12   CLFFFLVFICP-----FSRAEDDDVYIVHMDLSEMPKAFSSQHSWYMSTLASISSASDHL  66

Query  274  YAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPAT  453
            Y Y   + GFSAVLSP+ L +++ SPG++Y+T+D  VK+DT+H+  FLGLS   GAW  T
Sbjct  67   YTYNRVLRGFSAVLSPSGLRSLETSPGFVYATRDKPVKLDTTHSFEFLGLSPGSGAWAIT  126

Query  454  DYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFN  633
            D+G+ VIIGV+D+G+WPESKSF +DGMG IP++WKGEC+ GTQF  S+CNKKLIGAR F+
Sbjct  127  DFGKGVIIGVVDSGLWPESKSFAEDGMGTIPSKWKGECEEGTQFNSSLCNKKLIGARSFS  186

Query  634  KGLLAKNPN  660
            +GL+A  PN
Sbjct  187  RGLVAHVPN  195



>ref|XP_008241490.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=745

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 145/207 (70%), Gaps = 22/207 (11%)
 Frame = +1

Query  106  FHLAFISATFLQIF------------SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLS  249
             H + ++A  LQI             S+  QS  YI+HMD   MP+AF+ HQSW+ ATL 
Sbjct  3    LHCSSMAALALQILCTALSAITHFISSVSAQSNAYIIHMDSKAMPKAFSGHQSWYLATLL  62

Query  250  SISNR---------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSH  402
            SIS+           L++ YTN+IHGFSA+L+ +ELEA+K SPG++  T D  +K+ T+H
Sbjct  63   SISDSPKAYTFGTTKLIHTYTNSIHGFSAILTLSELEALKNSPGFISVTPDGPLKLHTTH  122

Query  403  TPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGD-DGMGEIPARWKGECQSGT  579
            T  FLGL+S  GAWPA++YG  VIIGV+DTGVWPES+SF + +G+ ++P+RWKG+C SGT
Sbjct  123  TSQFLGLTSSSGAWPASNYGEGVIIGVLDTGVWPESESFKEYEGITDVPSRWKGKCVSGT  182

Query  580  QFTPSMCNKKLIGARYFNKGLLAKNPN  660
            QF  S+CNKKLIGA++FNKG +A NP+
Sbjct  183  QFNSSLCNKKLIGAQFFNKGFIANNPD  209



>ref|XP_007017194.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14419.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=793

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 132/196 (67%), Gaps = 12/196 (6%)
 Frame = +1

Query  106  FHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------  267
             H  F++     +        TYIVHMD SFMP+ F SH SW+S+T+ S+ +R       
Sbjct  13   LHSVFLTFVMFTLHVHSVSVNTYIVHMDKSFMPKIFASHHSWYSSTVDSLKSRNTALSSN  72

Query  268  ------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
                  L+Y+Y +  HGFSAVLSP ELE +KKSPG++ +  D SV +DT+HTP FL L+ 
Sbjct  73   PRTSPTLLYSYDSGAHGFSAVLSPDELETLKKSPGFVSAYPDKSVTLDTTHTPEFLSLNP  132

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
              G WPA++YG D+IIGVID+GVWPES S+ DDGM  +PARW G C+ G +F  SMCN K
Sbjct  133  YSGLWPASNYGEDIIIGVIDSGVWPESDSYKDDGMTPVPARWNGICEEGQEFNSSMCNSK  192

Query  610  LIGARYFNKGLLAKNP  657
            LIGARYFNKG++A NP
Sbjct  193  LIGARYFNKGVIAANP  208



>ref|XP_006374913.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52710.1| subtilase family protein [Populus trichocarpa]
Length=775

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 142/211 (67%), Gaps = 18/211 (9%)
 Frame = +1

Query  82   MANHR-ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS  258
            MA+HR  L + L     T L       Q++ YIVHMDLS MP++F+    W+ +TL+S+S
Sbjct  1    MASHRNVLLYKLWVCFITILYFTETLSQTDNYIVHMDLSVMPKSFSGQHHWYLSTLASVS  60

Query  259  NRG-----------------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  387
            +                   L+Y+YT+ ++GFSA L+P+ELEA+K SPGY+ S KD  VK
Sbjct  61   DVADSSTARASEATLTASSKLLYSYTHVVNGFSASLTPSELEALKTSPGYISSIKDLPVK  120

Query  388  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGEC  567
             DT+H+P +LGL+    AW A++YG  +IIG++DTG WPES+S+ D GM EIP  WKGEC
Sbjct  121  HDTTHSPKYLGLTPQSPAWKASNYGDGIIIGLVDTGAWPESESYNDHGMPEIPKTWKGEC  180

Query  568  QSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +SGTQF   MCNKKLIGAR+FNKGL+AK PN
Sbjct  181  ESGTQFNSLMCNKKLIGARFFNKGLIAKYPN  211



>ref|XP_008785921.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 139/198 (70%), Gaps = 11/198 (6%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSE--TYIVHMDLSFMPRAFTSHQSWFSATLS--------  249
            L FH  +++   L    I   +E  TYI+HMDLS +PRAF+ H+SW+++ +S        
Sbjct  5    LSFHYVWMAVAILTSHMIPTSAEVATYIIHMDLSAIPRAFSGHRSWYTSVVSAAATTPSD  64

Query  250  SIS-NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  426
            SIS    L+Y Y NAIHGFSA LSP +L+ +K+S GYL   ++  + VDT+HTP FL LS
Sbjct  65   SISATSNLIYVYDNAIHGFSARLSPLQLQQLKRSHGYLSCYREMPMTVDTTHTPEFLHLS  124

Query  427  SDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNK  606
            S  G WPA++YG DVIIGV+D+G+WPE +SF DD M ++PARWKG C+ GT F+ S CN+
Sbjct  125  SGSGLWPASNYGEDVIIGVVDSGIWPERESFSDDSMTDVPARWKGVCEQGTAFSSSACNR  184

Query  607  KLIGARYFNKGLLAKNPN  660
            KLIGAR FNKGLLA NPN
Sbjct  185  KLIGARSFNKGLLAANPN  202



>ref|XP_002510195.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52382.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 144/200 (72%), Gaps = 18/200 (9%)
 Frame = +1

Query  103  FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---ISNR---  264
            F  L+FI+  +L I     +++ YIVHMDLS MP  F+SH SW+ ATLSS   +SN    
Sbjct  11   FLWLSFITF-WLFIIPTLAETDNYIVHMDLSAMPEVFSSHHSWYLATLSSAFAVSNSRNT  69

Query  265  -----------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
                        L+Y+YT+ I+GFSA LS +ELEA+K +PGY+ S +D  VK+DT+ +P 
Sbjct  70   INTTPARPFSSKLLYSYTHVINGFSAHLSLSELEALKNTPGYISSIRDLPVKLDTTRSPT  129

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FLGL+ + GAW  T++G DVIIGV+DTG+WPES+S+ D+G+ EIP RWKGEC+SGT+F  
Sbjct  130  FLGLTGNSGAWQPTNFGEDVIIGVVDTGIWPESESYSDNGISEIPKRWKGECESGTEFNT  189

Query  592  SMCNKKLIGARYFNKGLLAK  651
            S+CNKKLIGAR+FNK L+AK
Sbjct  190  SLCNKKLIGARFFNKALIAK  209



>ref|XP_007204261.1| hypothetical protein PRUPE_ppa001828mg [Prunus persica]
 gb|EMJ05460.1| hypothetical protein PRUPE_ppa001828mg [Prunus persica]
Length=759

 Score =   219 bits (558),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 142/198 (72%), Gaps = 10/198 (5%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR----  264
            AL      +SA    I S+  QS  YI+HMD   MP+AF+ HQSW+ ATL SIS+     
Sbjct  5    ALQILCTVLSAITHFISSVSAQSNAYIIHMDSKAMPKAFSGHQSWYLATLLSISDSPKAY  64

Query  265  -----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
                  L++ YTN+I GFSA+L+ +ELE++K SPG++  T D  +K+ T+HT  FLGL+S
Sbjct  65   TFSTTKLIHTYTNSIQGFSAILTLSELESLKNSPGFISVTPDGPLKLHTTHTSQFLGLTS  124

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGD-DGMGEIPARWKGECQSGTQFTPSMCNK  606
              GAWPA+ YG DVIIGV+D+GVWPES+SF + +G+ ++P+RWKG+C SGTQF  S+CNK
Sbjct  125  SSGAWPASSYGEDVIIGVLDSGVWPESESFKEYEGITDVPSRWKGKCVSGTQFNSSLCNK  184

Query  607  KLIGARYFNKGLLAKNPN  660
            KLIGA++FNKG +A NP+
Sbjct  185  KLIGAQFFNKGFIANNPD  202



>ref|XP_006374911.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52708.1| subtilase family protein [Populus trichocarpa]
Length=778

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 141/212 (67%), Gaps = 19/212 (9%)
 Frame = +1

Query  82   MANHRA-LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  255
            MA  R  L   L   S T L       Q++ YIVHMDLS MP++F+    W+ +TL+S+ 
Sbjct  1    MATRREFLLSKLWICSITILHFTGTLSQTDNYIVHMDLSAMPKSFSGQHHWYLSTLASVF  60

Query  256  --SNRG---------------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASV  384
              S+R                L+Y+YT+ I+GFSA L+P+ELEA+KKSPGY+ S KD  V
Sbjct  61   DVSDRSTARASPATYLTASSKLLYSYTHVINGFSASLTPSELEALKKSPGYISSIKDLPV  120

Query  385  KVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGE  564
            K DT+H+  FLGL+    AW A++ G  +IIG++D+GVWPES+S+ D GM EIP RWKG 
Sbjct  121  KHDTTHSTKFLGLAPQSPAWKASNLGDGIIIGLVDSGVWPESESYNDHGMSEIPKRWKGG  180

Query  565  CQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            CQSG QF  SMCNKKLIGAR+FNKGL+A NPN
Sbjct  181  CQSGAQFNSSMCNKKLIGARFFNKGLIANNPN  212



>gb|ABK95622.1| unknown [Populus trichocarpa]
Length=778

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 141/212 (67%), Gaps = 19/212 (9%)
 Frame = +1

Query  82   MANHRA-LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  255
            MA  R  L   L   S T L       Q++ YIVHMDLS MP++F+    W+ +TL+S+ 
Sbjct  1    MATRREFLLSKLWICSITILHFTGTLSQTDNYIVHMDLSAMPKSFSGQHHWYLSTLASVF  60

Query  256  --SNRG---------------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASV  384
              S+R                L+Y+YT+ I+GFSA L+P+ELEA+KKSPGY+ S KD  V
Sbjct  61   DVSDRSTARASPATYLTASSKLLYSYTHVINGFSASLTPSELEALKKSPGYISSIKDLPV  120

Query  385  KVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGE  564
            K DT+H+  FLGL+    AW A++ G  +IIG++D+GVWPES+S+ D GM EIP RWKG 
Sbjct  121  KHDTTHSTKFLGLAPQSPAWKASNLGDGIIIGLVDSGVWPESESYNDHGMSEIPKRWKGG  180

Query  565  CQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            CQSG QF  SMCNKKLIGAR+FNKGL+A NPN
Sbjct  181  CQSGAQFNSSMCNKKLIGARFFNKGLIANNPN  212



>ref|XP_002284864.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=763

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 137/202 (68%), Gaps = 14/202 (7%)
 Frame = +1

Query  91   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-  267
            HR     +A+IS T L   S  G+  TYI+HMD S MPRAF +H  W+++T+ S++    
Sbjct  8    HRLYLIFIAWISFT-LHFRSASGERSTYIIHMDKSLMPRAFATHHHWYASTVDSLTTAAS  66

Query  268  -----------LVYAYTNAIHGFSAVLSPAELEAIKKS-PGYLYSTKDASVKVDTSHTPG  411
                       L+Y Y + +HGF AVLS  ELE ++KS  G++ +  D +V +DT+HT  
Sbjct  67   TRSNAVQSTPKLIYTYDHVLHGFCAVLSKDELEKLRKSTAGFVSAYSDRTVTLDTTHTLE  126

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FL L+   G WPA+D+G+DVI+GVIDTGVWPES SF DDGM +IPARWKG C+ G +F  
Sbjct  127  FLKLNQISGLWPASDFGKDVIVGVIDTGVWPESASFKDDGMTQIPARWKGTCEEGQEFNS  186

Query  592  SMCNKKLIGARYFNKGLLAKNP  657
            SMCN+KLIGARYFNKG++A NP
Sbjct  187  SMCNRKLIGARYFNKGVIAANP  208



>ref|XP_010320531.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=750

 Score =   217 bits (552),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 129/182 (71%), Gaps = 11/182 (6%)
 Frame = +1

Query  148  SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----------LVYAYTNAI  294
            S  G+  TYI+HMD SFMP+AFTSH+ W S+ L +++ +            L+Y+Y NA 
Sbjct  14   SASGKRTTYIIHMDKSFMPKAFTSHEQWHSSILETVNLKDTASKSSTKPTRLLYSYDNAF  73

Query  295  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  474
            HGFSAV+S  EL+ ++K PG++ +  D  V +DT+HT  FLGL+ + G WPA+ YG DVI
Sbjct  74   HGFSAVMSEDELQVLEKLPGFVSAYADKMVTLDTTHTFEFLGLNPESGLWPASHYGEDVI  133

Query  475  IGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKN  654
            +GVIDTGVWPES+S+ DDGM EIP+RWKG C+ G  F  SMCN KLIG RYFNKG+ A N
Sbjct  134  VGVIDTGVWPESRSYKDDGMTEIPSRWKGICEPGQDFNASMCNNKLIGVRYFNKGVKAAN  193

Query  655  PN  660
            PN
Sbjct  194  PN  195



>emb|CDP01316.1| unnamed protein product [Coffea canephora]
Length=759

 Score =   217 bits (552),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 131/189 (69%), Gaps = 11/189 (6%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----------  267
            F+ ATFL   +   +  TYIVHMD SFMP+AF SHQ W+S+TL+S+ +            
Sbjct  12   FMFATFLLNLT-SAERSTYIVHMDKSFMPKAFASHQHWYSSTLNSLKSTSPNSDPQKPLE  70

Query  268  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  447
            L+Y Y N  HGFSAVLS AELEA+ K PG++ +  D    +DT+ +  FLGL+   G WP
Sbjct  71   LLYTYDNVFHGFSAVLSRAELEAVNKLPGFVSACSDRVATLDTTRSTEFLGLNPVTGLWP  130

Query  448  ATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARY  627
            A +YG+DVI+GV+DTGVWPES S+ DDGM +IP+RWKG C  G  F  S+CNKKLIGARY
Sbjct  131  AANYGKDVIVGVLDTGVWPESLSYKDDGMTDIPSRWKGSCDGGYDFNSSLCNKKLIGARY  190

Query  628  FNKGLLAKN  654
            FNKGLLA N
Sbjct  191  FNKGLLAAN  199



>ref|XP_006434738.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
 gb|ESR47978.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
Length=729

 Score =   216 bits (551),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 127/172 (74%), Gaps = 14/172 (8%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWFSATLSS--------------ISNRGLVYAYTNAIHGFSAVLSP  321
            MDLS MP+AF     W+SATL S              IS+  L+Y Y++ ++GFSA L+P
Sbjct  1    MDLSAMPKAFRGQHGWYSATLQSVSGNVEANTNIFNNISSSKLLYTYSHVLNGFSASLTP  60

Query  322  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVW  501
            AELEA+K SPGY+ S +D  VK  T+H+  FLGL+   GAWP + +G+D+IIGV+DTGVW
Sbjct  61   AELEALKSSPGYISSIRDLPVKPHTTHSSQFLGLNPKSGAWPVSKFGKDIIIGVVDTGVW  120

Query  502  PESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            PES+S+ D GM EIP+RWKGEC+SGTQF  S+CNKKLIGAR+FNKGLLAKNP
Sbjct  121  PESESYNDGGMTEIPSRWKGECESGTQFNSSLCNKKLIGARFFNKGLLAKNP  172



>gb|EYU25440.1| hypothetical protein MIMGU_mgv1a0017511mg, partial [Erythranthe 
guttata]
Length=650

 Score =   215 bits (548),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 131/179 (73%), Gaps = 12/179 (7%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHG  300
             Q  TYI+HMD S MP+AF+SH+ W+S+ L S+ +              LVY Y NA HG
Sbjct  21   AQRSTYIIHMDKSLMPKAFSSHRYWYSSILHSVQSPTSFAGGGEKLRPKLVYTYDNAFHG  80

Query  301  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  480
            F+AV+S  +++A++KSPG+L +  D  V  DT+H+  FLGL++  G WPA++YG+DVIIG
Sbjct  81   FTAVMSEDDVDAVRKSPGFLSAYPDDVVTPDTTHSYKFLGLNTAAGIWPASEYGKDVIIG  140

Query  481  VIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            V+DTGVWPES+SFGDDGM  +PARW+G CQ+G +F  S+CN+KLIGARYFN+G+ A NP
Sbjct  141  VVDTGVWPESRSFGDDGMTAVPARWRGICQAGEEFNSSLCNRKLIGARYFNEGVRAANP  199



>gb|KDO84130.1| hypothetical protein CISIN_1g004809mg [Citrus sinensis]
Length=729

 Score =   216 bits (551),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 127/172 (74%), Gaps = 14/172 (8%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWFSATLSS--------------ISNRGLVYAYTNAIHGFSAVLSP  321
            MDLS MP+AF     W+SATL S              IS+  L+Y Y++ ++GFSA L+P
Sbjct  1    MDLSAMPKAFRGQHGWYSATLQSVSGNVEANTNIFNNISSSKLLYTYSHVLNGFSASLTP  60

Query  322  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVW  501
            AELEA+K SPGY+ S +D  VK  T+H+  FLGL+   GAWP + +G+D+IIGV+DTGVW
Sbjct  61   AELEALKSSPGYISSIRDLPVKPHTTHSSQFLGLNPKSGAWPVSKFGKDIIIGVVDTGVW  120

Query  502  PESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            PES+S+ D GM EIP+RWKGEC+SGTQF  S+CNKKLIGAR+FNKGLLAKNP
Sbjct  121  PESESYNDGGMTEIPSRWKGECESGTQFNSSLCNKKLIGARFFNKGLLAKNP  172



>ref|XP_011069662.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=769

 Score =   217 bits (552),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 128/185 (69%), Gaps = 12/185 (6%)
 Frame = +1

Query  139  QIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAY  282
             +     +  T+IVHMD SFMP+AF+SH  W+S+ L S+ +              LVY Y
Sbjct  22   HVLQASAERSTFIVHMDKSFMPKAFSSHHYWYSSMLQSVKSVAQTSFDRDNLESKLVYTY  81

Query  283  TNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYG  462
             +A HGFSAV+S  ELEA+KK PG+L +  D  V  DT+HT  FL L++  G WPA+ YG
Sbjct  82   DSAFHGFSAVMSKPELEALKKLPGFLSAYPDGVVIPDTTHTYKFLSLNTAIGLWPASQYG  141

Query  463  RDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGL  642
            +DVIIGVIDTGVWPES+SF DDGM EIPARW+G CQ G +F  S+CNKKLIGARYFN+G+
Sbjct  142  KDVIIGVIDTGVWPESQSFKDDGMTEIPARWRGICQEGEEFNSSLCNKKLIGARYFNEGV  201

Query  643  LAKNP  657
             A NP
Sbjct  202  RAANP  206



>ref|XP_010028239.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=762

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 136/191 (71%), Gaps = 8/191 (4%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------  267
            L F+   FL       +SETYIVHMD   MP+ F+  +SW+ ATLSSIS  G        
Sbjct  8    LCFVILQFLPSCWSQTKSETYIVHMDTLSMPKVFSDQRSWYLATLSSISEGGATSTPLDK  67

Query  268  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  447
            LVY Y++++ GFSA LS  ELE++K+SP Y+ ST+D  +K+ T+HTP FLGL+S  GAWP
Sbjct  68   LVYTYSSSVQGFSATLSRPELESLKRSPHYVSSTRDRPLKLHTTHTPSFLGLNSVSGAWP  127

Query  448  ATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARY  627
            A++YG DVIIG +DTG+WPES SF D+G+  IP+RWKG C SG  F  S+CNKK+IGAR+
Sbjct  128  ASEYGNDVIIGFVDTGIWPESASFHDNGIPAIPSRWKGSCVSGGDFNASLCNKKIIGARF  187

Query  628  FNKGLLAKNPN  660
            +++GL+A NP 
Sbjct  188  YHRGLVANNPK  198



>gb|KCW54937.1| hypothetical protein EUGRSUZ_I00910, partial [Eucalyptus grandis]
Length=747

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 136/191 (71%), Gaps = 8/191 (4%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------  267
            L F+   FL       +SETYIVHMD   MP+ F+  +SW+ ATLSSIS  G        
Sbjct  8    LCFVILQFLPSCWSQTKSETYIVHMDTLSMPKVFSDQRSWYLATLSSISEGGATSTPLDK  67

Query  268  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  447
            LVY Y++++ GFSA LS  ELE++K+SP Y+ ST+D  +K+ T+HTP FLGL+S  GAWP
Sbjct  68   LVYTYSSSVQGFSATLSRPELESLKRSPHYVSSTRDRPLKLHTTHTPSFLGLNSVSGAWP  127

Query  448  ATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARY  627
            A++YG DVIIG +DTG+WPES SF D+G+  IP+RWKG C SG  F  S+CNKK+IGAR+
Sbjct  128  ASEYGNDVIIGFVDTGIWPESASFHDNGIPAIPSRWKGSCVSGGDFNASLCNKKIIGARF  187

Query  628  FNKGLLAKNPN  660
            +++GL+A NP 
Sbjct  188  YHRGLVANNPK  198



>gb|KEH42928.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 145/203 (71%), Gaps = 21/203 (10%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---------  252
            LF ++ F+   F+ +     Q + YI+HM+LS MP+AF++H +W+ +TLSS         
Sbjct  10   LFSYITFLHLIFITL----AQYDNYIIHMNLSAMPKAFSTHHTWYHSTLSSALENPQLTA  65

Query  253  -------ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
                   IS++ L+Y YT+ I+GFSA LSP E E++K +PGY+ S +D  +K+DT+H+P 
Sbjct  66   TNNLNSPISSK-LIYTYTHVINGFSANLSPKEHESLKNAPGYISSIRDLHMKMDTTHSPQ  124

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FLGL+ + GAW  + +G D+I+GVIDTGVWPES+SF DDGM +IP++WKG+C++   F  
Sbjct  125  FLGLNPNIGAWHDSKFGEDIIVGVIDTGVWPESESFKDDGMTKIPSKWKGQCENSIHFNS  184

Query  592  SMCNKKLIGARYFNKGLLAKNPN  660
            S+CNKKLIGA++FN+GLLAK PN
Sbjct  185  SLCNKKLIGAKFFNRGLLAKYPN  207



>emb|CAN60787.1| hypothetical protein VITISV_034533 [Vitis vinifera]
Length=763

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 138/202 (68%), Gaps = 14/202 (7%)
 Frame = +1

Query  91   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----  255
            HR     LA+I  T L   S  G+  TYI+HMD S MP+AF +H  W+++T+ S+     
Sbjct  8    HRLYLIFLAWILFT-LHFRSASGERSTYIIHMDKSLMPKAFATHHHWYASTVDSLMTAAS  66

Query  256  -------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKS-PGYLYSTKDASVKVDTSHTPG  411
                   S   L+Y Y + +HGFSAVLS  ELE +++S  G++ +  D++V +DT+HT  
Sbjct  67   TTSIAVQSTPKLIYIYDHVLHGFSAVLSKGELEKLRRSTAGFVSAYSDSTVTLDTTHTLE  126

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FL L+   G WPA+D+G+DVI+GVIDTGVWPES SF DDGM +IPARWKG C+ G +F  
Sbjct  127  FLKLNQISGLWPASDFGKDVIVGVIDTGVWPESASFKDDGMTQIPARWKGTCEEGQEFNS  186

Query  592  SMCNKKLIGARYFNKGLLAKNP  657
            SMCN+K+IGARYFNKG++A NP
Sbjct  187  SMCNRKMIGARYFNKGVIAANP  208



>ref|XP_002284869.3| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=778

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 138/202 (68%), Gaps = 14/202 (7%)
 Frame = +1

Query  91   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----  255
            HR     LA+I  T L   S  G+  TYI+HMD S MP+AF +H  W+++T+ S+     
Sbjct  23   HRLYLIFLAWILFT-LHFRSASGERSTYIIHMDKSLMPKAFATHHHWYASTVDSLMTAAS  81

Query  256  -------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKS-PGYLYSTKDASVKVDTSHTPG  411
                   S   L+Y Y + +HGFSAVLS  ELE +++S  G++ +  D++V +DT+HT  
Sbjct  82   TTSIAVQSTPKLIYIYDHVLHGFSAVLSKGELEKLRRSTAGFVSAYSDSTVTLDTTHTLE  141

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FL L+   G WPA+D+G+DVI+GVIDTGVWPES SF DDGM +IPARWKG C+ G +F  
Sbjct  142  FLKLNQISGLWPASDFGKDVIVGVIDTGVWPESASFKDDGMTQIPARWKGTCEEGQEFNS  201

Query  592  SMCNKKLIGARYFNKGLLAKNP  657
            SMCN+K+IGARYFNKG++A NP
Sbjct  202  SMCNRKMIGARYFNKGVIAANP  223



>gb|EYU36350.1| hypothetical protein MIMGU_mgv1a001799mg [Erythranthe guttata]
Length=757

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 132/194 (68%), Gaps = 13/194 (7%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------  267
            + F+   FL    + G+  +YIVHMD S MP+AF SH  W+S T++S+            
Sbjct  11   VVFLCTMFLS--HVLGERSSYIVHMDKSLMPKAFASHHHWYSFTINSLKKSSKSLHRHRK  68

Query  268  ---LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  438
               LVY Y NA HGFSAVLS  ELE++  SPG++ +  D +V +DT+HT  FL L+ D G
Sbjct  69   PLELVYTYDNAFHGFSAVLSEDELESLGNSPGFVSAYSDRNVTLDTTHTFEFLSLNPDAG  128

Query  439  AWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIG  618
             WPA+DYG+DVI+GVIDTGVWPES SF DDGM EIP +WKG CQ+G  F  S+CNKKL+G
Sbjct  129  LWPASDYGKDVIVGVIDTGVWPESLSFKDDGMTEIPTKWKGICQAGQDFNSSLCNKKLVG  188

Query  619  ARYFNKGLLAKNPN  660
             +YF+KG+ A NPN
Sbjct  189  VQYFSKGVGASNPN  202



>ref|XP_003529873.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=753

 Score =   214 bits (545),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 142/207 (69%), Gaps = 20/207 (10%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---  252
            MA H  L     +I+   L I ++  QS+ YI+HMD+S MP+AF+S  +W+ +TLSS   
Sbjct  2    MATHICLSLCFFYITTYHLAISTL-AQSDNYIIHMDISAMPKAFSSQHTWYLSTLSSALD  60

Query  253  -----------ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTS  399
                       + N  L+Y YTN I+GFSA LSP ELEA+K SPGY+ S +D   K DT+
Sbjct  61   NSKATSDNLNSVINSKLIYTYTNVINGFSANLSPKELEALKTSPGYVSSMRDLRAKRDTT  120

Query  400  HTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGT  579
            H+P FLGL+ + GAWP + +G+DVI+G +DTG+ PES+SF D+G+ +IP+RWKG+C+S  
Sbjct  121  HSPHFLGLNPNVGAWPVSQFGKDVIVGFVDTGISPESESFNDEGLTKIPSRWKGQCESTI  180

Query  580  QFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +     CN KLIGA++FNKGLLAK+PN
Sbjct  181  K-----CNNKLIGAKFFNKGLLAKHPN  202



>ref|XP_011017184.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=772

 Score =   214 bits (545),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 138/211 (65%), Gaps = 18/211 (9%)
 Frame = +1

Query  82   MANHRALFFHLAFISA-TFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  255
            MA    +  +  +IS  T L       Q+E YIVHMDL  MP+AF+    W+ + L+SI 
Sbjct  1    MATRDNVSLYKLWISVLTILPFTQTLSQTENYIVHMDLLVMPKAFSGQHQWYLSALASIF  60

Query  256  ----------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  387
                            ++  L+Y+YT+ I+GFSA L+P+ELE +K SPGY+ S KD  VK
Sbjct  61   DVSDSSTTRATAATLTASSKLLYSYTHVINGFSASLTPSELEVLKNSPGYISSIKDLPVK  120

Query  388  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGEC  567
             DT+ +  FLGL+    AW  ++YG  +IIG++DTGVWPES+S+ D GM EIP RWKGEC
Sbjct  121  HDTTRSSKFLGLTPQSLAWKVSNYGEGIIIGLVDTGVWPESQSYKDHGMSEIPKRWKGEC  180

Query  568  QSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            QSGTQF  SMCNKKLIGAR+FNKGL+AK PN
Sbjct  181  QSGTQFNSSMCNKKLIGARFFNKGLIAKYPN  211



>gb|EPS63009.1| subtilisin-like protease preproenzyme [Genlisea aurea]
Length=716

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 124/169 (73%), Gaps = 11/169 (7%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWFSATLSSISNRG-----------LVYAYTNAIHGFSAVLSPAEL  330
            MD S MP+ F++H  W+  TL+  ++             LVY+Y NAI+GF+A LSP+EL
Sbjct  1    MDTSAMPKPFSTHHDWYLNTLAVAADETISSSSSWASSRLVYSYGNAINGFAATLSPSEL  60

Query  331  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
            EA+++SPGYL S KD  V++DT+H+  FLGL SDHGAW  +D G DVI+GV+DTGVWPES
Sbjct  61   EAVRRSPGYLSSVKDREVQLDTTHSYRFLGLDSDHGAWSESDSGSDVIVGVVDTGVWPES  120

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            +SF DDGMGEIP RW G C+ G +F  S CN+KL+GARYFNKGLLA NP
Sbjct  121  RSFNDDGMGEIPRRWNGICEVGVRFNSSNCNRKLVGARYFNKGLLAGNP  169



>ref|XP_010320326.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=749

 Score =   214 bits (544),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 128/182 (70%), Gaps = 11/182 (6%)
 Frame = +1

Query  148  SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----------LVYAYTNAI  294
            S  G+  TYI+HMD SFMP+AFTSH+ W S+ L +++ +            ++Y+Y NA 
Sbjct  14   SASGKRTTYIIHMDKSFMPKAFTSHEQWHSSILETVNLKDTASKSSTKPTRILYSYDNAF  73

Query  295  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  474
            HGFSAV+S  EL+ ++K PG++    D  V +DT+HT  FLGL+ + G WPA+ YG DVI
Sbjct  74   HGFSAVMSEDELKVLEKLPGFVSVYADKMVTLDTTHTFEFLGLNPESGLWPASHYGEDVI  133

Query  475  IGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKN  654
            +GVIDTGVWPES+S+ DDGM EIP+RWKG C+ G  F  SMCN KLIG RYFNKG+ A N
Sbjct  134  VGVIDTGVWPESRSYKDDGMTEIPSRWKGICEPGQDFNASMCNNKLIGVRYFNKGVKAAN  193

Query  655  PN  660
            PN
Sbjct  194  PN  195



>gb|KJB58523.1| hypothetical protein B456_009G213500 [Gossypium raimondii]
Length=759

 Score =   214 bits (544),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 127/171 (74%), Gaps = 7/171 (4%)
 Frame = +1

Query  166  ETYIVHMDLSFMPRAFTSHQSWFSATLSSI-------SNRGLVYAYTNAIHGFSAVLSPA  324
             TYIVHMD SFMP+ F SH SW+S+ + S+       S+  L+Y+Y +  HGFSAVLS  
Sbjct  27   NTYIVHMDKSFMPKVFASHHSWYSSIVDSLKSTNIPQSSPSLIYSYDSGAHGFSAVLSGD  86

Query  325  ELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWP  504
            ELE +KKSPG++ +  D +V VDT+HTP FL L+S  G WPA++YG   IIGVIDTGVWP
Sbjct  87   ELETLKKSPGFVSAYLDRTVTVDTTHTPEFLSLNSYSGLWPASNYGEGTIIGVIDTGVWP  146

Query  505  ESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            ES+S+ DDGM  +P+RWKG+C+ G +F  S+CN KLIGA+YFNKG++A NP
Sbjct  147  ESESYKDDGMSPVPSRWKGKCEEGQEFNSSVCNSKLIGAKYFNKGVIAANP  197



>ref|XP_011029640.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 139/212 (66%), Gaps = 19/212 (9%)
 Frame = +1

Query  82   MANHRA-LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  255
            MA  R  L + L     T L       Q++ YIVHMDLS MP+ F+    W+ +TL+S+ 
Sbjct  1    MATRREFLLYKLWICLITVLHFTGTLSQTDNYIVHMDLSAMPKPFSDQHHWYLSTLASVF  60

Query  256  -----------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASV  384
                             ++  L+Y+YT+ ++GFSA L+P+ELEA+KKSPGY+ S KD  V
Sbjct  61   DVSDSSTARASPATYLTTSSELLYSYTHVLNGFSASLTPSELEALKKSPGYISSIKDLPV  120

Query  385  KVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGE  564
            K DT+H+  FLGL+    AW A++ G  +IIG++D+GVWPES+S+ D GM EIP RWKG 
Sbjct  121  KHDTTHSTKFLGLAPQSPAWKASNLGDGIIIGLVDSGVWPESESYNDHGMSEIPKRWKGG  180

Query  565  CQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            CQSG QF  SMCNKKLIGAR+FNKGL+A NP+
Sbjct  181  CQSGAQFNSSMCNKKLIGARFFNKGLIANNPD  212



>emb|CDP17236.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 131/194 (68%), Gaps = 9/194 (5%)
 Frame = +1

Query  103  FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL----  270
            F  L +    F     +  +  TYIVHMD S MP+AF+ H  W+S+T+ ++ +       
Sbjct  12   FLVLTWFLVPFHASLVVSAKRSTYIVHMDKSAMPKAFSGHHMWYSSTVDAVKSVSFDSLR  71

Query  271  -----VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  435
                 VY+Y N +HGFSA+LS  ELEA+KKSPG+L +  D  V  DT+HT  FL L+  +
Sbjct  72   NGPKFVYSYDNVLHGFSALLSEDELEALKKSPGFLSAYTDKLVTTDTTHTYNFLSLNPTN  131

Query  436  GAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLI  615
            G WPA+D+G+DVI+GVIDTGVWPES S+ DDGM  IP++WKG C++G  F  S+CN KLI
Sbjct  132  GLWPASDFGKDVIVGVIDTGVWPESPSYKDDGMTPIPSKWKGTCEAGQDFNSSLCNLKLI  191

Query  616  GARYFNKGLLAKNP  657
            GARYFNKGL+A NP
Sbjct  192  GARYFNKGLVAANP  205



>ref|XP_010320327.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=757

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 128/179 (72%), Gaps = 11/179 (6%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATL-----------SSISNRGLVYAYTNAIHGF  303
             +  TYI+HMD SFMP+AFTSH+ W S+ L           SSI+   L+Y+Y NA HGF
Sbjct  25   AKRTTYIIHMDKSFMPKAFTSHEQWHSSILETVKLKDTTSGSSINPTRLLYSYDNAFHGF  84

Query  304  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  483
            SAV+S  EL+ ++K PG+  +  D  V +DT+HT  FLGLS + G WPA++YG DVI+GV
Sbjct  85   SAVMSEDELKVLEKLPGFASAYADKMVTLDTTHTFEFLGLSPESGLWPASEYGEDVIVGV  144

Query  484  IDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            IDTGVWPES+S+ DDGM EIP+RW+G C+ G +F+ SMCN KLIG +YFNKG+ A  PN
Sbjct  145  IDTGVWPESRSYMDDGMTEIPSRWRGICEPGQEFSASMCNNKLIGVQYFNKGVKAAYPN  203



>ref|XP_003548151.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=750

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 135/191 (71%), Gaps = 15/191 (8%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS----------NRG  267
            F   T  +  S   QSE YI+HMD+S MP+A++SH +W+ +TLSS            N  
Sbjct  12   FYITTLHRTISTLAQSENYIIHMDISAMPKAYSSHHTWYLSTLSSALENSKATTDNLNSK  71

Query  268  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  447
            L+Y YTN I+GFSA LSP ELEA+K SPGY+ S +D   K DT+H+P FLGL+ + GAWP
Sbjct  72   LIYIYTNVINGFSANLSPKELEALKTSPGYVSSMRDLRAKRDTTHSPQFLGLNKNVGAWP  131

Query  448  ATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARY  627
            A+ +G+D+I+G++DTG+ PESKS+ D+G+ +IP+RWKG+C+S  +     CN KLIGAR+
Sbjct  132  ASQFGKDIIVGLVDTGISPESKSYNDEGLTKIPSRWKGQCESSIK-----CNNKLIGARF  186

Query  628  FNKGLLAKNPN  660
            F KG LAK+PN
Sbjct  187  FIKGFLAKHPN  197



>ref|XP_010267360.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=772

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 11/184 (6%)
 Frame = +1

Query  142  IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----------RGLVYAYTN  288
            I S+  + + YIVHMDLS MP  F  H SW+ ATLSSI +             L+Y Y++
Sbjct  20   ITSLVAKPDVYIVHMDLSAMPTPFRDHHSWYEATLSSIKDGMAGVATTTKASNLIYTYSS  79

Query  289  AIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRD  468
            AIHGF+A LSP ELE +++SPG++ ST+D  +K  T+ TP FLGL+   GAWP ++YG D
Sbjct  80   AIHGFAARLSPLELELLEQSPGFVSSTRDVPLKAHTTRTPDFLGLNPSFGAWPVSNYGED  139

Query  469  VIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            VIIG++D+G+WPES SFGDDG+ E+P RWKGEC SGT F+ ++CN+KLIGAR+++KG++A
Sbjct  140  VIIGLVDSGIWPESASFGDDGLAEVPKRWKGECVSGTNFSSTLCNRKLIGARFYSKGIMA  199

Query  649  KNPN  660
              P+
Sbjct  200  YRPD  203



>ref|XP_002510194.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52381.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score =   211 bits (538),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 134/201 (67%), Gaps = 19/201 (9%)
 Frame = +1

Query  100  LFF--HLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL-  270
            LFF  H+ FI    L   S   +  TYIVHMD S MP+ FT+HQ W+++TL S+ +  L 
Sbjct  8    LFFAWHVFFI----LSATSTSVERATYIVHMDKSLMPKIFTTHQDWYTSTLISLQSTNLA  63

Query  271  ------------VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGF  414
                        +Y+Y N  HGFSAVLSP EL+A++  PG++ + KD  V VDT+HT  F
Sbjct  64   FSNNDLKLSPSFIYSYDNVAHGFSAVLSPEELQALRNYPGFVSAYKDKMVTVDTTHTHEF  123

Query  415  LGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPS  594
            L L+   G WPA+ +G +VIIGVID+GVWPES+S+ DDGM  IP+RWKG C+ G +F  S
Sbjct  124  LSLNPFTGLWPASSFGENVIIGVIDSGVWPESESYKDDGMTAIPSRWKGVCEEGDEFNSS  183

Query  595  MCNKKLIGARYFNKGLLAKNP  657
            MCN KLIGARYFNKG+ A NP
Sbjct  184  MCNSKLIGARYFNKGVKAANP  204



>gb|EYU19442.1| hypothetical protein MIMGU_mgv1a001731mg [Erythranthe guttata]
Length=768

 Score =   211 bits (537),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 128/183 (70%), Gaps = 15/183 (8%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG---------------LVYAYTNA  291
             +  TYIVHMD S+MP+AF+SH  W+S+ L   + +                L+Y Y NA
Sbjct  25   AKRSTYIVHMDKSYMPKAFSSHHHWYSSILLHSTAKSSLPNNNKVNNKVKTNLIYTYDNA  84

Query  292  IHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDV  471
             HGFSAV+S +ELEA+KKSPG++ S  D  +  DT+H+  FL L++  G WPA+DYG+DV
Sbjct  85   FHGFSAVMSESELEALKKSPGFISSYPDDVITADTTHSTQFLSLNTAAGLWPASDYGKDV  144

Query  472  IIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAK  651
            IIGVIDTG+WPES+SF D GM EIP RWKG CQ+G +F  S CNKK+IGARYFN+G  A+
Sbjct  145  IIGVIDTGIWPESRSFSDTGMTEIPPRWKGICQTGQEFNSSSCNKKIIGARYFNQGYRAE  204

Query  652  NPN  660
            +P+
Sbjct  205  SPD  207



>ref|XP_009797476.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=766

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 131/200 (66%), Gaps = 15/200 (8%)
 Frame = +1

Query  103  FFHLAFIS---ATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------  255
            +FHL F+S   +  +       Q  TYIVH+D S MP  F  H  W S+T+ SI      
Sbjct  5    YFHLLFLSWFLSALVFCLLATAQRSTYIVHLDKSLMPNIFADHHHWHSSTIDSIKAAVPS  64

Query  256  ------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  417
                  S   LVY+Y N  HGFSAVLS  EL+A+KKSPG++ + KD +V+  T+HT  FL
Sbjct  65   SVDRFHSAPKLVYSYDNVFHGFSAVLSKDELQALKKSPGFVSAYKDRTVEPQTTHTSDFL  124

Query  418  GLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSM  597
             L+   G WPA+  G+DVIIGV+D+G+WPES SF DDGM EIP RWKG C+ GTQF  S+
Sbjct  125  KLNPSSGLWPASGLGQDVIIGVLDSGIWPESASFRDDGMPEIPKRWKGICKPGTQFNTSL  184

Query  598  CNKKLIGARYFNKGLLAKNP  657
            CN+KLIGA YFNKG+LA +P
Sbjct  185  CNRKLIGANYFNKGILANDP  204



>ref|XP_004229665.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 128/197 (65%), Gaps = 13/197 (7%)
 Frame = +1

Query  106  FHLAFIS-ATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---------  255
             HL  +S A F  +F    Q  TYIVH+D SFMP  F  H  W S+TL SI         
Sbjct  12   LHLVLLSWAFFAHLFLALAQRSTYIVHLDKSFMPNVFAHHHHWHSSTLDSIKAVVPSSVD  71

Query  256  ---SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  426
               S   LVY+Y N  HGFSA+LS  EL A++KSPG++ + KD +V+  T+HT  FL L+
Sbjct  72   RFHSAPKLVYSYDNVFHGFSAILSKHELAALRKSPGFISAYKDRTVEPHTTHTSDFLKLT  131

Query  427  SDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNK  606
               G W A+  G+DVIIGV+D G+WPES SF DDGM EIP RWKG C+ GTQF  SMCN+
Sbjct  132  PSSGLWQASGLGQDVIIGVLDGGIWPESASFRDDGMPEIPKRWKGICKPGTQFNTSMCNR  191

Query  607  KLIGARYFNKGLLAKNP  657
            KLIGA YFNKG+LA NP
Sbjct  192  KLIGANYFNKGILANNP  208



>ref|XP_009608285.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 128/182 (70%), Gaps = 12/182 (7%)
 Frame = +1

Query  151  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS------------NRGLVYAYTNAI  294
            I  Q  TYIVH+D SFMP+ F SHQ+W S+ + +I                L+Y+Y N I
Sbjct  23   ISAQRSTYIVHLDKSFMPKIFASHQNWHSSIIDTIKIDVPTTPNNHHLTPKLLYSYDNVI  82

Query  295  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  474
            HGFSAVLS  ELEA+KKSPG+L + KD +V+  T++T  FL L+   G WPA+ +G+D+I
Sbjct  83   HGFSAVLSKDELEALKKSPGFLSAYKDRTVEAHTTYTSEFLKLNPASGLWPASGFGQDII  142

Query  475  IGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKN  654
            IGV+D+G+WPES SF DDG+ EIP +WKG C+ G +F  S+CN+KLIGA YFNKGLLA N
Sbjct  143  IGVLDSGIWPESASFRDDGLSEIPKKWKGICKPGKEFNSSLCNRKLIGANYFNKGLLANN  202

Query  655  PN  660
            P+
Sbjct  203  PS  204



>ref|XP_008444560.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 129/184 (70%), Gaps = 17/184 (9%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----------------LVYAYTN  288
            ++  YIVHM+ + MP+ F S  SW+SAT+SS+ +                   L++ Y +
Sbjct  23   ETHNYIVHMNSAAMPKPFASRHSWYSATISSVLHSSSSSSSSSSSSSSSFPSKLIHTYNH  82

Query  289  AIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRD  468
            AI GF A L+P++LEA+K SPGYL S  D+SV VDT+H+  FLGLSS+HG  P + YG D
Sbjct  83   AISGFCASLTPSQLEALKNSPGYLSSVLDSSVHVDTTHSSHFLGLSSNHGLLPISKYGSD  142

Query  469  VIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            VIIG +DTG+WP+S+SF DDGM EIP+RWKGEC+S T F  S CN KLIGAR+FNKGL+A
Sbjct  143  VIIGFVDTGIWPDSESFNDDGMSEIPSRWKGECESSTHFNVSFCNNKLIGARFFNKGLIA  202

Query  649  KNPN  660
            + PN
Sbjct  203  QFPN  206



>ref|XP_007147252.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
 gb|ESW19246.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
Length=765

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 137/186 (74%), Gaps = 6/186 (3%)
 Frame = +1

Query  109  HLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----NRGLV  273
            H+    +    ++  + ++ TYIVHMD S+MP+ FTSH+ W+S+TL+S+      N  ++
Sbjct  15   HIIVALSMVCLVWQCNSKAVTYIVHMDKSYMPKVFTSHRHWYSSTLTSLDSTQHVNSSIL  74

Query  274  YAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPAT  453
            Y+Y NA+HGFS  LSP +LE++K++PG++ + +D +  +DT+ +  FL L+  HG WPA+
Sbjct  75   YSYENALHGFSVALSPQQLESLKETPGFISAYRDRATTLDTTASYAFLSLNISHGLWPAS  134

Query  454  DYGRDVIIGVIDTGVWPESKSFGDDGMG-EIPARWKGECQSGTQFTPSMCNKKLIGARYF  630
            +YG++V++GV+D+G+WPES SF DDGM  + P +WKG+C+ G +F PS+CN KL+GARYF
Sbjct  135  NYGQNVVVGVVDSGIWPESDSFKDDGMVIQTPPKWKGKCEGGQRFDPSLCNSKLVGARYF  194

Query  631  NKGLLA  648
            NKGLLA
Sbjct  195  NKGLLA  200



>ref|XP_009769987.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009769988.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
Length=765

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 12/182 (7%)
 Frame = +1

Query  151  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAI  294
            I  Q  TYIVH+D SFMP+ F SHQ+W S+ +++I                +VY+Y N I
Sbjct  22   ISAQRSTYIVHLDKSFMPKIFASHQNWHSSIINNIKIEVPTTPNDHHPVPKIVYSYDNVI  81

Query  295  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  474
            HGFSAVLS  ELEA+KKS G+L + KD +V+  T+HT  FL L+   G WPA+ +G+DVI
Sbjct  82   HGFSAVLSKDELEALKKSSGFLSAYKDRTVEAHTTHTSEFLKLNPASGLWPASGFGQDVI  141

Query  475  IGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKN  654
            IGV+D+G+WPES SF DDG+ EIP +WKG C+ GT+F  S+CN+KLIGA YFNKG+LA +
Sbjct  142  IGVLDSGIWPESASFRDDGLSEIPKKWKGICKPGTEFNSSLCNRKLIGANYFNKGILADD  201

Query  655  PN  660
            P+
Sbjct  202  PS  203



>ref|XP_011074394.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=761

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 125/182 (69%), Gaps = 12/182 (7%)
 Frame = +1

Query  151  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAI  294
            +  +   YIVHMD S MP+AF+SH  W+S+ L S+ +              L+Y Y NA 
Sbjct  20   VSAERSVYIVHMDKSSMPKAFSSHHYWYSSMLKSVKSEPQASFNSLKAEPKLIYTYDNAF  79

Query  295  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  474
            HGFSA++S AELEA+KKSPG++ +  D  +  DT+H+  FL L++  G WPA+ YG+DVI
Sbjct  80   HGFSALVSKAELEALKKSPGFISAYSDHILTPDTTHSYKFLSLNTATGLWPASKYGKDVI  139

Query  475  IGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKN  654
            IGV+D+G+WPES SF DDGM EIPARWKG CQ G QF  S CNKK+IGARYFN G  A N
Sbjct  140  IGVVDSGIWPESPSFRDDGMTEIPARWKGICQEGEQFNSSSCNKKIIGARYFNNGFQAGN  199

Query  655  PN  660
            P+
Sbjct  200  PD  201



>gb|KEH18575.1| subtilisin-like serine protease [Medicago truncatula]
Length=762

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 143/210 (68%), Gaps = 19/210 (9%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSID-GQSETYIVHMDLSFMPRAFTSHQSWFSATLSS--  252
            M NH +    + F   TFL +  I   QS+ YI+HMD + MP+ FT+H +W+ +TLSS  
Sbjct  1    MTNHISQC--IVFSCITFLHLLFITIAQSDNYIIHMDKAAMPKVFTTHHTWYLSTLSSAL  58

Query  253  --------------ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKV  390
                          + +  L+Y YT+ ++GFSA LSP E E++K SPGY+ S KD+ +K+
Sbjct  59   ENPQLTTSSNNLNSLFSSKLIYTYTHVMNGFSANLSPKEHESLKTSPGYISSIKDSHMKL  118

Query  391  DTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQ  570
            DT+H+P FLGL+ + GAW  +++G DVI+G+IDTG+WPES+SF D+ M EIP++W G+C+
Sbjct  119  DTTHSPQFLGLNPNKGAWHDSNFGNDVIVGLIDTGIWPESESFKDNLMSEIPSKWNGQCE  178

Query  571  SGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +   F  S+CNKKLIGA++FNKGL +K PN
Sbjct  179  NSILFNSSLCNKKLIGAKFFNKGLQSKYPN  208



>ref|XP_006345406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 127/197 (64%), Gaps = 13/197 (7%)
 Frame = +1

Query  106  FHLAFISATFL-QIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---------  255
             HL  +   FL  +F    Q  TYIVH+D SFMP  F  H  W S+TL SI         
Sbjct  12   LHLLLLPWAFLAHLFLALAQRSTYIVHLDKSFMPNVFAHHHHWHSSTLDSIKAVVPSSVD  71

Query  256  ---SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  426
               S   LVY+Y N  HGFSAVLS  EL A++KSPG++ + KD +V+  T+HT  FL L+
Sbjct  72   RFHSAPKLVYSYDNVFHGFSAVLSKDELAALRKSPGFISAYKDRTVEPHTTHTSDFLKLT  131

Query  427  SDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNK  606
               G W A+  G+DVIIGV+D G+WPES SF DDGM EIP RWKG C+ GTQF  SMCN+
Sbjct  132  PSSGLWQASGLGQDVIIGVLDGGIWPESASFRDDGMPEIPKRWKGICKPGTQFNTSMCNR  191

Query  607  KLIGARYFNKGLLAKNP  657
            KLIGA YFNKG+LA NP
Sbjct  192  KLIGANYFNKGILANNP  208



>ref|XP_011464036.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=474

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 132/195 (68%), Gaps = 14/195 (7%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN------------  261
             +  + L   ++   S TYI+HMD S MP+AF  HQ W+ ATLSS+S             
Sbjct  7    LVLCSILFSITVSAISHTYIIHMDSSAMPKAFLDHQKWYLATLSSLSEGLLEADEATSSA  66

Query  262  --RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  435
                L+Y YTNAI GFSA L+ +ELE++K SPG++   +D  +K+ T+ +  F GL+   
Sbjct  67   SITKLIYTYTNAIQGFSATLTLSELESLKSSPGFISYIRDRPLKLHTTRSSQFHGLTPLS  126

Query  436  GAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLI  615
            GAWPA++YG +V IGVIDTGVWPES+SF D+GM  IP++WKG+C+SGTQ   S+CNKKLI
Sbjct  127  GAWPASNYGENVTIGVIDTGVWPESESFNDEGMTPIPSKWKGKCESGTQSNSSLCNKKLI  186

Query  616  GARYFNKGLLAKNPN  660
            GAR + KG +A+NP+
Sbjct  187  GARIYYKGFIAENPD  201



>gb|KEH18574.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 133/191 (70%), Gaps = 7/191 (4%)
 Frame = +1

Query  109  HLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------L  270
            +L F   T L +     +SE YI+HMDLS MP+ F++  SW+ +TLS ++         +
Sbjct  8    NLLFPCITILHLIFTLARSENYIIHMDLSAMPKVFSNQHSWYESTLSKVTANNNLTSSKI  67

Query  271  VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPA  450
            +Y YTN ++GF A LSP E EA+K SPGY+ S  D  +K+ T+H+P FLGL+   GAWPA
Sbjct  68   IYTYTNVMNGFCANLSPKEHEALKTSPGYISSIPDLPLKLHTTHSPQFLGLNPFEGAWPA  127

Query  451  TDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGE-CQSGTQFTPSMCNKKLIGARY  627
            + +G+DVIIG+ID+GVWPES+SF D+GM +IP++WKG+ CQ       S CNKKLIGAR+
Sbjct  128  SKFGQDVIIGLIDSGVWPESESFNDNGMTKIPSKWKGKLCQFENSNNSSFCNKKLIGARF  187

Query  628  FNKGLLAKNPN  660
            FNKGL AKN N
Sbjct  188  FNKGLSAKNSN  198



>emb|CAA07059.1| SBT4B protein [Solanum lycopersicum]
Length=777

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 127/197 (64%), Gaps = 13/197 (7%)
 Frame = +1

Query  103  FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---------  255
            F HL F+S       +I  Q  TYIVH+D S MP  FT H  W S+T+ SI         
Sbjct  10   FLHLLFLSTHMFCFLTI-AQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSVD  68

Query  256  ---SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  426
               S   LVY+Y N  HGFSAVLS  EL A+KK PG++ + +D +V+  T+HT  FL L+
Sbjct  69   RFHSAPKLVYSYDNVFHGFSAVLSQNELAALKKLPGFVSAYEDRTVEPHTTHTSDFLKLN  128

Query  427  SDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNK  606
               G WPA+  G+DVII V+D G+WPES SF DDGM EIP RWKG C+ GTQF  SMCN+
Sbjct  129  PSSGLWPASGLGQDVIIAVLDGGIWPESASFQDDGMPEIPKRWKGICRPGTQFNTSMCNR  188

Query  607  KLIGARYFNKGLLAKNP  657
            KLIGA YFNKG+LA +P
Sbjct  189  KLIGANYFNKGILADDP  205



>ref|XP_011074591.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   208 bits (530),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 127/180 (71%), Gaps = 12/180 (7%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHG  300
            G+  +YIVHMD SFMP+AF SH  W+S T+ S+ +              LVY Y N  HG
Sbjct  26   GERSSYIVHMDKSFMPKAFASHNHWYSFTIKSLKSVSSKSLDHHRKPLKLVYTYDNVFHG  85

Query  301  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  480
            FSA+LS  ELEA+KKSPG++ +  D +V +DT+HT  FL L+   G WPA++YG+ VI+G
Sbjct  86   FSALLSNDELEALKKSPGFVSAYSDRNVTLDTTHTFEFLSLNPVTGLWPASEYGKGVIVG  145

Query  481  VIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            VIDTGVWPES SF DDGM E+P+ WKG C++G +F  S+CN+KLIG RYFNKG+ A NPN
Sbjct  146  VIDTGVWPESLSFNDDGMTEVPSWWKGTCEAGQEFNSSLCNRKLIGVRYFNKGVKAANPN  205



>emb|CAA07062.1| SBT4E protein [Solanum lycopersicum]
Length=777

 Score =   208 bits (530),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 132/198 (67%), Gaps = 13/198 (7%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-------  258
            LFF   F+SA  L   +I  Q  TYIVH+D S MP  FT H  W S+T+ SI        
Sbjct  9    LFFLSWFLSAHLLCYLAI-AQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSL  67

Query  259  NR-----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
            NR      LVY+Y +  HGFSAVLS  EL+A+KKSPG++ + KD +V+ DT++T  +L L
Sbjct  68   NRFHSVPKLVYSYDHVFHGFSAVLSKDELKALKKSPGFISAYKDRTVEPDTTYTSDYLKL  127

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +   G WPA+  G+DVIIGV+D G+WPES SF DDG+ EIP RW G C  GTQF  SMCN
Sbjct  128  NPSSGLWPASGLGQDVIIGVLDGGIWPESASFRDDGIPEIPKRWTGICNPGTQFNTSMCN  187

Query  604  KKLIGARYFNKGLLAKNP  657
            +KLIGA YFNKGLLA +P
Sbjct  188  RKLIGANYFNKGLLADDP  205



>ref|NP_001234780.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA06998.1| subtilisin-like protease [Solanum lycopersicum]
Length=779

 Score =   208 bits (530),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 133/199 (67%), Gaps = 16/199 (8%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  255
            + F  A  +  +L I     Q  TYIVH+D S MP  FT H  W S+T+ SI        
Sbjct  15   VLFSWALSAHLYLAI----AQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSV  70

Query  256  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                S   LVY+Y +  HGFSAVLS  EL A+KKSPG++ + KD +V+ DT++T G+L L
Sbjct  71   DRFHSAPKLVYSYDHVFHGFSAVLSKDELAALKKSPGFISAYKDRTVEPDTTYTFGYLKL  130

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +  +G WPA+  G+D+IIGV+D+G+WPES SF DDG+ EIP RWKG C  GTQF  SMCN
Sbjct  131  NPSYGLWPASGLGQDMIIGVLDSGIWPESASFQDDGIPEIPKRWKGICNPGTQFNTSMCN  190

Query  604  KKLIGARYFNKGLLAKNPN  660
            +KLIGA YFNKGLLA++PN
Sbjct  191  RKLIGANYFNKGLLAEDPN  209



>gb|EYU36340.1| hypothetical protein MIMGU_mgv1a001790mg [Erythranthe guttata]
Length=759

 Score =   208 bits (529),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 128/185 (69%), Gaps = 5/185 (3%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----SNRGLVYAY  282
             + + FL    +  +  TYIVH+D S MP+AF+SH  W+S+ L S+     S   ++Y Y
Sbjct  11   ILVSIFLLAGDVLAERSTYIVHVDKSSMPKAFSSHHHWYSSMLKSVKSIDESESKIIYTY  70

Query  283  TNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYG  462
             NA HGFSAV++  ELEA+KKSPG+L + +D  V  DT+H+  FL L++  G WPA++YG
Sbjct  71   DNAFHGFSAVMNKHELEALKKSPGFLSAFEDGVVTADTTHSYKFLSLNTATGLWPASNYG  130

Query  463  RDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGL  642
            +DVIIG++DTG+WPES SF D+GM  IPA+WKG CQ G  F  S+CNKKLIG RYFN+G 
Sbjct  131  KDVIIGILDTGIWPESPSFRDEGMTAIPAKWKGSCQGGQDFNSSLCNKKLIGVRYFNQGT  190

Query  643  LAKNP  657
             A  P
Sbjct  191  RAAQP  195



>ref|XP_007047286.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOX91443.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=767

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 130/178 (73%), Gaps = 11/178 (6%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----------RGLVYAYTNAIHGF  303
             +S TYI+HMD S MP+AF+SH SW+ + LSSI +              +Y YT++I+GF
Sbjct  31   AKSGTYIIHMDSSAMPKAFSSHHSWYLSMLSSILDPSEAAAASTTISKHLYTYTDSINGF  90

Query  304  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  483
            SA L+ +ELEA+K S GY+  T+D  + V T+HT  FLGLSS  GAW A + G DVIIG+
Sbjct  91   SASLTSSELEALKNSFGYISFTRDLPLTVHTTHTSQFLGLSSVSGAWTAPNNGEDVIIGI  150

Query  484  IDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            +DTG+WPES+SF D+GM ++P RWKG+C+SGT+F  S CNKKLIGAR++NKGLLA NP
Sbjct  151  VDTGIWPESESFSDEGMNKVPPRWKGKCESGTEFNSSFCNKKLIGARFYNKGLLANNP  208



>gb|EYU36336.1| hypothetical protein MIMGU_mgv1a019012mg, partial [Erythranthe 
guttata]
Length=733

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 121/168 (72%), Gaps = 5/168 (3%)
 Frame = +1

Query  169  TYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----RGLVYAYTNAIHGFSAVLSPAELE  333
            TYIVHMD   MP+AF+SH  W+S+ L S  +       ++Y Y NA HGFSAVLS  ELE
Sbjct  3    TYIVHMDKFSMPKAFSSHHHWYSSMLKSAKSLDEPESKIIYTYDNAFHGFSAVLSEDELE  62

Query  334  AIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESK  513
            A+KKS G+L + +D  V  DT+H+  FL L+S  G WPA++YG+DVIIGVIDTG+WPES 
Sbjct  63   AVKKSQGFLSAFEDGVVTADTTHSSKFLSLNSATGLWPASNYGKDVIIGVIDTGIWPESP  122

Query  514  SFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            SF DDGM EIP RWKG C+ G +F  S CN+K+IGARYF +GL A NP
Sbjct  123  SFRDDGMTEIPTRWKGICEEGEEFNSSSCNRKIIGARYFREGLRAANP  170



>ref|NP_001234774.1| subtilisin-like protease precursor [Solanum lycopersicum]
 emb|CAA06997.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA07001.1| subtilisin-like protease [Solanum lycopersicum]
Length=761

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 127/198 (64%), Gaps = 13/198 (7%)
 Frame = +1

Query  103  FFHLAFIS-ATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  255
              HL   S A    +F    Q  TYIVH+D S MP  FT H  W S+T+ SI        
Sbjct  3    LLHLLLFSWALSAHLFLALAQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSV  62

Query  256  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                S   LVY+Y N +HGFSAVLS  EL A+KK PG++ + KD +V+  T+HT  FL L
Sbjct  63   DRFHSAPKLVYSYDNVLHGFSAVLSKDELAALKKLPGFISAYKDRTVEPHTTHTSDFLKL  122

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +   G WPA+  G+DVI+ V+D+G+WPES SF DDGM EIP RWKG C+ GTQF  SMCN
Sbjct  123  NPSSGLWPASGLGQDVIVAVLDSGIWPESASFQDDGMPEIPKRWKGICKPGTQFNASMCN  182

Query  604  KKLIGARYFNKGLLAKNP  657
            +KLIGA YFNKG+LA +P
Sbjct  183  RKLIGANYFNKGILANDP  200



>gb|KJB43733.1| hypothetical protein B456_007G214100 [Gossypium raimondii]
Length=758

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 138/193 (72%), Gaps = 16/193 (8%)
 Frame = +1

Query  127  ATFLQIFSID----GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL--------  270
            +T L I SI      + +TYI+HMD S MP+AF+SH SW+ + LSSIS+           
Sbjct  8    STVLFIVSIHPFTRAKPDTYIIHMDPSAMPKAFSSHHSWYFSMLSSISDTSEAASASSTV  67

Query  271  ----VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  438
                +Y YT++I+GFSA L+ +ELE++KKS GYL  T+D  + V T+HT  FLGL+S  G
Sbjct  68   TSKHLYTYTHSINGFSATLTLSELESLKKSFGYLSFTRDRPLTVHTTHTSQFLGLNSVSG  127

Query  439  AWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIG  618
            AW A +YG DVIIG++D+G+WPES+S+ D+GM ++P RWKG+C+SGT F  S CNKKLIG
Sbjct  128  AWTAPNYGEDVIIGIVDSGIWPESESYSDEGMAQVPTRWKGKCESGTNFNSSFCNKKLIG  187

Query  619  ARYFNKGLLAKNP  657
            AR++NKGLL+ +P
Sbjct  188  ARFYNKGLLSSHP  200



>ref|XP_009769989.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=771

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 127/182 (70%), Gaps = 12/182 (7%)
 Frame = +1

Query  151  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS------------NRGLVYAYTNAI  294
            I  Q  TYIVH+D SFMP  F SHQ+W S+ + +I                L+Y+Y N I
Sbjct  23   ISAQRSTYIVHLDKSFMPTIFASHQNWHSSIIDAIKIDVSTTPNDHHLTPKLLYSYDNVI  82

Query  295  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  474
            HGFSAVLS  ELEA+KKS G+L + KD +V+  T+HT  FL L+   G WPA+ +G+DVI
Sbjct  83   HGFSAVLSKDELEALKKSSGFLSAYKDRTVEAHTTHTSEFLKLNPASGLWPASGFGQDVI  142

Query  475  IGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKN  654
            IGV+D+G+WPES SF DDG+ EIP +WKG C+ GT+F  S+CN+KLIGA YFNKG+LA +
Sbjct  143  IGVLDSGIWPESASFRDDGLSEIPKKWKGICKPGTEFNSSLCNRKLIGANYFNKGILADD  202

Query  655  PN  660
            P+
Sbjct  203  PS  204



>ref|XP_006345401.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=761

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 127/198 (64%), Gaps = 16/198 (8%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  255
            L F  A  +  FL I     Q  TYIVH D S MP  FT H  W S+T+ SI        
Sbjct  7    LLFSWALSAHLFLAI----AQRSTYIVHFDKSLMPNVFTDHHHWHSSTIDSIKASVPSSV  62

Query  256  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                S   LVY+Y N +HGFSAVLS  EL A+KK PG++ + KD +V+  T+HT  FL L
Sbjct  63   DRFHSAPKLVYSYDNVLHGFSAVLSKDELAALKKLPGFISAYKDRTVEPHTTHTSDFLKL  122

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +   G WPA+  G+DVI+ V+D+G+WPES SF DDGM EIP RWKG C+ GTQF  SMCN
Sbjct  123  NPSSGLWPASGLGQDVIVAVLDSGIWPESASFQDDGMPEIPKRWKGICKPGTQFNASMCN  182

Query  604  KKLIGARYFNKGLLAKNP  657
            +KLIGA YFNKG+LA +P
Sbjct  183  RKLIGANYFNKGILANDP  200



>ref|XP_009343011.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 132/199 (66%), Gaps = 13/199 (7%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  267
              F L  +    LQ+        TYIVHMD S MP+++TSH  W+S+ + S  +      
Sbjct  11   FIFSLVALFLLALQVNVSFADRSTYIVHMDKSLMPKSYTSHDHWYSSIVDSFKSENPTSF  70

Query  268  --------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                    ++Y Y NA HGFSAVLSP EL  +KKSPG++ +  D S+ +DT+HT  FL L
Sbjct  71   DGNKIWPSILYTYDNAFHGFSAVLSPDELVTLKKSPGFVSAYADKSITLDTTHTTQFLNL  130

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSMC  600
            +   G WPA+DYG D+IIGVIDTG+WPES+SF D+GM + +PARWKG+C+ G +F  S+C
Sbjct  131  NPFAGLWPASDYGDDIIIGVIDTGLWPESESFRDEGMTKSLPARWKGKCEVGQEFNASLC  190

Query  601  NKKLIGARYFNKGLLAKNP  657
            N KLIGARYFNKG++A NP
Sbjct  191  NYKLIGARYFNKGVMAANP  209



>ref|XP_004249504.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 123/181 (68%), Gaps = 12/181 (7%)
 Frame = +1

Query  151  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAI  294
            I  +  TYIVH+D SFMP+ F +HQ+W S  + +I                L+Y+Y N  
Sbjct  20   ISAERSTYIVHLDKSFMPKIFATHQNWHSYIIDTIKIEAPTTQNTHHPLPKLLYSYDNVF  79

Query  295  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  474
            HGFSAVLS  ELEA+KKSPG+L + KD  V+  T+H+P FL L+   G WPA+ +G DVI
Sbjct  80   HGFSAVLSKDELEALKKSPGFLSAYKDRPVEAHTTHSPEFLKLNPASGLWPASGFGEDVI  139

Query  475  IGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKN  654
            IGV+DTGVWPES SF DDG+  IP +WKG C+ GT F  S+CN+KLIGA YFNKGLLA +
Sbjct  140  IGVLDTGVWPESASFRDDGLSAIPKKWKGICKPGTDFNSSLCNRKLIGANYFNKGLLASD  199

Query  655  P  657
            P
Sbjct  200  P  200



>gb|ACA64703.1| subtilase [Nicotiana tabacum]
Length=766

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 133/201 (66%), Gaps = 17/201 (8%)
 Frame = +1

Query  103  FFHLAFISATFL--QIFSI--DGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----  255
            +FHL F+S  FL   +F +    Q  TYIVH+D S MP  F  H  W S+T+ SI     
Sbjct  5    YFHLLFLS-WFLSAHVFCLLATAQRSTYIVHLDKSLMPNIFADHHHWHSSTIDSIKAAVP  63

Query  256  -------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGF  414
                   S   LVY+Y    HGFSAVLS  ELEA+KK PG++ + KD +V+  T+HT  F
Sbjct  64   SSVDRFHSAPKLVYSYDYVFHGFSAVLSQDELEALKKLPGFVSAYKDRTVEPQTTHTSDF  123

Query  415  LGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPS  594
            L L+   G WPA+  G+DVIIGV+D+G+WPES SF DDGM E+P RWKG C+SGTQF  S
Sbjct  124  LKLNPSSGLWPASGLGQDVIIGVLDSGIWPESASFRDDGMPEVPKRWKGICKSGTQFNTS  183

Query  595  MCNKKLIGARYFNKGLLAKNP  657
            +CN+KLIGA YFNKG+LA +P
Sbjct  184  LCNRKLIGANYFNKGILANDP  204



>ref|XP_009621569.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 133/201 (66%), Gaps = 17/201 (8%)
 Frame = +1

Query  103  FFHLAFISATFL--QIFSI--DGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----  255
            +FHL F+S  FL   +F +    Q  TYIVH+D S MP  F  H  W S+T+ SI     
Sbjct  5    YFHLLFLS-WFLSAHVFCLLATAQRSTYIVHLDKSLMPNIFADHHHWHSSTIDSIKAAVP  63

Query  256  -------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGF  414
                   S   LVY+Y    HGFSAVLS  ELEA+KK PG++ + KD +V+  T+HT  F
Sbjct  64   SSVDRFHSAPKLVYSYDYVFHGFSAVLSQDELEALKKLPGFVSAYKDRTVEPQTTHTSDF  123

Query  415  LGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPS  594
            L L+   G WPA+  G+DVIIGV+D+G+WPES SF DDGM E+P RWKG C+SGTQF  S
Sbjct  124  LKLNPSSGLWPASGLGQDVIIGVLDSGIWPESASFRDDGMPEVPKRWKGICKSGTQFNTS  183

Query  595  MCNKKLIGARYFNKGLLAKNP  657
            +CN+KLIGA YFNKG+LA +P
Sbjct  184  LCNRKLIGANYFNKGILANDP  204



>ref|XP_004514927.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=762

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 146/212 (69%), Gaps = 24/212 (11%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQ-IFSI-DGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS-  252
            MA H  ++  + F   TFL  IF++ D QS+ YI+HMDLS MP+ F++  +W+ +TLSS 
Sbjct  1    MATH--IYLSIFFSYVTFLHLIFTLADDQSDNYIIHMDLSAMPKPFSTQHTWYLSTLSSA  58

Query  253  ----------------ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASV  384
                            IS++ L+Y YT+ ++GFSA LSP E E +K SPGY+ S +D   
Sbjct  59   LENPLELSTNNLNQSLISSK-LIYTYTHVMNGFSASLSPKEHETLKNSPGYISSIRDLHA  117

Query  385  KVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGE  564
            K+DT+H+P FLGL+   GAW  + +G+DVI+G++DTGVWPES+SF D+GM EIP+ WKG+
Sbjct  118  KLDTTHSPEFLGLNPYKGAWHDSKFGKDVIVGLVDTGVWPESESFNDNGMTEIPSHWKGK  177

Query  565  CQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            C+   +   S+CNKKLIGAR+FNKGLL+K PN
Sbjct  178  CEFEKK--TSLCNKKLIGARFFNKGLLSKYPN  207



>ref|XP_010484555.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=737

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 126/171 (74%), Gaps = 6/171 (4%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---SNRGLVYAYTNAIHGFSAVLSPAE  327
             ++ TYI+HMDLS  P  F  HQSWFS TL+S+    N  ++YAYT+++HGFSAVL+ +E
Sbjct  20   AETSTYIIHMDLSAKPLPFPDHQSWFSTTLTSVITDRNPKIIYAYTDSVHGFSAVLTNSE  79

Query  328  LEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPE  507
            L+ +K  PGY+  TKD  VK+ T+ +P F+GL+S  G WP ++YG   +IG+IDTG+WP+
Sbjct  80   LQRLKHKPGYVSFTKDLPVKLHTTFSPQFIGLNSTSGTWPVSNYGAGTVIGIIDTGIWPD  139

Query  508  SKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            S SF DDG+G +P++WKGECQ  +    S+CNKKLIGAR FNKGL A NP+
Sbjct  140  SPSFHDDGLGSVPSKWKGECQFNSS---SLCNKKLIGARLFNKGLFANNPD  187



>ref|XP_007207210.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
 gb|EMJ08409.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
Length=739

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 124/180 (69%), Gaps = 13/180 (7%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHG  300
             +  TYIVHMD S MP+++ SHQ W+S+ + S   +             L+Y Y NA HG
Sbjct  5    AERSTYIVHMDKSLMPKSYASHQHWYSSIVDSFKAQIPTSSDGHKISPSLLYTYDNAFHG  64

Query  301  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  480
            FSAVLS  ELE +K SPG++ +  D S+ +DT+HT  FL L+   G WPA++YG D+IIG
Sbjct  65   FSAVLSAEELETLKNSPGFVSAYSDKSITLDTTHTTQFLSLNPSTGLWPASNYGEDIIIG  124

Query  481  VIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            VIDTGVWPESKSF DDGM  ++PARWKG C+ G +F  S+C  KLIGARYFNKG++A NP
Sbjct  125  VIDTGVWPESKSFRDDGMTKKLPARWKGTCEVGQEFNSSLCTFKLIGARYFNKGVMAANP  184



>emb|CDP01315.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 131/198 (66%), Gaps = 12/198 (6%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG---  267
            +  F + F+S++   I     +   YIVH+D S MP+ F SH  W+++ + SI N G   
Sbjct  8    SFLFLVWFLSSS--HILGALAERSIYIVHIDKSLMPKVFASHIYWYTSMIDSIGNVGQTS  65

Query  268  -------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  426
                   ++Y Y  A HGFSA++S   L+A+KKSPG++ +  D S  +DT+HTP FL L+
Sbjct  66   DHGFAPKILYTYDAAFHGFSALMSKDHLQALKKSPGFVSAHPDRSPTIDTTHTPDFLSLN  125

Query  427  SDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNK  606
            +  G WPA+DYG+DVIIGV+D G+WPE+ SF DDGM  IP RWKG CQ G +F  S+CN 
Sbjct  126  TATGLWPASDYGKDVIIGVVDDGIWPENPSFKDDGMTPIPPRWKGSCQEGQEFNSSLCNL  185

Query  607  KLIGARYFNKGLLAKNPN  660
            KLIGA+YFNK +LA NPN
Sbjct  186  KLIGAKYFNKAVLAANPN  203



>ref|XP_011069661.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 121/179 (68%), Gaps = 12/179 (7%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHG  300
             +  TYIVHMD SFMP AF+SH  W+S+ L S  +              LVY Y NA HG
Sbjct  44   AERSTYIVHMDKSFMPLAFSSHHYWYSSVLQSAKSVAQTSLDRDNLEPKLVYTYDNAFHG  103

Query  301  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  480
            FSAV+S  ELEA++KSPG+L +  D  V  DT+HT  FL L++  G WPA+ YG+DVIIG
Sbjct  104  FSAVMSKPELEAVQKSPGFLSAYPDGVVIPDTTHTYKFLSLNTATGLWPASQYGKDVIIG  163

Query  481  VIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            V+DTGV PES SF DDGM  IPARW+G CQ G  F  S+CNKKLIG RYFN+G+ A NP
Sbjct  164  VVDTGVLPESLSFKDDGMTAIPARWRGICQEGEGFNSSLCNKKLIGVRYFNEGVRAANP  222



>ref|XP_011074393.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=767

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 125/180 (69%), Gaps = 12/180 (7%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SNRGLVYAYTNAIHG  300
             +   YIVH D S MP+AF+SH  W+S+ L S+            S   ++Y Y NA HG
Sbjct  26   AERSVYIVHTDKSSMPKAFSSHTYWYSSMLKSLKSVAQTSLEGQNSEPKIIYTYDNAFHG  85

Query  301  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  480
            FSAV++ AEL+A+KKSPG++ +  D  V  DT+H+  FL L++  G WPA++YG+DVIIG
Sbjct  86   FSAVMTKAELQALKKSPGFISAYADDVVTPDTTHSYKFLSLNTATGLWPASNYGKDVIIG  145

Query  481  VIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            VIDTG+WPES SF DDGM EIPARWKG CQ G QF  S CNKK+IGARYFN+G  A+ P+
Sbjct  146  VIDTGIWPESPSFRDDGMTEIPARWKGICQEGEQFNSSSCNKKIIGARYFNEGFRAQLPD  205



>gb|KDO79191.1| hypothetical protein CISIN_1g004824mg [Citrus sinensis]
Length=728

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 127/171 (74%), Gaps = 14/171 (8%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWF-------------SATLSSISNRGLVYAYTNAIHGFSAVLSPA  324
            MD S MP+A++S  +W+             +AT S+IS++ LVY Y N+IHGFSA L+ +
Sbjct  1    MDTSAMPKAYSSLYTWYLFMLCSVSESSKATATSSTISSK-LVYTYANSIHGFSATLTVS  59

Query  325  ELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWP  504
            ELE +KK PGY+ ST D  + V T+HT  FLGLSS  GAWPA++YG+ VIIG++DTG+WP
Sbjct  60   ELETLKKLPGYISSTPDRPLAVHTTHTSEFLGLSSLSGAWPASNYGKGVIIGLVDTGIWP  119

Query  505  ESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            ES+SF D+GM ++P RWKGEC SG QF  S+CNKKLIGAR+FNKGL+A NP
Sbjct  120  ESQSFSDEGMAKVPPRWKGECMSGVQFNSSLCNKKLIGARFFNKGLIANNP  170



>ref|XP_011069660.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=762

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 128/188 (68%), Gaps = 12/188 (6%)
 Frame = +1

Query  133  FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL------------VY  276
            FL       Q  TYIVHMD S MP+AF+    W+S+ L SI + GL            V+
Sbjct  15   FLLAHHASAQRSTYIVHMDKSSMPKAFSGGHHWYSSILGSIKSVGLKSSDGDQPGPKLVH  74

Query  277  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATD  456
            +Y NA HGFSAV+S  ELE+++KSPG L +  D  V  DT+HT  FLGL++  G WPA+ 
Sbjct  75   SYDNAFHGFSAVMSKDELESLRKSPGLLSAHVDRPVTPDTTHTYKFLGLNTASGIWPASQ  134

Query  457  YGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNK  636
            YG+DVIIGV+D+G+WPES SF D+GM E+PARW+G C  G  F  S+CNKK+IGAR+FN+
Sbjct  135  YGKDVIIGVVDSGIWPESPSFRDEGMTEVPARWRGACVVGQDFNSSLCNKKIIGARWFNQ  194

Query  637  GLLAKNPN  660
            G+LA NP+
Sbjct  195  GVLAANPD  202



>gb|KDP41714.1| hypothetical protein JCGZ_16121 [Jatropha curcas]
Length=724

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 122/159 (77%), Gaps = 8/159 (5%)
 Frame = +1

Query  199  MPRAFTSHQSWFSATLSSI--------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPG  354
            MP+AF++  SW  ATLSS+        SN  L+Y+YT+ ++GFSA LS +ELEA+K SPG
Sbjct  1    MPKAFSTQHSWHLATLSSVFADSKAASSNSKLLYSYTHVMNGFSAHLSSSELEALKNSPG  60

Query  355  YLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGM  534
            Y+ STKD  VK DT+ +P FLGL+S+ GAW  ++YG D+IIGV+DTGVWPES+SFGD GM
Sbjct  61   YISSTKDRPVKPDTTRSPTFLGLTSNSGAWKVSNYGEDIIIGVVDTGVWPESESFGDKGM  120

Query  535  GEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAK  651
             +IP RWKG C+SG QF  S CN KLIGAR+FNKGLLAK
Sbjct  121  PKIPKRWKGICESGQQFNSSSCNNKLIGARFFNKGLLAK  159



>ref|XP_010093626.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB54387.1| Subtilisin-like protease [Morus notabilis]
Length=724

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 122/165 (74%), Gaps = 7/165 (4%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWFSATLSSISNRG-------LVYAYTNAIHGFSAVLSPAELEAIK  342
            MD S MPRAF++HQSWF +T SS+S          L++ Y N+IHGFSA L+ +EL+A+K
Sbjct  1    MDKSAMPRAFSAHQSWFESTFSSVSENSQEPITSKLIHTYKNSIHGFSATLTLSELQALK  60

Query  343  KSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFG  522
             SPGY++ST D  +K  T+HT  FLGLS + G WPA+ YG  VIIGV+DTGVWPES+SF 
Sbjct  61   NSPGYIHSTPDRMLKPHTTHTSKFLGLSQNSGVWPASSYGEGVIIGVVDTGVWPESESFS  120

Query  523  DDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            D GM ++P+RWKG+C  G +F  S+CNKKLIGAR++NKGL A  P
Sbjct  121  DKGMTKVPSRWKGKCVPGEKFNSSLCNKKLIGARFYNKGLHANIP  165



>gb|EYU36342.1| hypothetical protein MIMGU_mgv1a001789mg [Erythranthe guttata]
Length=759

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 127/186 (68%), Gaps = 5/186 (3%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----SNRGLVYAY  282
             + + FL    +  +  TYIVHMD S MP+AF+SH  W+S+ L+S      S   ++Y Y
Sbjct  11   ILVSIFLLAGDVSAERSTYIVHMDKSSMPKAFSSHHHWYSSMLTSAKSLDESESKIIYTY  70

Query  283  TNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYG  462
             NA HGFS V++  ELEA+KK PG+L + +D  V  DT+H+  FL L++  G WPA++YG
Sbjct  71   DNAFHGFSVVMNKQELEALKKLPGFLSAFEDGVVTADTTHSYKFLSLNTASGLWPASNYG  130

Query  463  RDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGL  642
            +DVIIG++DTG+WPES SF D+GM  IPA+WKG CQ G  F  S+CNKKLIG RYFN+G 
Sbjct  131  KDVIIGILDTGIWPESPSFRDEGMTAIPAKWKGSCQGGQDFNSSLCNKKLIGVRYFNQGT  190

Query  643  LAKNPN  660
             A  P+
Sbjct  191  RAAFPD  196



>ref|XP_003590866.1| Subtilisin-like protease [Medicago truncatula]
Length=752

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 129/186 (69%), Gaps = 10/186 (5%)
 Frame = +1

Query  133  FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---------NRGLVYAYT  285
             L + + D  S TYIVHMD S MP+ FTSH +W+ +TL S +         ++ LVY Y 
Sbjct  21   LLPLHAKDETSSTYIVHMDKSLMPQVFTSHHNWYESTLHSTTTQSDDHVHPSKKLVYTYN  80

Query  286  NAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGR  465
            +A+HGFSAVLSP EL+ +KKS G++ +  D +  +DT+HT  FL L    G W A++ G 
Sbjct  81   HAMHGFSAVLSPKELDNLKKSHGFVTAYPDRTATIDTTHTFEFLSLDPSKGLWNASNLGE  140

Query  466  DVIIGVIDTGVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSMCNKKLIGARYFNKGL  642
            +VI+GVID+GVWPES+SF DDGM + IP +WKG+CQ+G  F  SMCN KLIGARYFNKG+
Sbjct  141  NVIVGVIDSGVWPESESFKDDGMSKNIPTKWKGKCQAGQDFNTSMCNLKLIGARYFNKGV  200

Query  643  LAKNPN  660
            +A  PN
Sbjct  201  IASKPN  206



>gb|AES61117.2| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 129/186 (69%), Gaps = 10/186 (5%)
 Frame = +1

Query  133  FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---------NRGLVYAYT  285
             L + + D  S TYIVHMD S MP+ FTSH +W+ +TL S +         ++ LVY Y 
Sbjct  21   LLPLHAKDETSSTYIVHMDKSLMPQVFTSHHNWYESTLHSTTTQSDDHVHPSKKLVYTYN  80

Query  286  NAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGR  465
            +A+HGFSAVLSP EL+ +KKS G++ +  D +  +DT+HT  FL L    G W A++ G 
Sbjct  81   HAMHGFSAVLSPKELDNLKKSHGFVTAYPDRTATIDTTHTFEFLSLDPSKGLWNASNLGE  140

Query  466  DVIIGVIDTGVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSMCNKKLIGARYFNKGL  642
            +VI+GVID+GVWPES+SF DDGM + IP +WKG+CQ+G  F  SMCN KLIGARYFNKG+
Sbjct  141  NVIVGVIDSGVWPESESFKDDGMSKNIPTKWKGKCQAGQDFNTSMCNLKLIGARYFNKGV  200

Query  643  LAKNPN  660
            +A  PN
Sbjct  201  IASKPN  206



>ref|XP_006345405.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=779

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 129/198 (65%), Gaps = 16/198 (8%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  255
            + F  A  +  FL I     Q  TYIVH+D S MP  FT H  W S+T+ SI        
Sbjct  15   VLFSWALSAHLFLAI----AQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSV  70

Query  256  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                S   LVY+Y +  HGFSAVLS  EL+A+KKSPG++ + KD +V+ DT++T  +L L
Sbjct  71   DRFHSAPKLVYSYDHVFHGFSAVLSKDELKALKKSPGFISAYKDRTVEPDTTYTSDYLKL  130

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +   G WPA+  G+DVIIGV+D G+WPES SF DDG+ EIP RWKG C  GTQF  SMCN
Sbjct  131  NPSSGLWPASGLGQDVIIGVLDGGIWPESASFRDDGIPEIPKRWKGICNPGTQFNTSMCN  190

Query  604  KKLIGARYFNKGLLAKNP  657
            +KLIGA YFNKGLLA +P
Sbjct  191  RKLIGANYFNKGLLADDP  208



>gb|EYU36339.1| hypothetical protein MIMGU_mgv1a001782mg [Erythranthe guttata]
Length=760

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 128/185 (69%), Gaps = 5/185 (3%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---ISNRGL--VYAY  282
             + + FL    +  +  TYIVHMD S MP+AF+SH  W+S+ L+S   +  RGL  +Y Y
Sbjct  12   ILVSIFLLADDVSAERSTYIVHMDKSSMPKAFSSHHHWYSSMLNSAKSLDERGLKIIYTY  71

Query  283  TNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYG  462
             NA HGFS V++  ELEA+KKSPG+L + +D +V   T+H+  FL L++  G WPA++YG
Sbjct  72   DNAFHGFSVVMNKHELEALKKSPGFLSAFEDGAVTAATTHSYKFLSLNTASGLWPASNYG  131

Query  463  RDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGL  642
            +DVIIG++D G+WPES SF D+GM  IPA+WKG CQ G  F  S+CNKKLIG RYFN+G 
Sbjct  132  KDVIIGILDGGIWPESPSFSDEGMTAIPAKWKGTCQGGQDFNSSLCNKKLIGVRYFNQGT  191

Query  643  LAKNP  657
             A  P
Sbjct  192  RAAFP  196



>ref|XP_006345494.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=754

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 128/193 (66%), Gaps = 13/193 (7%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----------  267
            F+ A F  +  I  +  TYIVH+D S MP  F SH  W S+T+ SI              
Sbjct  15   FLFAHFFCLVVI-AERSTYIVHLDKSLMPNMFASHHHWHSSTIESIKIVNPALLNSHHPV  73

Query  268  --LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGA  441
              L+Y+Y N  HGFSAVLS  ELEA+KKS G++ + KD SV+  T+HT  +L L+   G 
Sbjct  74   PKLLYSYDNVFHGFSAVLSKDELEALKKSTGFISAYKDRSVEAHTTHTSEYLKLNPSSGL  133

Query  442  WPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGA  621
            WPA+ +G+DV+IGV+D+GVWPES SF DDGM EIP +WKG C+ G +F  S+CNKKLIGA
Sbjct  134  WPASGFGQDVVIGVLDSGVWPESASFRDDGMPEIPKKWKGICRPGMEFNTSLCNKKLIGA  193

Query  622  RYFNKGLLAKNPN  660
             YFNKGLLA NP+
Sbjct  194  NYFNKGLLASNPD  206



>ref|XP_008370910.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=651

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 132/200 (66%), Gaps = 20/200 (10%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR----  264
            ALF     ++ +F           TYIVHMD S MP+++TSH  W+S+ + S  +     
Sbjct  17   ALFLLALHVNVSF-------ADRSTYIVHMDKSLMPKSYTSHDHWYSSIVDSFKSEYPTS  69

Query  265  --------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLG  420
                     ++Y Y NA HGFSAVLS  EL  +KKSPG++ +  D S+ +DT+HT  FL 
Sbjct  70   FDGNKILPSILYTYDNAFHGFSAVLSADELVTLKKSPGFVSAYADKSITLDTTHTTQFLN  129

Query  421  LSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSM  597
            L+   G WPA+DYG D+IIGVIDTG+WPES+SF D+GM + +PARWKG+C+ G +F  S+
Sbjct  130  LNPFAGLWPASDYGDDLIIGVIDTGLWPESESFRDEGMTKSLPARWKGKCEVGQEFNASL  189

Query  598  CNKKLIGARYFNKGLLAKNP  657
            CN KLIGARYFNKG++A NP
Sbjct  190  CNYKLIGARYFNKGVMAANP  209



>ref|XP_004249505.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=765

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 131/198 (66%), Gaps = 14/198 (7%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  267
            L F     S + L       +  TYIVH+D SFMP+ F +HQ+W S+ + +I        
Sbjct  7    LLFSWFLFSTSLL--LGTSAERSTYIVHLDKSFMPKIFATHQNWHSSIIDTIKIEAPTTQ  64

Query  268  --------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                    L+Y+Y N IHGFSAVLS  EL++++KS G+L + KD SV+  T+HT  FL L
Sbjct  65   NDYHPLPKLLYSYDNVIHGFSAVLSKDELKSLEKSAGFLSAYKDRSVESHTTHTSEFLKL  124

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +   G WPA+ +G+DVIIGV+D+GVWPES SF DDG+ EIP RWKG C++GT F  S+CN
Sbjct  125  NPASGLWPASGFGQDVIIGVLDSGVWPESASFSDDGLPEIPKRWKGICKAGTDFDSSLCN  184

Query  604  KKLIGARYFNKGLLAKNP  657
            +K+IGA YFNKG+LA NP
Sbjct  185  RKIIGANYFNKGILADNP  202



>gb|EYU36337.1| hypothetical protein MIMGU_mgv1a020902mg, partial [Erythranthe 
guttata]
Length=734

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 121/166 (73%), Gaps = 5/166 (3%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWFSATLS-----SISNRGLVYAYTNAIHGFSAVLSPA  324
            +  TYIVHMD S MP+AF+SH  W+S+ LS           L+Y Y NA HGFSAVLS  
Sbjct  1    KRSTYIVHMDKSSMPKAFSSHHHWYSSMLSFGKPLDEPESKLIYTYDNAFHGFSAVLSED  60

Query  325  ELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWP  504
            ELEA+KKSPG++ S  D  +   T+ +  FL L+S  G WPA++ G+DVIIGVIDTG+WP
Sbjct  61   ELEALKKSPGFISSYADDVITTHTTRSTQFLSLNSATGLWPASNSGKDVIIGVIDTGIWP  120

Query  505  ESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGL  642
            ES+SF D+GM E+P+RWKG CQ+G +F  S+CNKK+IGARYFN+G+
Sbjct  121  ESRSFSDEGMTEVPSRWKGICQAGQEFNSSLCNKKIIGARYFNRGM  166



>ref|XP_006339058.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 126/184 (68%), Gaps = 12/184 (7%)
 Frame = +1

Query  142  IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYT  285
            +     +  TYIVH+D SFMP+ F +HQ+W S+ + +I                L+Y+Y 
Sbjct  19   LLGTSAERSTYIVHLDKSFMPKIFATHQNWHSSIIDTIKIEAPTTQNGHHPVPKLLYSYD  78

Query  286  NAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGR  465
            N IHGFSAVLS  ELE ++KS G+L + KD SV+  T+HT  FL L+   G WPA+ +G+
Sbjct  79   NVIHGFSAVLSKHELELLEKSAGFLSAYKDRSVEAHTTHTSEFLKLNPASGLWPASGFGQ  138

Query  466  DVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLL  645
            DVIIGV+D+GVWPES SF +DG+ EIP RWKG C++GT F  S+CN+K+IGA YFNKG+L
Sbjct  139  DVIIGVLDSGVWPESASFSEDGLPEIPKRWKGICKAGTDFNSSLCNRKIIGANYFNKGIL  198

Query  646  AKNP  657
            A NP
Sbjct  199  ADNP  202



>ref|XP_009771925.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=781

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 129/198 (65%), Gaps = 13/198 (7%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  255
            L F   F+SA      ++  Q  TYIVH+D S MP  F  H  W S+T+ SI        
Sbjct  13   LLFLSWFLSAHVFCFLAV-AQRSTYIVHLDKSLMPSIFADHHHWHSSTIDSIKAAVPSSV  71

Query  256  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                S   LVY+Y N  HGFSAVLS  ELEA+KK PG++ + KD +V+  T++T  FL L
Sbjct  72   DRFHSAPKLVYSYDNVFHGFSAVLSKDELEALKKLPGFVSAYKDTTVEPHTTYTSDFLKL  131

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +   G WPA+  G+DVIIGV+DTG+WPES SF DDGM ++P RWKG C+ GTQF  S+CN
Sbjct  132  NPSSGLWPASGLGQDVIIGVLDTGIWPESASFRDDGMPQVPKRWKGICKPGTQFNTSLCN  191

Query  604  KKLIGARYFNKGLLAKNP  657
            +KLIGA YFNKG+LA +P
Sbjct  192  RKLIGANYFNKGILANDP  209



>ref|XP_008218400.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=766

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 124/180 (69%), Gaps = 13/180 (7%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHG  300
             +  T+IVHMD S MP+++ SHQ W+S+ + S   +             L+Y Y NA HG
Sbjct  32   AERSTHIVHMDKSLMPKSYASHQHWYSSIVDSFKAQIPTSSDGHKISPSLLYTYDNAFHG  91

Query  301  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  480
            FSAVLS  ELE +K S G++ +  D S+ +DT+HT  FL L+   G WPA++YG D+IIG
Sbjct  92   FSAVLSAEELETLKNSAGFVSAYSDKSITLDTTHTTQFLSLNPSTGLWPASNYGEDIIIG  151

Query  481  VIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            VIDTGVWPESKSF DDGM  ++PARWKG C+ G +F  S+CN KLIGARYFNKG++A NP
Sbjct  152  VIDTGVWPESKSFRDDGMTKKLPARWKGTCEVGQEFNSSLCNFKLIGARYFNKGVMAANP  211



>ref|XP_002510196.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52383.1| Cucumisin precursor, putative [Ricinus communis]
Length=777

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 140/211 (66%), Gaps = 21/211 (10%)
 Frame = +1

Query  82   MANHRALFFH--LAFISATFLQ-IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS  252
            MA   ++ F+  L F ++TFL  + ++  + + YIV MD S MP+AF++H SW  ATLSS
Sbjct  1    MAKQYSIPFYERLFFATSTFLLFVPTLLAEKDNYIVRMDSSAMPKAFSAHHSWHLATLSS  60

Query  253  I------------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDA  378
            +                      L+Y+YT+ I GFSA LSPAE E +K S GY+ S KD 
Sbjct  61   VFEVSKSRSSVSTATTAAAKPSKLLYSYTHVIDGFSAHLSPAEHEILKNSTGYISSIKDL  120

Query  379  SVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWK  558
             VK DT+ +P +LGL+S+  AW  ++YG  +IIGVID+GVWPES+SF D+GM  IP RWK
Sbjct  121  PVKPDTTRSPSYLGLTSNSEAWKLSNYGESIIIGVIDSGVWPESESFSDNGMPRIPKRWK  180

Query  559  GECQSGTQFTPSMCNKKLIGARYFNKGLLAK  651
            G+C+SG QF  S+CN KLIGAR++NKGL+AK
Sbjct  181  GKCESGVQFNSSLCNNKLIGARFYNKGLIAK  211



>ref|XP_004514928.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=712

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 123/169 (73%), Gaps = 13/169 (8%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWFSATLSSI-----------SNRGLVYAYTNAIHGFSAVLSPAEL  330
            MDLS MP+AFT+  SW+ +TLS +           ++  ++Y YTN I+GFSA LSP E 
Sbjct  1    MDLSAMPKAFTNQHSWYHSTLSQVISTTNNNILKSTSSKIIYTYTNVINGFSANLSPEEH  60

Query  331  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
            EA+KKSPGY+ S  D  V +DT+H+P FLGL+   GAW  ++YG+DVIIG++DTGVWPES
Sbjct  61   EALKKSPGYISSMPDLPVTLDTTHSPEFLGLNPYKGAWHDSNYGKDVIIGMVDTGVWPES  120

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            KSF D+GM EIP+RWKG+C+   +   S CNKKLIGARYFNKG LA NP
Sbjct  121  KSFNDNGMTEIPSRWKGKCE--FEVNTSFCNKKLIGARYFNKGFLAANP  167



>ref|XP_010464539.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=738

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 126/171 (74%), Gaps = 6/171 (4%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSS-ISNRG--LVYAYTNAIHGFSAVLSPAE  327
             ++ TYI+HMDLS  P  F  HQSWFS TL+S I+ R   ++YAYT+++HGFSAVL+ +E
Sbjct  22   AETSTYIIHMDLSVKPLPFPDHQSWFSTTLTSVITGRKPKIIYAYTDSVHGFSAVLTNSE  81

Query  328  LEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPE  507
            L+ +K  PGY+  TKD  VK+ T+ +P F+GL+S  G WP ++YG    IG+IDTG+WP+
Sbjct  82   LQRLKDKPGYVSFTKDLPVKLHTTFSPQFIGLNSTSGTWPVSNYGAGTFIGIIDTGIWPD  141

Query  508  SKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            S SF DDG+G +P++WKGECQ  +    S+CNKKLIGAR FNKGL A NP+
Sbjct  142  SPSFHDDGIGSVPSKWKGECQFNSS---SLCNKKLIGARVFNKGLFANNPD  189



>ref|XP_006393907.1| hypothetical protein EUTSA_v10005646mg [Eutrema salsugineum]
 gb|ESQ31193.1| hypothetical protein EUTSA_v10005646mg [Eutrema salsugineum]
Length=734

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 133/186 (72%), Gaps = 8/186 (4%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---SNRGLVYAY  282
            +  I++ F+   + D  + TYI+HMDLS  P  F++HQSWFS TL+S+       ++YAY
Sbjct  7    ILLITSFFMATATTD--TSTYIIHMDLSAKPLPFSNHQSWFSTTLTSVITGRKPKILYAY  64

Query  283  TNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYG  462
            T++IHGFSAVL+ +EL+ ++  PGY+  TKD  VK+ T+ +P F+GL S+ G WP ++YG
Sbjct  65   TDSIHGFSAVLTDSELQRLQHKPGYVSFTKDLPVKLHTTFSPQFIGLDSNSGTWPVSNYG  124

Query  463  RDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGL  642
               +IG+IDTG+WP+S SF DDG+G +P+RWKG+C+  T    S CNKKLIGAR FN+GL
Sbjct  125  VGTVIGIIDTGIWPDSPSFHDDGIGSVPSRWKGKCEFNTS---SSCNKKLIGARVFNEGL  181

Query  643  LAKNPN  660
             A NPN
Sbjct  182  FANNPN  187



>ref|XP_009419397.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=761

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 136/190 (72%), Gaps = 9/190 (5%)
 Frame = +1

Query  118  FISATFLQIF-SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------SNRGL  270
             ++A+ +++  S     +TYIVHMD + MP AF+  +SW++ATL++         ++  +
Sbjct  14   LLAASAVRLLASTSADVDTYIVHMDSAAMPSAFSGRRSWYAATLAATADASDAIPADEKI  73

Query  271  VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPA  450
            VY Y +AIHGFSA LS A+LE +KKS G+L  ++DA VK DT+HT  FL LS+  G WPA
Sbjct  74   VYVYDHAIHGFSARLSSAQLEQLKKSHGFLSCSRDAPVKKDTTHTSDFLELSASAGLWPA  133

Query  451  TDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYF  630
            ++YG DVIIGV+DTG+WPES SF DDG+  +P+RW+G C+ GT F  S CN+KLIGAR F
Sbjct  134  SNYGDDVIIGVLDTGIWPESASFRDDGLTAVPSRWRGACEQGTAFRSSACNRKLIGARSF  193

Query  631  NKGLLAKNPN  660
            NKGLLA +PN
Sbjct  194  NKGLLASDPN  203



>ref|XP_006345400.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 128/199 (64%), Gaps = 13/199 (7%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  255
            L F   FIS       +I  Q  TYIVH+D S MP  F  H  W S+T+ SI        
Sbjct  9    LLFLSWFISVHLFCYLAI-AQRSTYIVHLDKSLMPNVFPDHHHWHSSTIDSIKASVPSSV  67

Query  256  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                S   LVY+Y N  HGFSAVLS  EL+A+KK PG++ + KD +V+  T++T  FL L
Sbjct  68   DRFHSAPKLVYSYDNVFHGFSAVLSKDELKALKKLPGFVSAYKDRTVEPHTTYTSDFLKL  127

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +   G WPA+  G+DVIIGV+D G+WPES SF DDG+ EIP RWKG C+ GT+F  SMCN
Sbjct  128  NPSSGLWPASGLGQDVIIGVLDGGIWPESASFRDDGIPEIPKRWKGICKPGTEFNTSMCN  187

Query  604  KKLIGARYFNKGLLAKNPN  660
            KKLIGA YFNKG+LA +PN
Sbjct  188  KKLIGANYFNKGILANDPN  206



>ref|XP_009338017.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 130/199 (65%), Gaps = 13/199 (7%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  267
              F L  +    LQ+        TYIVHMD S MP+++TSH  W+S+ + S  +      
Sbjct  11   FIFSLVALFLLALQVNVSFADRSTYIVHMDKSLMPKSYTSHDHWYSSIVDSFKSENPTSF  70

Query  268  --------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                    ++Y Y NA HGFSAVLS  EL  +KKSPG++ +  D S+  DT+HT  FL L
Sbjct  71   DGNKIWPSILYTYDNAFHGFSAVLSADELVTLKKSPGFVSAYADKSITPDTTHTTQFLNL  130

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSMC  600
            +   G WPA+DYG D+IIGVIDTG+WPES+SF D+GM + +PARWKG+C+ G +F  S+C
Sbjct  131  NPFAGLWPASDYGDDIIIGVIDTGLWPESESFRDEGMTKSLPARWKGKCEVGQEFNASLC  190

Query  601  NKKLIGARYFNKGLLAKNP  657
            N KLIGARYFNKG++A NP
Sbjct  191  NYKLIGARYFNKGVMAANP  209



>ref|XP_003552427.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=764

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 129/194 (66%), Gaps = 10/194 (5%)
 Frame = +1

Query  103  FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---------  255
            F  +  I+  FL       ++ TYIVHMD S  P  FT+H  WF +T+ SI         
Sbjct  12   FPFMLLITHWFLLALHGSAETSTYIVHMDKSLFPHVFTTHHDWFESTIDSIKSAKLGHSS  71

Query  256  -SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSD  432
              ++ LVY+Y +A++GFSAVL+  ELEA+K S G++ +  D +V +DT+HT  FL L S 
Sbjct  72   NQSQKLVYSYNHAMYGFSAVLTLEELEAVKNSHGFVAAYPDRNVTIDTTHTSEFLSLDSS  131

Query  433  HGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKL  612
             G W A+++G DVI+GVIDTGVWPES+SF D+GM +IP RWKG C+ G  F  SMCN KL
Sbjct  132  SGLWHASNFGEDVIVGVIDTGVWPESESFKDEGMTKIPNRWKGTCEEGQDFNTSMCNFKL  191

Query  613  IGARYFNKGLLAKN  654
            IGARYFNKG++A N
Sbjct  192  IGARYFNKGVIAAN  205



>ref|XP_009342993.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 125/176 (71%), Gaps = 13/176 (7%)
 Frame = +1

Query  169  TYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHGFSAV  312
            TYIVHMD S MP++++SH  W+S+ + S  +              ++Y Y  A HGFSAV
Sbjct  34   TYIVHMDKSLMPKSYSSHDHWYSSIVDSFKSENPTSFDGNKILPSILYTYDTAFHGFSAV  93

Query  313  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  492
            LSP EL  +KKSPG++ +  D S+ +DT+HT  FL L+   G WPA+DYG D+IIGVIDT
Sbjct  94   LSPDELVTLKKSPGFVSAYADKSITLDTTHTTQFLNLNPFAGLWPASDYGDDIIIGVIDT  153

Query  493  GVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            G+WPES+SF D+GM + +PARWKG+C+ G +F  S+CN KLIGARYFNKG++A NP
Sbjct  154  GLWPESESFRDEGMTKSLPARWKGKCEVGQEFNASLCNYKLIGARYFNKGVMAANP  209



>gb|AAO62352.1| subtilase [Casuarina glauca]
Length=764

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 122/180 (68%), Gaps = 13/180 (7%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHGF  303
            +  TYIVHMD S MP+AFTSH SW+ + + S+++               +Y Y + +HGF
Sbjct  31   EKSTYIVHMDKSHMPKAFTSHHSWYLSIIDSLNSERPTSTEELKSASSFLYTYNHVLHGF  90

Query  304  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  483
            S  L   ++E++K +PG++ + +D +  +DT+HTP FL LS   G WP ++YG DVIIGV
Sbjct  91   SVALCQEDVESLKNTPGFISAYQDRNATLDTTHTPEFLSLSPSWGLWPTSNYGEDVIIGV  150

Query  484  IDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            ID+GVWPES+SF DDGM   +PARWKG CQ G QF  S CN KLIGARYFN G+LA NPN
Sbjct  151  IDSGVWPESESFNDDGMNASVPARWKGICQVGEQFNSSHCNSKLIGARYFNNGILAANPN  210



>ref|XP_009787984.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 127/194 (65%), Gaps = 12/194 (6%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------  255
            L+++ +  L  F    +  TYIVH+D S MP  F  HQ W S+T+ SI            
Sbjct  16   LSWLLSVHLFCFLAVARRSTYIVHLDKSLMPNIFADHQHWHSSTIDSIKAAVPSSVDRFH  75

Query  256  SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  435
            S   LVY+Y N  HGFSAVLS  ELEA+KK PG++ + KD + +  T++T  FL L+   
Sbjct  76   SAPKLVYSYDNVFHGFSAVLSKDELEALKKLPGFVSAYKDTTAEPHTTYTSDFLKLNPSS  135

Query  436  GAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLI  615
            G WPA+  G+DVIIGV+D+G+WPES SF DDGM EIP RWKG C+ GTQF  S+CN+KLI
Sbjct  136  GLWPASGLGQDVIIGVLDSGIWPESASFRDDGMPEIPKRWKGICKPGTQFNTSLCNRKLI  195

Query  616  GARYFNKGLLAKNP  657
            G  YFNKG+LA +P
Sbjct  196  GVNYFNKGILANDP  209



>gb|ACA64702.1| subtilase [Nicotiana tabacum]
Length=773

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 127/194 (65%), Gaps = 12/194 (6%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------  255
            L+++ +  L  F    +  TYIVH+D S MP  F  HQ W S+T+ SI            
Sbjct  16   LSWLLSVHLFCFLAVARRSTYIVHLDKSLMPNIFADHQHWHSSTIDSIKAAVPSSVDRFH  75

Query  256  SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  435
            S   LVY+Y N  HGFSAVLS  ELEA+KK PG++ + KD + +  T++T  FL L+   
Sbjct  76   SAPKLVYSYDNVFHGFSAVLSKDELEALKKLPGFVSAYKDTTAEPHTTYTSDFLKLNPSS  135

Query  436  GAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLI  615
            G WPA+  G+DVIIGV+D+G+WPES SF DDGM EIP RWKG C+ GTQF  S+CN+KLI
Sbjct  136  GLWPASGLGQDVIIGVLDSGIWPESASFRDDGMPEIPKRWKGICKPGTQFNTSLCNRKLI  195

Query  616  GARYFNKGLLAKNP  657
            G  YFNKG+LA +P
Sbjct  196  GVNYFNKGILANDP  209



>ref|XP_009337959.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Pyrus 
x bretschneideri]
Length=798

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 125/176 (71%), Gaps = 13/176 (7%)
 Frame = +1

Query  169  TYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHGFSAV  312
            TYIVHMD S MP++++SH  W+S+ + S  +              ++Y Y  A HGFSAV
Sbjct  68   TYIVHMDKSLMPKSYSSHDHWYSSIVDSFKSENPTSFDGNKILPSILYTYDTAFHGFSAV  127

Query  313  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  492
            LSP EL  +KKSPG++ +  D S+ +DT+HT  FL L+   G WPA+DYG D+IIGVIDT
Sbjct  128  LSPDELVTLKKSPGFVSAYADKSITLDTTHTTQFLNLNPFAGLWPASDYGDDIIIGVIDT  187

Query  493  GVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            G+WPES+SF D+GM + +PARWKG+C+ G +F  S+CN KLIGARYFNKG++A NP
Sbjct  188  GLWPESESFRDEGMTKSLPARWKGKCEVGQEFNASLCNYKLIGARYFNKGVMAANP  243



>gb|KEH18578.1| subtilisin-like serine protease [Medicago truncatula]
Length=728

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 122/168 (73%), Gaps = 9/168 (5%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWFSATLSSISNRGL--------VYAYTNAIHGFSAVLSPAELEAI  339
            MDLS MP+ F++  SW+ +TLS ++   L        +Y Y N I+GFSA LSP E EA+
Sbjct  1    MDLSAMPKVFSNKNSWYESTLSQVTTNNLNNPTFSKIIYTYNNVINGFSANLSPEEHEAL  60

Query  340  KKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSF  519
            K SPGY+ S  D  +K+DT+H+P FLGL+S  GAWPA+DYG+DVI+G+IDTGVWPES+SF
Sbjct  61   KTSPGYISSMPDLPLKLDTTHSPQFLGLNSYKGAWPASDYGKDVIVGMIDTGVWPESESF  120

Query  520  GDDGMGEIPARWKGE-CQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
             D+ M +IP++WKG+ CQ       S CNKKLIGAR+FNKG LAK PN
Sbjct  121  KDNDMPQIPSKWKGQLCQFENTNNSSFCNKKLIGARFFNKGFLAKYPN  168



>ref|XP_004229661.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=769

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 123/182 (68%), Gaps = 12/182 (7%)
 Frame = +1

Query  151  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAI  294
            +  +  TYIVH+D S MP+ F +H  W S+T+ SI                L+Y+Y N  
Sbjct  25   VIAERSTYIVHLDKSLMPKIFATHHHWHSSTVESIKIVNPALLNSHHPVPKLLYSYDNVF  84

Query  295  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  474
            HGFSAVLS  ELE +KK  G++ + KD SV+  T+HTP FL L+   G WPA+ +G+DV+
Sbjct  85   HGFSAVLSKDELEVLKKFTGFISAYKDRSVEAHTTHTPEFLKLNPSSGLWPASGFGQDVV  144

Query  475  IGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKN  654
            IGV+D+GVWPES SF D+GM EIP +WKG C+ G +F  S+CNKKLIGA YFNKGLLA N
Sbjct  145  IGVLDSGVWPESASFRDEGMPEIPKKWKGICRPGMEFNTSLCNKKLIGANYFNKGLLASN  204

Query  655  PN  660
            P+
Sbjct  205  PD  206



>ref|XP_003624105.1| Xylem serine proteinase [Medicago truncatula]
 gb|ABD28576.1| Protease-associated PA; Proteinase inhibitor I9, subtilisin propeptide 
[Medicago truncatula]
 gb|AES80323.1| subtilisin-like serine protease [Medicago truncatula]
Length=769

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 134/204 (66%), Gaps = 17/204 (8%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  255
            +F  L  IS  FL  F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+        
Sbjct  6    VFSLLLIISLWFLLTFHSNAETSTYIIHMNKSFFPQVFTTHHDWFKSTIHSLKSKTLVPD  65

Query  256  --------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
                    S + LVY Y +A++GFSAVLS  ELE +K   G++ + +D +  +DT+HT  
Sbjct  66   DYDQASKQSQKKLVYTYDHAMYGFSAVLSSNELEILKNIDGFVSAYQDRTATIDTTHTFE  125

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFT  588
            FL L S  G W  +D+G DV++GVIDTG+WPES+SF DDGM  +IP +WKG C++G +F 
Sbjct  126  FLSLDSPSGLWHTSDFGDDVVVGVIDTGLWPESQSFKDDGMTKKIPNKWKGTCETGQEFN  185

Query  589  PSMCNKKLIGARYFNKGLLAKNPN  660
             SMCN KLIGARYFNKG++A NPN
Sbjct  186  TSMCNFKLIGARYFNKGVIASNPN  209



>ref|XP_009608286.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=765

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 127/185 (69%), Gaps = 12/185 (6%)
 Frame = +1

Query  142  IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYT  285
            +     +  TYIVH+D S MP+ F SH++W S+ +++I                +VY+Y 
Sbjct  19   LLGTSAKRSTYIVHLDKSVMPKIFASHENWHSSIINNIKIEVPTTPNDHHPVPKIVYSYD  78

Query  286  NAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGR  465
            N IHGFSAVLS  EL A+KKSPG+L + KD +V+  T+HT  FL L+   G WPA+ +G+
Sbjct  79   NVIHGFSAVLSKDELVALKKSPGFLSAYKDRTVEAHTTHTSEFLKLNPASGMWPASGFGQ  138

Query  466  DVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLL  645
            DVIIGV+D+G+WPES SF DDG+ E+P RWKG C+ G +F  S+CN+KLIGA YFNKG+L
Sbjct  139  DVIIGVLDSGIWPESASFRDDGLPEVPKRWKGICKPGAEFNSSLCNRKLIGANYFNKGIL  198

Query  646  AKNPN  660
            A +P+
Sbjct  199  ADDPS  203



>ref|XP_006345402.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=760

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 126/198 (64%), Gaps = 16/198 (8%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  255
            L F   F+SA  L I     Q  TYIVHMD + MP  F  H  W S+T+ SI        
Sbjct  9    LLFISWFLSAHMLAI----AQRSTYIVHMDKTLMPNVFPDHHHWHSSTIDSIKASVPSSV  64

Query  256  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                S   LVY+Y N +HGFSAVLS  E+ A+K  PG++ + KD +V+  T+HT  FL L
Sbjct  65   DRFHSAPKLVYSYDNVLHGFSAVLSQDEVAALKNLPGFISAYKDRTVEPHTTHTSDFLKL  124

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
            +   G W A+  G+DVIIGV D+G+WPES SF DDGM EIP RWKG C+ GTQF  SMCN
Sbjct  125  NPSSGLWQASGLGQDVIIGVFDSGIWPESVSFQDDGMPEIPKRWKGICKPGTQFNTSMCN  184

Query  604  KKLIGARYFNKGLLAKNP  657
            KKLIGA YFN+G+LA +P
Sbjct  185  KKLIGANYFNQGILANDP  202



>ref|XP_004156411.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=757

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 135/196 (69%), Gaps = 12/196 (6%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  267
            L+F  + I   +L    I  ++  YIVHM+ + MP+ F S  SW+SAT+SS+ +      
Sbjct  5    LYFWFSLIPIFWL--CPILTETRNYIVHMNSAAMPKPFASRHSWYSATISSLLHSSSSSS  62

Query  268  ------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
                  L++ Y +AI GF A L+P++LEA+K SPGYL S  D+SV VDT+H+  FLGLSS
Sbjct  63   SSFPSKLIHTYNHAISGFCASLTPSQLEALKNSPGYLSSVLDSSVHVDTTHSSHFLGLSS  122

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
            +HG  P + YG DVIIG +DTG+WP+S+SF DDGM EIP++WKGEC+S T F  S CN K
Sbjct  123  NHGLLPISKYGSDVIIGFVDTGIWPDSESFIDDGMSEIPSKWKGECESSTHFNVSFCNNK  182

Query  610  LIGARYFNKGLLAKNP  657
            LIGAR+FNKGL++  P
Sbjct  183  LIGARFFNKGLISGLP  198



>ref|XP_004143027.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN62450.1| hypothetical protein Csa_2G354760 [Cucumis sativus]
Length=757

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 135/196 (69%), Gaps = 12/196 (6%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  267
            L+F  + I   +L    I  ++  YIVHM+ + MP+ F S  SW+SAT+SS+ +      
Sbjct  5    LYFWFSLIPIFWL--CPILTETRNYIVHMNSAAMPKPFASRHSWYSATISSLLHSSSSSS  62

Query  268  ------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
                  L++ Y +AI GF A L+P++LEA+K SPGYL S  D+SV VDT+H+  FLGLSS
Sbjct  63   SSFPSKLIHTYNHAISGFCASLTPSQLEALKNSPGYLSSVLDSSVHVDTTHSSHFLGLSS  122

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
            +HG  P + YG DVIIG +DTG+WP+S+SF DDGM EIP++WKGEC+S T F  S CN K
Sbjct  123  NHGLLPISKYGSDVIIGFVDTGIWPDSESFIDDGMSEIPSKWKGECESSTHFNVSFCNNK  182

Query  610  LIGARYFNKGLLAKNP  657
            LIGAR+FNKGL++  P
Sbjct  183  LIGARFFNKGLISGLP  198



>ref|XP_007139763.1| hypothetical protein PHAVU_008G057000g [Phaseolus vulgaris]
 gb|ESW11757.1| hypothetical protein PHAVU_008G057000g [Phaseolus vulgaris]
Length=739

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 126/179 (70%), Gaps = 12/179 (7%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL-----------VYAYTNAIHGF  303
             +S TYI+HMD S  P  FT+H  WF +T+ SI +  L           VY+Y +A++GF
Sbjct  28   AESSTYIIHMDRSLFPTVFTTHHDWFESTVHSIKSATLGHSFKQSQNLTVYSYNHAMYGF  87

Query  304  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  483
            SAVLS  ELEA+K SPG++ +  D +V +DT+HT  FL L+S  G W A+++G DVI+GV
Sbjct  88   SAVLSSEELEAVKNSPGFVAAYPDRNVTIDTTHTFEFLSLASSSGLWHASNFGEDVIVGV  147

Query  484  IDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            IDTGVWPES+SF DDGM  +IP +WKG C+ G +F  SMCN KLIGARYFNKG++A +P
Sbjct  148  IDTGVWPESESFKDDGMTKKIPNKWKGTCEEGQEFNTSMCNFKLIGARYFNKGVIAAHP  206



>ref|XP_006345404.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=782

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 128/196 (65%), Gaps = 16/196 (8%)
 Frame = +1

Query  103  FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS--------  258
            F    F+ A  L +     +  TYIVH+D S MP+ F +H  W S+T+ SI         
Sbjct  9    FLVFFFLFAPLLCL----AERSTYIVHLDKSLMPKIFATHHHWHSSTIESIKIITPASLN  64

Query  259  ----NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  426
                   L+Y+Y N  HGFSAVLS  ELEA+KKSPG++ + KD  +++ T+HTP FL L+
Sbjct  65   SHHPAPKLLYSYDNVFHGFSAVLSQNELEALKKSPGFVSAHKDVPIELHTTHTPEFLKLN  124

Query  427  SDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNK  606
               G WPA+++G+DVIIG++DTG+WPES SF DDGM EIP RWKG C+ GT F  S+CN+
Sbjct  125  PSSGLWPASNFGQDVIIGLVDTGIWPESPSFRDDGMPEIPKRWKGICREGTDFNSSLCNR  184

Query  607  KLIGARYFNKGLLAKN  654
            K+IG  YF KG +A+N
Sbjct  185  KIIGVNYFYKGAVAEN  200



>ref|NP_569044.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 dbj|BAB10943.1| subtilisin-type protease-like [Arabidopsis thaliana]
 gb|AAS99721.1| At5g67090 [Arabidopsis thaliana]
 dbj|BAD94613.1| subtilisin-type protease-like [Arabidopsis thaliana]
 gb|AED98299.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=736

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 129/173 (75%), Gaps = 6/173 (3%)
 Frame = +1

Query  151  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS-ISNRG--LVYAYTNAIHGFSAVLSP  321
            +  ++  YI+HMDLS  P  F+ H+SWFS TL+S I+NR   ++YAYT+++HGFSAVL+ 
Sbjct  18   VTAETSPYIIHMDLSAKPLPFSDHRSWFSTTLTSVITNRKPKIIYAYTDSVHGFSAVLTN  77

Query  322  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVW  501
            +EL+ +K  PGY+  TKD  VK+ T+ +P F+GL+S  G WP ++YG  ++IG+IDTG+W
Sbjct  78   SELQRLKHKPGYVSFTKDLPVKLHTTFSPKFIGLNSTSGTWPVSNYGAGIVIGIIDTGIW  137

Query  502  PESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            P+S SF DDG+G +P++WKG C+  +    S+CNKKLIGA+ FNKGL A NP+
Sbjct  138  PDSPSFHDDGVGSVPSKWKGACEFNSS---SLCNKKLIGAKVFNKGLFANNPD  187



>gb|KJB59847.1| hypothetical protein B456_009G275900 [Gossypium raimondii]
Length=746

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 136/196 (69%), Gaps = 15/196 (8%)
 Frame = +1

Query  85   ANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR  264
            A+H  L F   + S +F  IF+   Q++ YI+HMD S MP+AF   QSW+ ATLSS+S  
Sbjct  3    AHHINLLFICLYFSLSF--IFTKQVQADNYIIHMDHSAMPKAFAGRQSWYLATLSSLSAN  60

Query  265  GLVYAYTNAIHGFSAVLSPAEL-----EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
              + A TN+       +  AEL      A+K S GY+ S +D +VK+DT+++  FL LSS
Sbjct  61   --LRANTNS------TIPTAELLYSYNHALKNSRGYVSSIRDKTVKLDTTYSFKFLRLSS  112

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
            D G WPA+ +G+DVIIG+I TGVWPES+SF DDGM ++P RWKG+C+SGTQF  S+CNKK
Sbjct  113  DAGLWPASGFGKDVIIGLIGTGVWPESESFNDDGMNDVPLRWKGKCESGTQFNSSLCNKK  172

Query  610  LIGARYFNKGLLAKNP  657
            LIGAR FNKGL+A NP
Sbjct  173  LIGARSFNKGLIANNP  188



>ref|XP_009595146.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=781

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 127/192 (66%), Gaps = 13/192 (7%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SN  261
            F+SA      +I  Q  TYIVH+D S MP  F  +  W S+T+ SI            S 
Sbjct  19   FLSAHVFCFLAI-AQRSTYIVHLDKSLMPNIFADYHHWHSSTIDSIKAAVPSSVDRFHSA  77

Query  262  RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGA  441
              LVY+Y N  HGFSAVLS  ELEA+KK PG++ + KD +V+  T++T  FL L+   G 
Sbjct  78   PKLVYSYDNVFHGFSAVLSKDELEALKKLPGFVSAYKDRTVEPHTTYTSDFLKLNPSSGL  137

Query  442  WPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGA  621
            WPA+  G+DVIIGV+D G+WPES+SF DDGM EIP RWKG C+ GTQF  S+CN+KLIGA
Sbjct  138  WPASGLGQDVIIGVLDGGIWPESESFRDDGMPEIPKRWKGICKPGTQFNTSLCNRKLIGA  197

Query  622  RYFNKGLLAKNP  657
             YFN+G+LA +P
Sbjct  198  NYFNRGILANDP  209



>ref|XP_004229664.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=781

 Score =   200 bits (508),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 127/192 (66%), Gaps = 15/192 (8%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SN  261
            F+SA    IF    Q  TYIVH+D S MP  F  H  W S+T+ SI            S 
Sbjct  21   FLSA---HIFLAMAQRSTYIVHLDKSLMPNVFADHHHWHSSTIESIKASVPSSEDRFHSA  77

Query  262  RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGA  441
              LVY+Y N  HGFSAVLS  EL+A+KKSPG++ + KD +V+  T++T  FL L+  +G 
Sbjct  78   PKLVYSYDNVFHGFSAVLSKDELKALKKSPGFISAYKDRTVEPHTTYTSDFLKLNPSYGL  137

Query  442  WPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGA  621
            WPA+  G+D+I+ V+D G+WPES SF DDG+ EIP +WKG C+ GTQF  SMCN+KLIGA
Sbjct  138  WPASGLGQDMIVAVLDGGIWPESMSFQDDGLPEIPKKWKGICRPGTQFNSSMCNRKLIGA  197

Query  622  RYFNKGLLAKNP  657
             YFNKG+LA +P
Sbjct  198  NYFNKGILANDP  209



>ref|XP_011464023.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=739

 Score =   199 bits (507),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 131/182 (72%), Gaps = 2/182 (1%)
 Frame = +1

Query  121  ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN--RGLVYAYTNAI  294
            + A FL    +  +S +Y V+MD S  P  F+ H +W+ ATLSS+S     L++ YT AI
Sbjct  32   VIALFLLPIMVSPESHSYTVYMDPSLKPTPFSDHHTWYLATLSSLSQGETKLIHTYTEAI  91

Query  295  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  474
             GFSA+L+P+EL+A+  +PG +  +++  +K+ T+H+  FLGL+  +GAWP + YG +VI
Sbjct  92   QGFSAILTPSELQALPSTPGLVSYSRNRPLKLLTTHSSEFLGLTPKYGAWPISGYGENVI  151

Query  475  IGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKN  654
            IG++DTGVWPES+SFGD+GM  +P+RWKG C+S T F  S CN KLIGAR++NKG +A+N
Sbjct  152  IGLLDTGVWPESESFGDEGMTGVPSRWKGTCESDTHFNSSSCNNKLIGARFYNKGYIAEN  211

Query  655  PN  660
            P+
Sbjct  212  PD  213



>ref|XP_010687642.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 123/183 (67%), Gaps = 16/183 (9%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWFSAT---LSSISNRGL-------------VYAYTNA  291
            Q  TYI+HMD S MP  FTSH  W+++T   L+S ++ GL             +Y Y NA
Sbjct  35   QRSTYIIHMDKSLMPNVFTSHHHWYTSTVDSLNSATSNGLKSPNYSSPSSPSVLYTYDNA  94

Query  292  IHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDV  471
            +HGFSA+LS  EL+ ++  P ++ + K+A   +DT+ T  FL L+   G WPA++YG DV
Sbjct  95   LHGFSALLSQNELQKLENHPSFITAYKEAKATLDTTRTIDFLSLNPYTGLWPASNYGHDV  154

Query  472  IIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAK  651
            IIGVIDTGVWPES+SF D GM  +P+RWKG C+ G  F  SMCNKKLIGA+YFNKG++A 
Sbjct  155  IIGVIDTGVWPESRSFNDAGMTPVPSRWKGACEGGQNFNASMCNKKLIGAKYFNKGVIAS  214

Query  652  NPN  660
             PN
Sbjct  215  TPN  217



>gb|ACA64704.1| subtilase [Nicotiana tabacum]
Length=781

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 127/192 (66%), Gaps = 13/192 (7%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SN  261
            F+SA      +I  Q  TYIVH+D S MP  F  +  W S+T+ SI            S 
Sbjct  19   FLSAHVFCFLAI-AQRSTYIVHLDKSLMPNIFADYHHWHSSTIDSIKAAVPSSVDRFHSA  77

Query  262  RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGA  441
              LVY+Y N  HGFSAVLS  ELEA+KK PG++ + KD +V+  T++T  FL L+   G 
Sbjct  78   PKLVYSYDNVFHGFSAVLSKDELEALKKLPGFVSAYKDRTVEPHTTYTSDFLKLNPSSGL  137

Query  442  WPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGA  621
            WPA+  G++VIIGV+D G+WPES+SF DDGM EIP RWKG C+ GTQF  S+CN+KLIGA
Sbjct  138  WPASGLGQEVIIGVLDGGIWPESESFRDDGMPEIPKRWKGICKPGTQFNTSLCNRKLIGA  197

Query  622  RYFNKGLLAKNP  657
             YFNKG+LA +P
Sbjct  198  NYFNKGILANDP  209



>ref|XP_004492811.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 134/199 (67%), Gaps = 16/199 (8%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR---------  264
            + FI+  F   F ++ ++ TYIVHMD SF P+ FT+H  WF +T+ S++++         
Sbjct  13   MLFITPWFQLTFHVNAETSTYIVHMDKSFFPQVFTTHHDWFQSTVHSLNSKTELLDLDQP  72

Query  265  ------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  426
                   +VY Y +A++GFSAVL+  ELE +K   G++ + +D +  +DT+HT  FL L 
Sbjct  73   SKQQSKKVVYTYDHAMYGFSAVLTSNELETLKNIHGFIAAYQDRTAIIDTTHTFQFLSLD  132

Query  427  SDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCN  603
            S +G W A+++G D+I+GVID+GVWPES+SF D GM  +IP++WKG C+ G  F  SMCN
Sbjct  133  SPNGLWHASNFGEDIIVGVIDSGVWPESESFKDHGMTKKIPSKWKGACEEGQDFNASMCN  192

Query  604  KKLIGARYFNKGLLAKNPN  660
             KLIGARYFNKG++A NPN
Sbjct  193  FKLIGARYFNKGMIAANPN  211



>ref|XP_011468374.1| PREDICTED: uncharacterized protein LOC101302380 [Fragaria vesca 
subsp. vesca]
Length=1517

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 131/198 (66%), Gaps = 15/198 (8%)
 Frame = +1

Query  109  HLAFISATFLQIFSID---GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  264
            ++ ++  TFL     +    +  TYIVHMD S MP+ FTSHQ W+S+ + S         
Sbjct  759  YILYVLQTFLLALHFNTSLAERSTYIVHMDKSLMPKFFTSHQHWYSSIVDSFKTETQTDS  818

Query  265  -----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
                  ++Y Y NA HGFSAVLS  ELE +KKSPG++ +  D +  +DT+HT  FL L+ 
Sbjct  819  HSFSPSILYTYDNAFHGFSAVLSIDELETLKKSPGFVSAYNDKTFTLDTTHTSDFLSLNP  878

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGM--GEIPARWKGECQSGTQFTPSMCN  603
              G  PA+++  D++IGVIDTGVWPES+SF DDG+   +IPARWKG C+ G +F  S+CN
Sbjct  879  SAGLLPASNHEEDIVIGVIDTGVWPESESFKDDGVMTKDIPARWKGTCEVGQEFNASLCN  938

Query  604  KKLIGARYFNKGLLAKNP  657
            KKLIGARYFNKG++A NP
Sbjct  939  KKLIGARYFNKGIMAANP  956


 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 122/180 (68%), Gaps = 13/180 (7%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHG  300
             +  TYIVHMD S MP++FTSH  W+S+ + S                 L+Y Y NA HG
Sbjct  4    AERSTYIVHMDKSLMPKSFTSHHHWYSSIVDSFKTDLHTSSDPHRLTPSLLYTYDNAFHG  63

Query  301  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  480
            FSAVLS  ELE + KSP ++ + KD +V VDT+HT  FL L+   G  PA++YG D+I+G
Sbjct  64   FSAVLSTDELETLGKSPAFVSAYKDKTVTVDTTHTTTFLSLNPSTGLLPASNYGEDIIVG  123

Query  481  VIDTGVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            VIDTG+WPES SF DDG+ + IPA+WKG+C+ G +F  S+CN KLIGARYFNKG+ A NP
Sbjct  124  VIDTGIWPESDSFRDDGLTKNIPAKWKGKCEVGQEFNTSLCNNKLIGARYFNKGVRAANP  183



>ref|XP_002865029.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41288.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=736

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 128/171 (75%), Gaps = 6/171 (4%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSS-ISNRG--LVYAYTNAIHGFSAVLSPAE  327
             ++ TYI+HMDLS  P  F++H++WFS TL+S I++R   ++YAYT+++HGFSAVL+  E
Sbjct  20   AETSTYIIHMDLSAKPLPFSNHRNWFSTTLTSVITDRKPKIIYAYTDSVHGFSAVLTTLE  79

Query  328  LEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPE  507
            L+ +K  PGY+  TKD  VK+ T+ +P F+GL+S  G WP ++YG   +IG+IDTG+WP+
Sbjct  80   LQRLKHKPGYVSFTKDLPVKLHTTFSPQFIGLNSTSGTWPVSNYGDGTVIGIIDTGIWPD  139

Query  508  SKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            S SF DDG+G +P++WKG C+  +    S+CNKKLIGAR FNKGL A NP+
Sbjct  140  SPSFHDDGVGSVPSKWKGACEFNSS---SLCNKKLIGARVFNKGLFANNPD  187



>ref|XP_008355893.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 124/176 (70%), Gaps = 13/176 (7%)
 Frame = +1

Query  169  TYIVHMDLSFMPRAFTSHQSWFSATLSSISN------------RGLVYAYTNAIHGFSAV  312
            TYIVHMD S MP++++SH  W+ + + S  +              ++Y Y NA HGFSAV
Sbjct  34   TYIVHMDKSLMPKSYSSHGHWYXSIVDSFKSGNPTSFDGNKILPSILYTYDNAFHGFSAV  93

Query  313  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  492
            LS  EL  +KKSPG++ +  D S+ +DT+HT  FL L+   G WPA+DYG D+IIGVIDT
Sbjct  94   LSADELVTLKKSPGFISAYADKSITLDTTHTTQFLNLNPFAGLWPASDYGDDIIIGVIDT  153

Query  493  GVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            G+WPES+SF D+GM + +PARWKG+C+ G +F  S+CN KLIGARYFNKG++A NP
Sbjct  154  GLWPESESFRDEGMTKSLPARWKGKCEVGQEFNASLCNYKLIGARYFNKGVMAANP  209



>ref|XP_003535388.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 133/210 (63%), Gaps = 17/210 (8%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQI----FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLS  249
            M  H  +   L F+   +L +     + + +S TYIVHMD S MP+ F SH  W+ +T+ 
Sbjct  1    MEPHFVVRLPLMFLITLWLSLSHHHANAETESSTYIVHMDKSLMPQVFASHHDWYESTIH  60

Query  250  SIS------------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  393
            SI+            ++ LVY Y +A+HGFSAVLSP ELE +K + G++ +  D S  +D
Sbjct  61   SINLATADDPSEQQQSQKLVYTYDDAMHGFSAVLSPEELETLKNTQGFVTAYPDRSATID  120

Query  394  TSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGE-IPARWKGECQ  570
            T+HT  FL L S +G W A++ G  VI+G+ID+GVWPES+SF DDGM   IP +WKG C+
Sbjct  121  TTHTFEFLSLDSSNGLWNASNLGEGVIVGMIDSGVWPESESFKDDGMSRNIPYKWKGTCE  180

Query  571  SGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
             G  F  SMCN KLIGARYFNKG+ A NPN
Sbjct  181  PGQDFNASMCNFKLIGARYFNKGVKAANPN  210



>ref|XP_006386505.1| hypothetical protein POPTR_0002s12610g [Populus trichocarpa]
 gb|ERP64302.1| hypothetical protein POPTR_0002s12610g [Populus trichocarpa]
Length=739

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 127/194 (65%), Gaps = 17/194 (9%)
 Frame = +1

Query  82   MANHRALFFHLAFISA-TFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS  258
            MA   ++  +  +IS  T L       Q E YIVHMDLS MP+AF+              
Sbjct  1    MATRDSVSLYKLWISVITILPFTQTLSQPENYIVHMDLSVMPKAFS--------------  46

Query  259  NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  438
              G  + YT+ I+GFSA L+P+ELE +K SPGY+ S KD  VK DT+H+  FLGL+    
Sbjct  47   --GQYHCYTHVINGFSASLTPSELEVLKNSPGYISSIKDLPVKQDTTHSSKFLGLTPQSL  104

Query  439  AWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIG  618
            AW  ++YG  +IIG++D+GV PES+S+ D GM EIP RWKGEC+SGTQF  S+CNKKLIG
Sbjct  105  AWKVSNYGEGIIIGLVDSGVSPESQSYNDHGMPEIPERWKGECESGTQFNSSLCNKKLIG  164

Query  619  ARYFNKGLLAKNPN  660
            AR+FNKGL+A  PN
Sbjct  165  ARFFNKGLIAMYPN  178



>emb|CAA59964.1| subtilisin-like protease [Alnus glutinosa]
Length=761

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 127/192 (66%), Gaps = 7/192 (4%)
 Frame = +1

Query  103  FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----G  267
             F  A      L   S   +  TYIVHMD S MP+AFTSH +W+S+ +  +++       
Sbjct  12   LFLFASCICLALHASSTSMEKSTYIVHMDKSHMPKAFTSHHNWYSSIVDCLNSEKPTTSS  71

Query  268  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  447
             VY Y + +HGFSA LS  EL+ +++SPG++ + +D +  +DT+HTP FL L+   G WP
Sbjct  72   FVYTYNHVLHGFSASLSHQELDTLRESPGFVSAYRDRNATLDTTHTPRFLSLNPTGGLWP  131

Query  448  ATDYGRDVIIGVIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGAR  624
            A++YG DVIIGVID+GVWPES SF DDGM  ++PARWKG C S   F  SMCN KLIGAR
Sbjct  132  ASNYGEDVIIGVIDSGVWPESDSFKDDGMTAQVPARWKGIC-SREGFNSSMCNSKLIGAR  190

Query  625  YFNKGLLAKNPN  660
            YFN G++A  PN
Sbjct  191  YFNNGIMAAIPN  202



>ref|XP_002277899.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=769

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 137/210 (65%), Gaps = 17/210 (8%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSID--GQS-ETYIVHMDLSFMPRAFTSHQSWFSATLSS  252
            MA   +L   L    A  + + + +  GQS +TYIVHMD S MP+ F+ H  W+S+ LSS
Sbjct  1    MAAALSLSLKLVCFHAFTISLLASNHLGQSADTYIVHMDSSAMPKPFSGHHGWYSSMLSS  60

Query  253  ISNRG--------------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKV  390
            +S+                L+Y Y+N+I+GFSA L+ +ELEA+KKSPGYL ST D  V+ 
Sbjct  61   VSDASTPTGAAVTPSTTAKLIYTYSNSINGFSASLTLSELEALKKSPGYLSSTPDQFVQP  120

Query  391  DTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQ  570
             T+ +  FLGL    GAW A++YG  VIIG++D+G+WPES SF D+GMG+ P RWKG C 
Sbjct  121  HTTRSHEFLGLRRGSGAWTASNYGNGVIIGLVDSGIWPESASFKDEGMGKPPPRWKGACV  180

Query  571  SGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +   FT SMCN K+IGARY+N+G LAK P+
Sbjct  181  ADANFTSSMCNNKIIGARYYNRGFLAKYPD  210



>ref|XP_004249811.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=683

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 121/179 (68%), Gaps = 12/179 (7%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHG  300
             +  TYIVH+D SFMP+   +HQ+W S  + ++                L+Y+Y + +HG
Sbjct  73   AERSTYIVHLDKSFMPKILATHQNWHSYIIDTVKIEAPTTRNTHHPLPKLLYSYDSVLHG  132

Query  301  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  480
            FSAVLS  E+EA++KSPG++ + KD  V+  T+H+P FL L+   G WPA+ +G DVII 
Sbjct  133  FSAVLSKDEIEALEKSPGFVSAYKDRPVEAHTTHSPEFLKLNPASGLWPASGFGEDVIIR  192

Query  481  VIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            V+DTGVWPES SF DDG+  IP RWKG C+ GT F  S+CN+KLIGA YFNKGLLA +P
Sbjct  193  VLDTGVWPESASFRDDGLSAIPKRWKGICKPGTDFNSSLCNRKLIGANYFNKGLLASDP  251



>ref|XP_008370912.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   197 bits (501),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 123/176 (70%), Gaps = 13/176 (7%)
 Frame = +1

Query  169  TYIVHMDLSFMPRAFTSHQSWFSATLSSISN------------RGLVYAYTNAIHGFSAV  312
            TYIVHMD S MP++++SH  W+ + + S  +              ++Y Y NA HGFSAV
Sbjct  34   TYIVHMDKSLMPKSYSSHGHWYXSIVDSFKSGNPTSFDGNKILPSILYTYDNAFHGFSAV  93

Query  313  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  492
            LS  EL  +KKSPG+  +  D S+ +DT+HT  FL L+   G WPA+DYG D+IIGVIDT
Sbjct  94   LSADELVTLKKSPGFXSAYADKSITLDTTHTTQFLNLNPFAGLWPASDYGDDIIIGVIDT  153

Query  493  GVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            G+WPES+SF D+GM + +PARWKG+C+ G +F  S+CN KLIGARYFNKG++A NP
Sbjct  154  GLWPESESFRDEGMTKSLPARWKGKCEVGQEFNASLCNYKLIGARYFNKGVMAANP  209



>emb|CDY09336.1| BnaA02g26740D [Brassica napus]
Length=727

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 123/170 (72%), Gaps = 6/170 (4%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---NRGLVYAYTNAIHGFSAVLSPAEL  330
            ++  YI+HMDLS  P  FT HQSWFS TL+S++      ++YAYT+++HGFSAVL+ +EL
Sbjct  21   ETSIYIIHMDLSAKPAPFTDHQSWFSTTLTSVTTGRKPKILYAYTDSVHGFSAVLTNSEL  80

Query  331  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
            + ++  PGY+  TKD  VK+ T+ +P F+GL+S+ G WP + YG   +IG++DTG+WP+ 
Sbjct  81   KRLQHKPGYVSFTKDLPVKLQTTFSPQFIGLASNSGTWPVSSYGAGTVIGIVDTGIWPDH  140

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
             SF DDG+G +P+ WKG+C+       S+CNKKLIGAR FNKGL A NPN
Sbjct  141  PSFHDDGLGSVPSTWKGKCEFNYS---SLCNKKLIGARVFNKGLFANNPN  187



>gb|KHN40450.1| Subtilisin-like protease [Glycine soja]
Length=765

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 129/195 (66%), Gaps = 11/195 (6%)
 Frame = +1

Query  103  FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---------  255
            F  +  I+  FL       ++ TYIVHMD S  P  FT+H  WF +T+ SI         
Sbjct  12   FPFMLLITHWFLLALHGSAETSTYIVHMDKSLFPHVFTTHHDWFESTIDSIKSAKLGHSS  71

Query  256  -SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSD  432
              ++ LVY+Y +A++GFSAVL+  ELEA+K S G++ +  D +V +DT+HT  FL L S 
Sbjct  72   NQSQKLVYSYNHAMYGFSAVLTLEELEAVKNSHGFVAAYPDRNVTIDTTHTSEFLSLDSS  131

Query  433  HGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKK  609
             G W A+++G DVI+GVIDTGVWPES+SF D+GM  +IP +WKG C+ G  F  SMCN K
Sbjct  132  SGLWHASNFGEDVIVGVIDTGVWPESESFKDEGMTKKIPNKWKGTCEEGQDFNTSMCNFK  191

Query  610  LIGARYFNKGLLAKN  654
            LIGARYFNKG++A N
Sbjct  192  LIGARYFNKGVIAAN  206



>emb|CAA07060.1| SBT4C protein [Solanum lycopersicum]
Length=779

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 121/185 (65%), Gaps = 12/185 (6%)
 Frame = +1

Query  139  QIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SNRGLVYAY  282
             +F    Q  TYIVH+D S MP  F     W S+T+ SI            S   LVY+Y
Sbjct  24   HLFLAIAQRSTYIVHLDKSLMPNVFLDDHHWHSSTIESIKAAVPSSADRFHSAPKLVYSY  83

Query  283  TNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYG  462
             +  HGFSAVLS  EL A+KKSPG++ + KD +V+ DT++T  +L L+   G WPA+  G
Sbjct  84   DHVFHGFSAVLSKDELAALKKSPGFISAYKDRTVEPDTTYTSDYLKLNPSSGLWPASGLG  143

Query  463  RDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGL  642
            +DVIIGV+D G+WPES SF DDG+ EIP RWKG C  GTQF  SMCN+KL+GA YFNKGL
Sbjct  144  QDVIIGVLDGGIWPESASFQDDGIPEIPKRWKGICTPGTQFNTSMCNRKLVGANYFNKGL  203

Query  643  LAKNP  657
            LA +P
Sbjct  204  LADDP  208



>gb|KHN15887.1| Subtilisin-like protease [Glycine soja]
Length=716

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 122/167 (73%), Gaps = 18/167 (11%)
 Frame = +1

Query  199  MPRAFTSHQSWFSATLSS-------------ISNRGLVYAYTNAIHGFSAVLSPAELEAI  339
            MP+ F++  SW+ +TLSS             +S+  L+Y YTNAI+GFSA LSP ELE++
Sbjct  1    MPKTFSTQHSWYLSTLSSALDNSKATNNLNSVSSSKLIYTYTNAINGFSANLSPKELESL  60

Query  340  KKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSF  519
            K SPGY+   +D   K DT+H+P FLGL+ + GAWP +++G+DVI+G++DTG+WPESKSF
Sbjct  61   KTSPGYVSYMRDLPAKRDTTHSPQFLGLNPNEGAWPVSEFGKDVIVGLVDTGIWPESKSF  120

Query  520  GDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
             D GM EIP+RWKG+C+S  +     CNKKLIGA++FNKG+LA +PN
Sbjct  121  NDKGMTEIPSRWKGQCESTIK-----CNKKLIGAQFFNKGMLANSPN  162



>ref|XP_006847104.1| hypothetical protein AMTR_s00017p00218650 [Amborella trichopoda]
 gb|ERN08685.1| hypothetical protein AMTR_s00017p00218650 [Amborella trichopoda]
Length=755

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 126/176 (72%), Gaps = 4/176 (2%)
 Frame = +1

Query  133  FLQIFSIDGQSE---TYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-GLVYAYTNAIHG  300
             LQ+ S    S+   TYI+HMDLS  P +F++H+ W  + L+S+S   G +Y Y++ +HG
Sbjct  17   ILQLVSASPTSDDYGTYIIHMDLSSKPMSFSTHEQWHKSLLASVSAEAGHLYTYSHVMHG  76

Query  301  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  480
            FSA LS A+L  +++ PG+  + +DA  K+ T+HTP FLGL   +G WP   +GRDVI+G
Sbjct  77   FSARLSRAQLARLEQLPGHRATRRDAYAKLFTTHTPRFLGLRKRNGIWPVASFGRDVIVG  136

Query  481  VIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            +IDTG+WPESKSF D G+  +P RWKG C++GT FTPS+CN+KLIGAR F+KGL A
Sbjct  137  IIDTGIWPESKSFSDHGLSAVPERWKGACENGTGFTPSLCNRKLIGARSFSKGLRA  192



>ref|XP_009129098.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=727

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 123/170 (72%), Gaps = 6/170 (4%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---NRGLVYAYTNAIHGFSAVLSPAEL  330
            ++  +I+HMDLS  P  FT HQSWFS TL+S++      ++YAYT+++HGFSAVL+ +EL
Sbjct  21   ETSIFIIHMDLSAKPAPFTDHQSWFSTTLTSVTTGRKPKILYAYTDSVHGFSAVLTNSEL  80

Query  331  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
            + ++  PGY+  TKD  VK+ T+ +P F+GL+S+ G WP + YG   +IG++DTG+WP+ 
Sbjct  81   KRLQHKPGYVSFTKDLPVKLQTTFSPQFIGLASNSGTWPVSSYGAGTVIGIVDTGIWPDH  140

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
             SF DDG+G +P+ WKG+C+       S+CNKKLIGAR FNKGL A NPN
Sbjct  141  PSFHDDGLGSVPSTWKGKCEFNYS---SLCNKKLIGARVFNKGLFANNPN  187



>ref|XP_007135313.1| hypothetical protein PHAVU_010G118800g [Phaseolus vulgaris]
 gb|ESW07307.1| hypothetical protein PHAVU_010G118800g [Phaseolus vulgaris]
Length=744

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 126/191 (66%), Gaps = 19/191 (10%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS------ISNRG--  267
            L F S   L +     QS  YI+HMD S MP+AF++  +W  +TLSS       SN    
Sbjct  9    LWFSSIIILNLVHTLAQSHNYIIHMDASAMPKAFSTQHAWHLSTLSSALDSAETSNHNNL  68

Query  268  ------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
                  L+Y YTNA++GFSA LSP E EA+K SPGY+ ST D   K+DT+H+PGFLGL+ 
Sbjct  69   DTAYSKLIYTYTNAMNGFSANLSPKEYEALKISPGYVSSTLDLPTKLDTTHSPGFLGLNP  128

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
              GAWPA  +G DVI+G++D+G+WPES+SF D+GM  +P+RWKG+C+S  +     CN K
Sbjct  129  STGAWPAAKFGEDVIVGLVDSGLWPESESFRDEGMSGVPSRWKGQCESSIK-----CNNK  183

Query  610  LIGARYFNKGL  642
            LIGAR+F KG 
Sbjct  184  LIGARFFKKGF  194



>gb|KHN15890.1| Subtilisin-like protease [Glycine soja]
Length=757

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 129/195 (66%), Gaps = 21/195 (11%)
 Frame = +1

Query  124  SATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---------------IS  258
            S   L + S   QSE YI+HMD S MP+ F++  +W+ +TLSS                +
Sbjct  12   SIIVLHLVSRMAQSENYIIHMDSSSMPKLFSTKHNWYLSTLSSALENTHVTTNDNILNTA  71

Query  259  NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  438
            +  L+Y YTN ++GFSA LSP ELEA+K SPGY+ ST D   K+ T+H+P FLGL+   G
Sbjct  72   SSKLIYTYTNVMNGFSANLSPNELEALKNSPGYISSTLDLQAKLHTTHSPQFLGLNPKIG  131

Query  439  AWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIG  618
            AWPA+ +G DVI+G++D+G+W ES+SF D+GM EIP+RWKG+C+S  +     CN KLIG
Sbjct  132  AWPASKFGEDVIVGLVDSGLWLESESFKDEGMTEIPSRWKGQCESSIK-----CNNKLIG  186

Query  619  ARYFNKGL-LAKNPN  660
            AR FNKG   AK PN
Sbjct  187  ARLFNKGFTFAKYPN  201



>ref|XP_010446286.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=504

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 124/171 (73%), Gaps = 6/171 (4%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSS-ISNRG--LVYAYTNAIHGFSAVLSPAE  327
             ++ TYI+HMDLS  P  F+ HQSWFS TL+S I++R   ++YAYT+++HGFSAVL+ +E
Sbjct  21   AETSTYIIHMDLSAKPLPFSDHQSWFSTTLTSVITDRKPKIIYAYTDSVHGFSAVLTNSE  80

Query  328  LEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPE  507
            L+ +K  PG +  TKD  VK+ T+ +P F+ L+   G WP ++ G   +IG+IDTG+WP+
Sbjct  81   LQRLKHKPGNVSFTKDLPVKLHTTFSPQFIDLNLTSGTWPVSNCGAGTVIGIIDTGIWPD  140

Query  508  SKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            S SF DDG G +P++WKGECQ  +    S+CNKKLIGAR FNKGL A NP+
Sbjct  141  SPSFHDDGHGSVPSKWKGECQFNSS---SLCNKKLIGARVFNKGLFANNPD  188



>ref|XP_008657904.1| PREDICTED: subtilisin-like protease [Zea mays]
Length=825

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 122/172 (71%), Gaps = 10/172 (6%)
 Frame = +1

Query  172  YIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------LVYAYTNAIHGFSAVLSPAE  327
            YIVHMD S MPR  + H+ W++AT++S+++          L+Y Y  A+HGF+A LS +E
Sbjct  62   YIVHMDKSAMPRHHSDHRDWYAATVASVTDASAGVRTKPQLLYTYDEALHGFAATLSASE  121

Query  328  LEAIKKSPGYL--YSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVW  501
            L A++  PG++  Y  + A+   DT+H+  FL L+S  G WPA+ +G  VIIG+IDTG+W
Sbjct  122  LRALRGQPGFVSVYPDRRATTLHDTTHSMEFLNLNSASGLWPASKFGEGVIIGMIDTGLW  181

Query  502  PESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            PES SF D GM  +P+RW+G C+ G QFTPSMCN+KL+GARYFN+GL+A NP
Sbjct  182  PESASFNDAGMPPVPSRWRGTCEPGVQFTPSMCNRKLVGARYFNRGLVAANP  233



>gb|AFW84453.1| putative subtilase family protein [Zea mays]
Length=770

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 122/172 (71%), Gaps = 10/172 (6%)
 Frame = +1

Query  172  YIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------LVYAYTNAIHGFSAVLSPAE  327
            YIVHMD S MPR  + H+ W++AT++S+++          L+Y Y  A+HGF+A LS +E
Sbjct  38   YIVHMDKSAMPRHHSDHRDWYAATVASVTDASAGVRTKPQLLYTYDEALHGFAATLSASE  97

Query  328  LEAIKKSPGYL--YSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVW  501
            L A++  PG++  Y  + A+   DT+H+  FL L+S  G WPA+ +G  VIIG+IDTG+W
Sbjct  98   LRALRGQPGFVSVYPDRRATTLHDTTHSMEFLNLNSASGLWPASKFGEGVIIGMIDTGLW  157

Query  502  PESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            PES SF D GM  +P+RW+G C+ G QFTPSMCN+KL+GARYFN+GL+A NP
Sbjct  158  PESASFNDAGMPPVPSRWRGTCEPGVQFTPSMCNRKLVGARYFNRGLVAANP  209



>gb|EYU36338.1| hypothetical protein MIMGU_mgv1a002690mg [Erythranthe guttata]
Length=646

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 116/163 (71%), Gaps = 5/163 (3%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWFSATLSSI-----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKS  348
            MD S MP+AF+SH  W+S+ L+S      S   ++Y Y NA HGFS V++  ELEA+KKS
Sbjct  1    MDKSSMPKAFSSHHHWYSSMLNSAKSLYESEPKIIYTYDNAFHGFSVVMNKHELEALKKS  60

Query  349  PGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDD  528
            PG+L + +D  V  DT+H+  FL L++  G WPA++YG+DVIIG++DTG+WPES SF D+
Sbjct  61   PGFLSAFEDGVVTTDTTHSYKFLSLNTATGLWPASNYGKDVIIGILDTGIWPESPSFRDE  120

Query  529  GMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            GM EIP RWKG CQ G  F  S+CNKKLIG RYFN+G  A  P
Sbjct  121  GMTEIPPRWKGSCQGGQDFNSSLCNKKLIGVRYFNQGTRAAFP  163



>ref|XP_003595551.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES65802.1| subtilisin-like serine protease [Medicago truncatula]
Length=762

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 145/208 (70%), Gaps = 17/208 (8%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN  261
            MA++  L+   ++I++  + IF++   S+ YI+HM+LS MP++F++  SW+ +TL+ ++ 
Sbjct  1    MASNICLWLWFSYITSLHV-IFTL-ALSDNYIIHMNLSDMPKSFSNQHSWYESTLAQVTT  58

Query  262  RG----------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
                        + Y YTN ++GFSA LSP E E++K   G++ S  D  +K+DT+H+P 
Sbjct  59   TNNNLNNSTSSKIFYTYTNVMNGFSANLSPEEHESLKTFSGFISSIPDLPLKLDTTHSPQ  118

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGE-CQ---SGT  579
            FLGL+   GAWP +D+G+D+I+GVIDTGVWPES+SF DDGM +IP++WKG+ CQ   S  
Sbjct  119  FLGLNPYRGAWPTSDFGKDIIVGVIDTGVWPESESFRDDGMTKIPSKWKGQLCQFENSNI  178

Query  580  Q-FTPSMCNKKLIGARYFNKGLLAKNPN  660
            Q    S+CNKKLIGAR+FNKG LAK+ N
Sbjct  179  QSINLSLCNKKLIGARFFNKGFLAKHSN  206



>ref|XP_006280074.1| hypothetical protein CARUB_v10025957mg [Capsella rubella]
 gb|EOA12972.1| hypothetical protein CARUB_v10025957mg [Capsella rubella]
Length=730

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 123/170 (72%), Gaps = 6/170 (4%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---SNRGLVYAYTNAIHGFSAVLSPAEL  330
            ++ TYI+HMDLS  P  F  H+SWFS TL+S+       ++YAYT+++HGFSAVL+ +EL
Sbjct  14   KTSTYIIHMDLSAKPLPFPDHRSWFSTTLTSVITDKKPRIIYAYTDSVHGFSAVLTNSEL  73

Query  331  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
            + +K  PGY+  TKD  VK+ T+ +P F+GL+S  G WP ++YG   +IG+IDTG+W +S
Sbjct  74   QRLKDKPGYVSFTKDLPVKLHTTFSPQFIGLNSASGTWPVSNYGAGTVIGIIDTGIWSDS  133

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
             SF DDG+G +P++WKG CQ  +    S+CNKKLIGAR FN+GL A NP+
Sbjct  134  PSFHDDGVGSVPSKWKGACQFNSS---SLCNKKLIGARVFNQGLFANNPD  180



>ref|XP_004496012.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=761

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 127/190 (67%), Gaps = 7/190 (4%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----RGLVY  276
            L  I+   L       +S TYIVHMD S MP+ FT+HQ+W+ +TL S ++     + L+Y
Sbjct  14   LNIITPFVLLSLHAKAESSTYIVHMDKSLMPQVFTTHQNWYESTLQSTNSEVDQSKKLLY  73

Query  277  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATD  456
             Y +A+HGFSAVLS  +L  +KKS G++ +  D +  +DT+HT  FL L    G W A++
Sbjct  74   TYNHAMHGFSAVLSSNDLNTLKKSHGFVSAYPDRTATIDTTHTFEFLSLDPSKGLWNASN  133

Query  457  YGRDVIIGVIDTGVWPESKSFGDDGMGE-IPARWKGECQSGTQFTPSMCNKKLIGARYFN  633
             G  VI+GVIDTGVWPES+SF D GM + IP +WKG C++G  F  SMCN KLIGARYFN
Sbjct  134  LGEGVIVGVIDTGVWPESESFKDIGMTKNIPTKWKGTCETGQDFNTSMCNLKLIGARYFN  193

Query  634  KGLLA-KNPN  660
            KG++A K PN
Sbjct  194  KGVIASKKPN  203



>ref|XP_010547521.1| PREDICTED: subtilisin-like protease SDD1 [Tarenaya hassleriana]
Length=755

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 132/183 (72%), Gaps = 5/183 (3%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--LVYAYTNA  291
             ++  F +  +   ++ +YIVHMDLS MP  F+ H SWFSATLSS+S R   ++Y+YT++
Sbjct  8    LLTIFFFRSTAAMAETGSYIVHMDLSAMPSPFSDHHSWFSATLSSVSGRKPEIIYSYTDS  67

Query  292  IHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDV  471
            IHGFSA+L+ +ELE++K+  GY+  T+D  V++ T+ +P F+GL+ + G WP ++YG  V
Sbjct  68   IHGFSALLTISELESLKRQTGYVSFTRDFPVQLHTTLSPQFIGLNPNSGIWPVSNYGDGV  127

Query  472  IIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAK  651
            +IG +DTG+WP S SF D+G+  +P++WKG C+  + F   +CNKKLIGAR FNKGLLA 
Sbjct  128  VIGFVDTGIWPGSASFHDEGISSVPSKWKGTCEFNSPF---VCNKKLIGARVFNKGLLAN  184

Query  652  NPN  660
             P+
Sbjct  185  IPS  187



>gb|KEH18576.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 134/202 (66%), Gaps = 13/202 (6%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN  261
            MA++  L+    +I+     IF++      YI+HMDLS MP+A+++  SW+ +TL  ++ 
Sbjct  1    MASNICLYLWFFYITNIHF-IFTL-AHFHNYIIHMDLSAMPKAYSNQHSWYKSTLYRVTT  58

Query  262  RG----------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
                        ++Y YTN ++GFSA LSP E EA+K S GY+ S  D  +K+DT+++P 
Sbjct  59   TNNNLESSTSSKIIYTYTNVMNGFSASLSPKEHEALKTSHGYISSIPDLPLKLDTTYSPQ  118

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGE-CQSGTQFT  588
            FLGL+   G W A+DYG+DVI+GVIDTGVWPES+SF D+G  +IP++WKG+ CQ      
Sbjct  119  FLGLNPYKGVWLASDYGKDVIVGVIDTGVWPESESFNDNGFTKIPSKWKGKLCQFENTNN  178

Query  589  PSMCNKKLIGARYFNKGLLAKN  654
             S CNKKLIGAR+FNKG LA N
Sbjct  179  SSFCNKKLIGARFFNKGFLAMN  200



>ref|XP_007139760.1| hypothetical protein PHAVU_008G056700g [Phaseolus vulgaris]
 gb|ESW11754.1| hypothetical protein PHAVU_008G056700g [Phaseolus vulgaris]
Length=765

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 131/193 (68%), Gaps = 12/193 (6%)
 Frame = +1

Query  112  LAFISATFL-QIFSIDGQSETYIVHMDLSFMPRAFTSHQSWF--------SATL--SSIS  258
            + FI+  FL  +     +S TYIVHMD S  P  FT+H  WF        SATL  SSI 
Sbjct  15   MLFITHWFLLALHGSAAESSTYIVHMDKSLFPHVFTTHHDWFESIMDSTKSATLGHSSIQ  74

Query  259  NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  438
            ++ LVY+Y+ A++GFSAVL+  ELEA+K S G++ +  D +  +DT+HT  FL L S  G
Sbjct  75   SQKLVYSYSIAMYGFSAVLTSEELEAVKNSLGFVAAYPDRTATIDTTHTFEFLSLDSSSG  134

Query  439  AWPATDYGRDVIIGVIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLI  615
             W A+++G DVI+GVID+GVWPES+SF DD M  +IP++WKG CQ G  F  SMCN KLI
Sbjct  135  LWHASNFGEDVIVGVIDSGVWPESESFKDDDMTKKIPSKWKGACQEGQDFNTSMCNFKLI  194

Query  616  GARYFNKGLLAKN  654
            GARYFNKG++A +
Sbjct  195  GARYFNKGVIAAD  207



>ref|XP_003566210.2| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=754

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 122/165 (74%), Gaps = 4/165 (2%)
 Frame = +1

Query  172  YIVHMDLSFMPRAFTSHQSWFSATLS-SISNRGLVYAYTNAIHGFSAVLSPAELEAIKKS  348
            YIVHMD S MPRAF+SH SW+ +TL+ +     + Y Y +A+HGF+A L   +LE +++S
Sbjct  32   YIVHMDKSAMPRAFSSHLSWYESTLAVAAPGADMFYVYDHAMHGFAARLPAEDLEKLRRS  91

Query  349  PGYLYSTKDASVKV--DTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFG  522
            PG++ S +D +  V  DT+HTP FLG+S+  G W AT YG DVI+GV+DTGVWPES S+ 
Sbjct  92   PGFVSSYRDDATAVTRDTTHTPEFLGVSAPGGVWEATQYGEDVIVGVVDTGVWPESASYR  151

Query  523  DDGMGEIPARWKGECQSGTQFTPS-MCNKKLIGARYFNKGLLAKN  654
            DDG+  +PARWKG C+SGT F  + +CN+KL+GAR FNKGL+A +
Sbjct  152  DDGLPPVPARWKGFCESGTAFDAAQVCNRKLVGARKFNKGLIANS  196



>ref|XP_003553772.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=763

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +1

Query  133  FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATL-SSISNRGLVYAYTNAIHGFSA  309
            FL +  +     TYIVHMD S MP+ FTS+ +W+S+TL  S +   ++Y+Y NA+HGFS 
Sbjct  20   FLPVLCLCNSKATYIVHMDKSHMPKVFTSYHNWYSSTLIDSAATPSILYSYDNALHGFSV  79

Query  310  VLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVID  489
             LS  +LE +K++PG++ + +D    +DT+ +  FL L+  HG WPA++Y ++V++GVID
Sbjct  80   SLSQEQLETLKQTPGFISAYRDRETTLDTTQSYTFLSLNHSHGLWPASNYAQNVVVGVID  139

Query  490  TGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            +G+WPES+SF D GM  + P +WKG+C+ G  F  S+CN KLIGA YFNKGLLA
Sbjct  140  SGIWPESESFKDHGMETQTPPKWKGKCEGGQNFDSSLCNSKLIGATYFNKGLLA  193



>ref|XP_004961962.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=762

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 124/178 (70%), Gaps = 4/178 (2%)
 Frame = +1

Query  133  FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGLVYAYTNAIHGFSA  309
             L++ +   ++E+YIVHMD S MPRAF+SHQ W+ +TLS+ +    + Y Y +A HGF+A
Sbjct  25   MLRVPAASAETESYIVHMDKSAMPRAFSSHQRWYESTLSAAAPGADMYYVYDHAAHGFAA  84

Query  310  VLSPAELEAIKKSPGYLYSTKD--ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  483
             L   ELE++++S G++   +D   +V  DT+HTP FLG+S+  G W    YG  VI+GV
Sbjct  85   RLRTEELESLRRSRGFVSCYRDDPRAVTRDTTHTPEFLGVSAQGGLWEEAGYGDGVIVGV  144

Query  484  IDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPS-MCNKKLIGARYFNKGLLAKN  654
            +DTGVWPES SF DDG+  +PARWKG C+SGT F  S  CN+KLIGAR FNKGL+A  
Sbjct  145  VDTGVWPESASFRDDGLPPVPARWKGACESGTAFDGSKACNRKLIGARKFNKGLIASQ  202



>gb|KHN15886.1| Subtilisin-like protease [Glycine soja]
Length=712

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 120/164 (73%), Gaps = 15/164 (9%)
 Frame = +1

Query  199  MPRAFTSHQSWFSATLSSIS----------NRGLVYAYTNAIHGFSAVLSPAELEAIKKS  348
            MP+A++SH +W+ +TLSS            N  L+Y YTN I+GFSA LSP ELEA+K S
Sbjct  1    MPKAYSSHHTWYLSTLSSALENSKATTDNLNSKLIYIYTNVINGFSANLSPKELEALKTS  60

Query  349  PGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDD  528
            PGY+ S +D   K DT+H+P FLGL+ + GAWPA+ +G+D+I+G++DTG+ PESKS+ D+
Sbjct  61   PGYVSSMRDLRAKRDTTHSPQFLGLNKNVGAWPASQFGKDIIVGLVDTGISPESKSYNDE  120

Query  529  GMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            G+ +IP+RWKG+C+S  +     CN KLIGAR+F KG LAK+PN
Sbjct  121  GLTKIPSRWKGQCESSIK-----CNNKLIGARFFIKGFLAKHPN  159



>gb|ABD28577.1| Proteinase inhibitor I9, subtilisin propeptide [Medicago truncatula]
 gb|AES80322.2| subtilisin-like serine protease [Medicago truncatula]
Length=771

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 127/192 (66%), Gaps = 20/192 (10%)
 Frame = +1

Query  145  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-------------------SNRG  267
            F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+                   S + 
Sbjct  21   FHSNAETSTYIIHMNKSFFPQVFTNHHDWFKSTIHSLKSKTLVLDDHDQQEEASMQSQKQ  80

Query  268  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  447
            LVY Y NA++GFSA+LS  ELE +  + G++ + +D +  +DT+HT  FL L S  G W 
Sbjct  81   LVYTYDNAMYGFSALLSSNELETLNNTDGFVAAYQDRTATMDTTHTFEFLSLDSPSGLWH  140

Query  448  ATDYGRDVIIGVIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGAR  624
            A+++G D+IIGVID+GVWPES+SF DDGM  +IP +WKG C++G +F  SMCN KLIGAR
Sbjct  141  ASNFGDDIIIGVIDSGVWPESQSFKDDGMTKKIPNKWKGTCETGHKFNASMCNFKLIGAR  200

Query  625  YFNKGLLAKNPN  660
             FNKG++A NPN
Sbjct  201  SFNKGVIASNPN  212



>ref|XP_007143987.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
 gb|ESW15981.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
Length=763

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 129/205 (63%), Gaps = 13/205 (6%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQI-FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS  258
            M +H  +   L F+   +L +    + +S TY+VHMD + MP+ F +H  W+ + + SI 
Sbjct  1    MESHFVVPLPLMFLITLWLLLAHHANAESSTYVVHMDKTLMPQVFATHHDWYQSIIHSID  60

Query  259  NR-----------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHT  405
                          LVY+Y +A+HGFSAVLS  ELE +KK  G++ +  D S  +DT+HT
Sbjct  61   LETADDPSKQQVLKLVYSYDDAMHGFSAVLSSEELETVKKVDGFVTAYPDRSATIDTTHT  120

Query  406  PGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGE-IPARWKGECQSGTQ  582
              FL L + +G W A+++G  VI+G+IDTG+WPES SF DDGM   IP++WKG C+ G  
Sbjct  121  FEFLSLDTPNGLWNASNFGEGVIVGLIDTGIWPESDSFKDDGMSRNIPSKWKGTCEPGQD  180

Query  583  FTPSMCNKKLIGARYFNKGLLAKNP  657
            F  SMCN KLIGARYFNKG+ A NP
Sbjct  181  FNASMCNFKLIGARYFNKGVKAANP  205



>dbj|BAJ88882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 121/167 (72%), Gaps = 3/167 (2%)
 Frame = +1

Query  163  SETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGLVYAYTNAIHGFSAVLSPAELEAI  339
            S +YIVHMD S MP  F SH SW+ +TL++ +    + Y Y +A+HGF+A L   EL+ +
Sbjct  27   SSSYIVHMDKSAMPTGFASHLSWYESTLAAAAPGADMFYVYDHAMHGFAARLPAEELDRL  86

Query  340  KKSPGYLYSTKD-ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKS  516
            ++SPG++   +D A V  DT+HTP FLG+S+  G W A+ YG DVIIGV+DTGVWPES S
Sbjct  87   RRSPGFVSCYRDDARVVRDTTHTPEFLGVSAAGGIWEASKYGEDVIIGVVDTGVWPESAS  146

Query  517  FGDDGMGEIPARWKGECQSGTQFTPS-MCNKKLIGARYFNKGLLAKN  654
            F DDG+  +PARWKG C+SGT F  + +CN+KL+GAR FNKGL+A N
Sbjct  147  FRDDGLPPVPARWKGFCESGTAFDAAKVCNRKLVGARKFNKGLIANN  193



>dbj|BAJ87233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 121/167 (72%), Gaps = 3/167 (2%)
 Frame = +1

Query  163  SETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGLVYAYTNAIHGFSAVLSPAELEAI  339
            S +YIVHMD S MP  F SH SW+ +TL++ +    + Y Y +A+HGF+A L   EL+ +
Sbjct  27   SSSYIVHMDKSAMPTGFASHLSWYESTLAAAAPGADMFYVYDHAMHGFAARLPAEELDRL  86

Query  340  KKSPGYLYSTKD-ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKS  516
            ++SPG++   +D A V  DT+HTP FLG+S+  G W A+ YG DVIIGV+DTGVWPES S
Sbjct  87   RRSPGFVSCYRDDARVVRDTTHTPEFLGVSAAGGIWEASKYGEDVIIGVVDTGVWPESAS  146

Query  517  FGDDGMGEIPARWKGECQSGTQFTPS-MCNKKLIGARYFNKGLLAKN  654
            F DDG+  +PARWKG C+SGT F  + +CN+KL+GAR FNKGL+A N
Sbjct  147  FRDDGLPPVPARWKGFCESGTAFDAAKVCNRKLVGARKFNKGLIANN  193



>ref|XP_006847097.1| hypothetical protein AMTR_s00017p00216950 [Amborella trichopoda]
 gb|ERN08678.1| hypothetical protein AMTR_s00017p00216950 [Amborella trichopoda]
Length=754

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 117/160 (73%), Gaps = 1/160 (1%)
 Frame = +1

Query  172  YIVHMDLSFMPRAFTSHQSWFSATLSSISNR-GLVYAYTNAIHGFSAVLSPAELEAIKKS  348
            YI+H+D S  P +F SH+ W  + L+S+S   G +Y Y++ +HGFSA LS A+L  +++ 
Sbjct  32   YIIHVDNSHKPNSFFSHEEWHKSMLASVSAEAGHLYTYSHVMHGFSARLSRAQLAQLEQL  91

Query  349  PGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDD  528
            PG+  + +DA  K+ T+HTP FLGL   +G WP   +GRDVI+G+IDTG+WPES+SF D 
Sbjct  92   PGHRATRRDAYAKLFTTHTPRFLGLRKKNGIWPVASFGRDVIVGIIDTGIWPESESFSDH  151

Query  529  GMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            G+  +P RWKG C++GT FTPS+CN+KLIGAR F+KGL A
Sbjct  152  GLSAVPERWKGACENGTGFTPSLCNRKLIGARSFSKGLRA  191



>ref|XP_002282856.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
 emb|CBI19500.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 133/201 (66%), Gaps = 12/201 (6%)
 Frame = +1

Query  94   RALFFHLAFISATFLQIFSIDG------QSETYIVHMDLSFMPRAFTSHQSWFSATLSSI  255
            R+LF H A +S   L +  I+       + +TYI+HMD S+ P +F++H+SW  +TL S+
Sbjct  8    RSLFSHHAVLSWLLLLLLGINNAMSELEERQTYIIHMDHSYKPDSFSTHESWHLSTLKSV  67

Query  256  S------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  417
            S         L+Y+Y++ + GFSA L+P+EL  ++KSP +  + ++   K+ T+HT  FL
Sbjct  68   STSPVNHKEMLLYSYSHVMQGFSARLTPSELSQLEKSPAHRATYRETFGKLFTTHTTKFL  127

Query  418  GLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSM  597
            GL  + G WPA  YG  VIIG+IDTG+WPES+SF D GM  +P RWKG+C+ GT F+ S 
Sbjct  128  GLKPNSGIWPAASYGDGVIIGIIDTGIWPESRSFSDKGMSPVPERWKGQCEYGTAFSQSC  187

Query  598  CNKKLIGARYFNKGLLAKNPN  660
            CN+KL+GAR F+KGL+A   N
Sbjct  188  CNRKLVGARSFSKGLIAAGRN  208



>emb|CAN60788.1| hypothetical protein VITISV_034534 [Vitis vinifera]
Length=766

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 133/201 (66%), Gaps = 12/201 (6%)
 Frame = +1

Query  94   RALFFHLAFISATFLQIFSIDG------QSETYIVHMDLSFMPRAFTSHQSWFSATLSSI  255
            R+LF H A +S   L +  I+       + +TYI+HMD S+ P +F++H+SW  +TL S+
Sbjct  8    RSLFSHHAVLSWLLLLLLGINNAMSELEERQTYIIHMDHSYKPDSFSTHESWHLSTLKSV  67

Query  256  S------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  417
            S         L+Y+Y++ + GFSA L+P+EL  ++KSP +  + ++   K+ T+HT  FL
Sbjct  68   STSPVNHKEMLLYSYSHVMQGFSARLTPSELSQLEKSPAHRATYRETFGKLFTTHTTKFL  127

Query  418  GLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSM  597
            GL  + G WPA  YG  VIIG+IDTG+WPES+SF D GM  +P RWKG+C+ GT F+ S 
Sbjct  128  GLKPNSGIWPAASYGDGVIIGIIDTGIWPESRSFSDKGMSPVPERWKGQCEYGTAFSQSC  187

Query  598  CNKKLIGARYFNKGLLAKNPN  660
            CN+KL+GAR F+KGL+A   N
Sbjct  188  CNRKLVGARSFSKGLIAAGRN  208



>gb|KHN06360.1| Subtilisin-like protease [Glycine soja]
Length=902

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 122/171 (71%), Gaps = 20/171 (12%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWFSATLSS------ISNRG---------LVYAYTNAIHGFSAVLS  318
            MD S MP+ F+S  +W+ +TLSS      ++N           L+Y Y N ++GFSA LS
Sbjct  1    MDTSSMPKPFSSKHNWYLSTLSSALENTHVTNNDNILNTASSKLIYTYANVMNGFSANLS  60

Query  319  PAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGV  498
            P ELEA+K SPGY+ ST D   K+DT+H+P FLGL+ + GAWPA+ +G DVI+G +D+GV
Sbjct  61   PKELEALKTSPGYISSTPDLQAKLDTTHSPQFLGLNPNKGAWPASKFGEDVIVGFVDSGV  120

Query  499  WPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAK  651
            WPES+SF D+GM +IP+RWKG+C+S  +     CNKKLIGA++FNKGL+AK
Sbjct  121  WPESESFKDEGMTQIPSRWKGQCESSIK-----CNKKLIGAQFFNKGLVAK  166



>dbj|BAJ90426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 3/174 (2%)
 Frame = +1

Query  142  IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGLVYAYTNAIHGFSAVLS  318
            + S+D  + +YIVHMD S MP  F+SH  W+ + L++ +    + Y Y +A+HGF+A L 
Sbjct  10   VASVDAPAASYIVHMDKSAMPSGFSSHLRWYESMLAAAAPGADMFYVYDHAMHGFAARLP  69

Query  319  PAELEAIKKSPGYLYSTKD-ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTG  495
              EL  +++SPG++   +D A V  DT+HTP FLG+S+  G W A+ YG +VIIGV+DTG
Sbjct  70   EEELVRLRRSPGFVSCYRDDARVVRDTTHTPEFLGVSAAGGIWEASKYGENVIIGVVDTG  129

Query  496  VWPESKSFGDDGMGEIPARWKGECQSGTQFTPS-MCNKKLIGARYFNKGLLAKN  654
            VWPES SF DDG+  +PARWKG C+SGT F  + +CN+KL+GAR FNKGL+A N
Sbjct  130  VWPESASFRDDGLPPVPARWKGFCESGTAFDATKVCNRKLVGARKFNKGLIANN  183



>ref|XP_003624104.1| Subtilisin-like protease [Medicago truncatula]
Length=1278

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 127/192 (66%), Gaps = 20/192 (10%)
 Frame = +1

Query  145  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-------------------SNRG  267
            F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+                   S + 
Sbjct  21   FHSNAETSTYIIHMNKSFFPQVFTNHHDWFKSTIHSLKSKTLVLDDHDQQEEASMQSQKQ  80

Query  268  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  447
            LVY Y NA++GFSA+LS  ELE +  + G++ + +D +  +DT+HT  FL L S  G W 
Sbjct  81   LVYTYDNAMYGFSALLSSNELETLNNTDGFVAAYQDRTATMDTTHTFEFLSLDSPSGLWH  140

Query  448  ATDYGRDVIIGVIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGAR  624
            A+++G D+IIGVID+GVWPES+SF DDGM  +IP +WKG C++G +F  SMCN KLIGAR
Sbjct  141  ASNFGDDIIIGVIDSGVWPESQSFKDDGMTKKIPNKWKGTCETGHKFNASMCNFKLIGAR  200

Query  625  YFNKGLLAKNPN  660
             FNKG++A NPN
Sbjct  201  SFNKGVIASNPN  212


 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 124/189 (66%), Gaps = 19/189 (10%)
 Frame = +1

Query  145  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------------SNRGL  270
            F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+                  S + L
Sbjct  784  FHSNAETSTYIIHMNKSFFPQVFTNHHDWFKSTIHSLKSKTLVLDDHDQQEASKQSQKKL  843

Query  271  VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPA  450
            VY Y NA++GF A+LS  ELE IK   G++ + +D +  +DT+HT  FL L S  G W A
Sbjct  844  VYTYDNAMYGFCAMLSSNELEIIKNIDGFVSAYQDRTATIDTTHTFEFLSLDSPSGLWHA  903

Query  451  TDYGRDVIIGVIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGARY  627
            +++G D+I+GVID+GVWPES+SF DDGM  +IP +WKG C++G +F  S+CN KLIGAR 
Sbjct  904  SNFGDDIIVGVIDSGVWPESQSFKDDGMTKKIPNKWKGTCETGHKFNASVCNFKLIGARS  963

Query  628  FNKGLLAKN  654
            FNKG++A N
Sbjct  964  FNKGVIAGN  972



>dbj|BAJ88973.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 130/193 (67%), Gaps = 5/193 (3%)
 Frame = +1

Query  91   HRALF--FHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-N  261
            HR ++    L  ++     + S+D  + +YIVHMD S +P  F+SH  W+ + L++ +  
Sbjct  11   HRTMWPWVALVLVALWVRPVASVDAPAASYIVHMDKSAIPSGFSSHLRWYESMLAAAAPG  70

Query  262  RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKD-ASVKVDTSHTPGFLGLSSDHG  438
              + Y Y +A+HGF+A L   EL  +++SPG++   +D A V  DT+HTP FLG+S+  G
Sbjct  71   ADMFYVYDHAMHGFAARLPEEELVRLRRSPGFVSCYRDDARVVRDTTHTPEFLGVSAAGG  130

Query  439  AWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPS-MCNKKLI  615
             W A+ YG +VIIGV+DTGVWPES SF DDG+  +PARWKG C+SGT F  + +CN+KL+
Sbjct  131  IWEASKYGENVIIGVVDTGVWPESASFRDDGLPPVPARWKGFCESGTAFDATKVCNRKLV  190

Query  616  GARYFNKGLLAKN  654
            GAR FNKGL+A N
Sbjct  191  GARKFNKGLIANN  203



>gb|KDP41712.1| hypothetical protein JCGZ_16119 [Jatropha curcas]
Length=732

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 114/173 (66%), Gaps = 15/173 (9%)
 Frame = +1

Query  184  MDLSFMPRAFTSHQSWFSATLSSISNRGL---------------VYAYTNAIHGFSAVLS  318
            MD S MPR F  H+ W+ +  +S+    L               VY+Y N  HGF+AVLS
Sbjct  1    MDKSLMPRTFNDHKDWYFSITNSLKFTKLSSSETAHRSSPVHPFVYSYENVAHGFAAVLS  60

Query  319  PAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGV  498
            P+ELE ++ S G++ + +D    +DT+HT  FL L+S  G WPA+++G DVIIGVIDTGV
Sbjct  61   PSELETLRNSTGFVSAYRDRMATIDTTHTFEFLSLNSTTGLWPASNFGEDVIIGVIDTGV  120

Query  499  WPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNP  657
            WPES S+ DDGM  +P+RWKG C+ G +FT SMCN KLIGARYFNKG+ A  P
Sbjct  121  WPESLSYKDDGMTPVPSRWKGICEEGEEFTSSMCNSKLIGARYFNKGVKAAAP  173



>gb|ABR16566.1| unknown [Picea sitchensis]
Length=522

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 124/192 (65%), Gaps = 10/192 (5%)
 Frame = +1

Query  97   ALFFHLAFISATFLQIFSID--GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--  264
            ALFF +  ++   L + S D  G  ++YI++MD S MP  F+ HQ W+S+ +  +S    
Sbjct  13   ALFFMIVSLA---LWVPSSDALGARQSYIIYMDKSMMPDHFSLHQHWYSSMIKEVSGSNS  69

Query  265  ---GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  435
                L+Y Y    HGF+A L+  E +A++   G L   +D++  + T+ TP FLGLSS H
Sbjct  70   DPTALLYTYDTVTHGFAACLTSTEAQAMENMDGCLSVFQDSTYGLHTTRTPDFLGLSSSH  129

Query  436  GAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLI  615
            G WP + YG D+I+GV+DTG+WPESKSF D G+  +PARWKGEC+ GT+F  S CN KLI
Sbjct  130  GLWPLSRYGDDIIVGVLDTGIWPESKSFNDQGLTPVPARWKGECEVGTEFNASHCNNKLI  189

Query  616  GARYFNKGLLAK  651
            GARYF KG  AK
Sbjct  190  GARYFLKGYEAK  201



>ref|XP_007017191.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
 gb|EOY14416.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
Length=761

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 122/172 (71%), Gaps = 5/172 (3%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----RGLVYAYTNAIHGFSAVLSPA  324
            + +TY+VHM+ S  P +F++H+ W  +TL S+SN       L+Y+Y + IHGFSA L+ +
Sbjct  35   EYKTYVVHMNHSHKPTSFSTHELWHRSTLRSLSNPVDDEEKLLYSYNHIIHGFSARLTSS  94

Query  325  ELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWP  504
            +L  I+KSP +L + +++  K+ T+H+P FLGL  + G WPA  YG  VIIGV DTG+WP
Sbjct  95   QLSEIEKSPAHLATYQESLGKLFTTHSPEFLGLEHNSGLWPAASYGEGVIIGVFDTGIWP  154

Query  505  ESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            ES+SF D GM ++P  WKG+C++GT F+PS CNKKLIGAR F+KG+ A   N
Sbjct  155  ESESFNDKGMPQVPQNWKGKCENGTAFSPSACNKKLIGARSFSKGIQAAEGN  206



>dbj|BAD82002.1| putative subtilase [Oryza sativa Japonica Group]
Length=757

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 118/174 (68%), Gaps = 11/174 (6%)
 Frame = +1

Query  172  YIVHMDLSFMPRAFTSHQSWFSATLSSISNRG---------LVYAYTNAIHGFSAVLSPA  324
            YIVHMD S MP   + H+ W+SAT+++++            +VY Y  A+HGF+A LS +
Sbjct  34   YIVHMDKSAMPAHHSDHREWYSATVATLTPGAPRGGRGGPRIVYTYDEALHGFAATLSAS  93

Query  325  ELEAIKKSPGYL--YSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGV  498
            EL A++ +PG++  Y  + A V  DT+H+  FL LS   G WPA  +G  VIIGVIDTGV
Sbjct  94   ELGALRLAPGFVSAYPDRRADVLHDTTHSTEFLRLSPFGGLWPAARFGEGVIIGVIDTGV  153

Query  499  WPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            WPES SF D GM  +P+RW+GEC++G  FT  MCN+KLIGARYFN+GL+A NP 
Sbjct  154  WPESASFDDGGMPPVPSRWRGECEAGQDFTLDMCNRKLIGARYFNRGLVAANPT  207



>ref|XP_008382901.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=543

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 124/171 (73%), Gaps = 10/171 (6%)
 Frame = +1

Query  166  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS----------NRGLVYAYTNAIHGFSAVL  315
            +TYI+HMD S  P +F +H++W  +T+ S+S          +  L+Y+Y++ +HGFSA L
Sbjct  28   QTYIIHMDHSHKPESFLTHEAWHKSTVKSLSSSSPXENGDGSEMLLYSYSHVMHGFSARL  87

Query  316  SPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTG  495
            +P++L  ++KSP ++ +  ++  K+ T+H+P FLGL  + G WP   +G+DVIIG+IDTG
Sbjct  88   TPSQLSRLEKSPAHVATYXESFGKMFTTHSPKFLGLRQNLGLWPNASFGQDVIIGIIDTG  147

Query  496  VWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            +WPES+SF D GM ++P RWKG C++GT FTPS+CNKKLIGAR F+KGL A
Sbjct  148  IWPESESFSDKGMSKVPLRWKGVCENGTAFTPSLCNKKLIGARSFSKGLEA  198



>emb|CDM85158.1| unnamed protein product [Triticum aestivum]
Length=764

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 121/189 (64%), Gaps = 15/189 (8%)
 Frame = +1

Query  133  FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVY  276
            FL   + D Q  +YIVHMD S MP A + H+ W+S  L+S++               LVY
Sbjct  19   FLTPVAAD-QRASYIVHMDKSAMPPAHSDHREWYSTVLASLTPAADSSGAASREQPRLVY  77

Query  277  AYTNAIHGFSAVLSPAELEAIKKSPGYL--YSTKDASVKVDTSHTPGFLGLSSDHGAWPA  450
             Y  A+HGF+A LS +EL A+ ++PG++  Y  + + +  DT+H+  FL LS   G WPA
Sbjct  78   IYDEALHGFAATLSASELRALSRAPGFVSAYPDRRSDITHDTTHSTEFLHLSPFGGLWPA  137

Query  451  TDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYF  630
               G DVIIG+IDTGVWPES SF D G+  +P+RW+G C+ G  F  S+CN+KLIGARYF
Sbjct  138  AKLGEDVIIGMIDTGVWPESASFNDAGIAPVPSRWRGTCEPGVAFPASLCNRKLIGARYF  197

Query  631  NKGLLAKNP  657
            NKGL+A NP
Sbjct  198  NKGLVAANP  206



>gb|ABN05870.1| Proteinase inhibitor I9, subtilisin propeptide [Medicago truncatula]
Length=511

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 124/189 (66%), Gaps = 19/189 (10%)
 Frame = +1

Query  145  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------------SNRGL  270
            F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+                  S + L
Sbjct  21   FHSNAETSTYIIHMNKSFFPQVFTNHHDWFKSTIHSLKSKTLVLDDHDQQEASKQSQKKL  80

Query  271  VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPA  450
            VY Y NA++GF A+LS  ELE IK   G++ + +D +  +DT+HT  FL L S  G W A
Sbjct  81   VYTYDNAMYGFCAMLSSNELEIIKNIDGFVSAYQDRTATIDTTHTFEFLSLDSPSGLWHA  140

Query  451  TDYGRDVIIGVIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGARY  627
            +++G D+I+GVID+GVWPES+SF DDGM  +IP +WKG C++G +F  S+CN KLIGAR 
Sbjct  141  SNFGDDIIVGVIDSGVWPESQSFKDDGMTKKIPNKWKGTCETGHKFNASVCNFKLIGARS  200

Query  628  FNKGLLAKN  654
            FNKG++A N
Sbjct  201  FNKGVIAGN  209



>gb|KEH23384.1| subtilisin-like serine protease [Medicago truncatula]
Length=515

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 124/189 (66%), Gaps = 19/189 (10%)
 Frame = +1

Query  145  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------------SNRGL  270
            F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+                  S + L
Sbjct  21   FHSNAETSTYIIHMNKSFFPQVFTNHHDWFKSTIHSLKSKTLVLDDHDQQEASKQSQKKL  80

Query  271  VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPA  450
            VY Y NA++GF A+LS  ELE IK   G++ + +D +  +DT+HT  FL L S  G W A
Sbjct  81   VYTYDNAMYGFCAMLSSNELEIIKNIDGFVSAYQDRTATIDTTHTFEFLSLDSPSGLWHA  140

Query  451  TDYGRDVIIGVIDTGVWPESKSFGDDGM-GEIPARWKGECQSGTQFTPSMCNKKLIGARY  627
            +++G D+I+GVID+GVWPES+SF DDGM  +IP +WKG C++G +F  S+CN KLIGAR 
Sbjct  141  SNFGDDIIVGVIDSGVWPESQSFKDDGMTKKIPNKWKGTCETGHKFNASVCNFKLIGARS  200

Query  628  FNKGLLAKN  654
            FNKG++A N
Sbjct  201  FNKGVIAGN  209



>ref|XP_008357007.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease, partial 
[Malus domestica]
Length=662

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 124/171 (73%), Gaps = 10/171 (6%)
 Frame = +1

Query  166  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS----------NRGLVYAYTNAIHGFSAVL  315
            +TYI+HMD S  P +F +H++W  +T+ S+S          +  L+Y+Y++ +HGFSA L
Sbjct  28   QTYIIHMDHSHKPESFLTHEAWHKSTVKSLSSSSPAENGDGSEMLLYSYSHVMHGFSARL  87

Query  316  SPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTG  495
            +P++L  ++KSP ++ +  ++  K+ T+H+P FLGL  + G WP   +G+DVIIG+IDTG
Sbjct  88   TPSQLSRLEKSPAHVATYPESFGKMFTTHSPKFLGLRQNLGLWPNASFGQDVIIGIIDTG  147

Query  496  VWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            +WPES+SF D GM E+P RWKG C++GT FTPS+CN+KLIGAR F+KGL A
Sbjct  148  IWPESESFSDKGMSEVPLRWKGVCENGTAFTPSLCNRKLIGARSFSKGLEA  198



>ref|XP_010647877.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=693

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 118/173 (68%), Gaps = 5/173 (3%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----LVYAYTNAIHGFSAVLSP  321
            G   +YI+HMD S MP  F+SH  W+ +TLSSIS+        +Y Y + + GFSAVLS 
Sbjct  26   GDVGSYIIHMDKSAMPMTFSSHHDWYMSTLSSISSPDGSLPTHLYTYNHVLDGFSAVLSK  85

Query  322  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVW  501
            A L+ ++K PG+L +  D+  K+ T+H+P FLGL  + GAWP   +G D+IIG++DTGVW
Sbjct  86   AHLDQLEKMPGHLATYPDSFGKLHTTHSPKFLGLEKNSGAWPEGKFGEDMIIGILDTGVW  145

Query  502  PESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            PES+SF D GMG +P RW+G C+SG  F  S CN+KLIGAR F++GL  +  N
Sbjct  146  PESESFRDKGMGPVPKRWRGACESGVAFNSSYCNRKLIGARSFSEGLKRRGLN  198



>gb|KDP41709.1| hypothetical protein JCGZ_16116 [Jatropha curcas]
Length=764

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 120/173 (69%), Gaps = 5/173 (3%)
 Frame = +1

Query  145  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----RGLVYAYTNAIHGFSA  309
            FS   + ETYI+HMD S  P AF + +SW    L S+SN        +Y+Y + +HGFSA
Sbjct  30   FSGSEELETYIIHMDHSHKPAAFLTDESWHRQILKSLSNPVDKKERFLYSYNHVMHGFSA  89

Query  310  VLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVID  489
             L+ +++  ++KSP +L S +++  K+ ++++P FLGL   HG WPA  YG  VIIG++D
Sbjct  90   RLTRSQISELEKSPAHLASYQESFGKLFSTYSPKFLGLKHKHGLWPAASYGEGVIIGILD  149

Query  490  TGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            TG+WPES+SF D GM  +P RWKG+C++GT F+PS CN+KLIGAR F+KGL A
Sbjct  150  TGIWPESESFNDKGMPPVPQRWKGQCENGTAFSPSSCNRKLIGARSFSKGLAA  202



>ref|XP_006847107.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
 gb|ERN08688.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
Length=757

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 125/197 (63%), Gaps = 6/197 (3%)
 Frame = +1

Query  82   MANHRALFFHLAFISATFLQIFSIDG-QSETYIVHMDLSFMPRAFTSHQSWFSA---TLS  249
            MA H      LA  S   L  ++    +  TYI+HMD S MP A  +HQ W  A    LS
Sbjct  1    MATHS--LQSLALFSWLLLHAYASSSIERSTYIIHMDDSAMPSAHKTHQQWHQAILVALS  58

Query  250  SISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  429
             +     +Y+Y +A+HGFSA LSP+EL+ + +S G++ + +D    +DT+HT  F+GL S
Sbjct  59   PVDPPPHLYSYDHALHGFSASLSPSELDELSRSHGFVSAYRDVQATLDTTHTFEFIGLGS  118

Query  430  DHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKK  609
            D G  P + YG  VIIG++DTG+WPES+SF D+GM E+P +WKG C  G  F  S+CN+K
Sbjct  119  DTGLGPKSGYGSGVIIGMVDTGLWPESESFHDNGMPEVPKKWKGGCDPGVAFNSSLCNRK  178

Query  610  LIGARYFNKGLLAKNPN  660
            LIGAR+FNKG+   NPN
Sbjct  179  LIGARFFNKGVEKNNPN  195



>emb|CDP01318.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 126/201 (63%), Gaps = 20/201 (10%)
 Frame = +1

Query  100  LFFHLAFI----SATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI----  255
            LF H   +    SAT L+      +  ++I+HMD S MP  F++ + W+   +S++    
Sbjct  11   LFTHFLAVAVLSSATALE----SAERSSFIIHMDHSLMPLVFSNQEQWYLNAMSNLKSMN  66

Query  256  --------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  411
                    S   L+Y Y +AIHGFSA+LS  ELE +KK PG+L + KD    +DT++T  
Sbjct  67   HPNPHRHQSQPKLLYTYRHAIHGFSAMLSTNELEYLKKLPGFLSAYKDKVGTLDTTYTYK  126

Query  412  FLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTP  591
            FL L+   G WPA+D+G DVI+GVIDTGVWPES S+ D GM ++P+RWKG C  G  F  
Sbjct  127  FLQLNHADGLWPASDFGNDVIVGVIDTGVWPESPSYRDGGMPKVPSRWKGRCAGGEGFNS  186

Query  592  SMCNKKLIGARYFNKGLLAKN  654
            S+CNKKLIG RYFN+G LA N
Sbjct  187  SLCNKKLIGVRYFNQGNLAAN  207



>gb|EYU45084.1| hypothetical protein MIMGU_mgv1a001942mg [Erythranthe guttata]
Length=736

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 125/192 (65%), Gaps = 8/192 (4%)
 Frame = +1

Query  103  FFHLAFISATFLQIFSIDGQSE--TYIVHMDLSFMPRAFTSHQSWFSATLSSISNR----  264
            + H   + +  + ++S  GQ E  TYIVHMD   MP  F SH  W+S+T+SSI +     
Sbjct  3    YIHFLMLFSCLMLVYSNLGQCERSTYIVHMDKEAMPMIFPSHGHWYSSTISSIKSTHVQQ  62

Query  265  --GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  438
               ++Y Y N +HGFSA LS  EL +++ SPG+L +  D ++ +DT+HT  FL L+   G
Sbjct  63   PPEIIYTYDNVVHGFSAQLSEDELHSLENSPGFLTAYIDRNLTLDTTHTYKFLSLNHVTG  122

Query  439  AWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIG  618
             WP ++YG D+I+GVID+GVWPES SF D GM EIP RWKG CQ G  F  S+CN+KLIG
Sbjct  123  LWPTSNYGEDIIVGVIDSGVWPESPSFKDHGMPEIPKRWKGTCQEGPNFNSSLCNRKLIG  182

Query  619  ARYFNKGLLAKN  654
             +YF+KG  A N
Sbjct  183  VQYFDKGAKAAN  194



>gb|KDO84128.1| hypothetical protein CISIN_1g047470mg [Citrus sinensis]
Length=757

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 118/170 (69%), Gaps = 5/170 (3%)
 Frame = +1

Query  166  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----NRGLVYAYTNAIHGFSAVLSPAEL  330
            +TYI+HMD S  P AF +H+SW  + L S S     N  L+Y+Y + I GFSA L+P++L
Sbjct  37   QTYIIHMDHSHKPSAFLTHESWHLSILKSASYPADRNNMLLYSYNHVIQGFSARLTPSQL  96

Query  331  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
              I+KSP +L +  ++  K+ T+H+P FLGL  + G WP+  YG+ VIIG+IDTG+WPES
Sbjct  97   SEIEKSPAHLATYPESFGKLFTTHSPNFLGLKPNSGLWPSARYGQGVIIGIIDTGIWPES  156

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +SF D GM  +P RW G C++GT F+P +CN+KLIGAR F+KGL A   N
Sbjct  157  ESFHDKGMPPVPRRWNGRCENGTAFSPFVCNRKLIGARSFSKGLQAAGIN  206



>ref|XP_006473885.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=757

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 118/170 (69%), Gaps = 5/170 (3%)
 Frame = +1

Query  166  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----NRGLVYAYTNAIHGFSAVLSPAEL  330
            +TYI+HMD S  P AF +H+SW  + L S S     N  L+Y+Y + I GFSA L+P++L
Sbjct  37   QTYIIHMDHSHKPSAFLTHESWHLSILKSASYPADRNNMLLYSYNHVIQGFSARLTPSQL  96

Query  331  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
              I+KSP +L +  ++  K+ T+H+P FLGL  + G WP+  YG+ VIIG+IDTG+WPES
Sbjct  97   SEIEKSPAHLATYPESFGKLFTTHSPNFLGLKPNSGLWPSARYGQGVIIGIIDTGIWPES  156

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +SF D GM  +P RW G C++GT F+P +CN+KLIGAR F+KGL A   N
Sbjct  157  ESFHDKGMPPVPRRWNGRCENGTAFSPFVCNRKLIGARSFSKGLQAAGIN  206



>ref|XP_004972264.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score =   183 bits (464),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 118/173 (68%), Gaps = 10/173 (6%)
 Frame = +1

Query  172  YIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------LVYAYTNAIHGFSAVLSPAE  327
            YIVHMD S MP   + H+ W++AT++S ++          L+Y Y +A+HGF+A  S +E
Sbjct  38   YIVHMDKSAMPPHHSDHREWYAATVASATDASADGRAEPQLLYTYDDALHGFAATFSASE  97

Query  328  LEAIKKSPGYL--YSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVW  501
            L  ++ + G++  Y  + A+   DT+H+  FL LSS  G WPA ++G  VIIG+IDTGVW
Sbjct  98   LRTLRATLGFVSAYPDRRATTLHDTTHSMEFLNLSSVGGLWPAANFGEGVIIGMIDTGVW  157

Query  502  PESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            PES SF D  M  +P+RW+G C+ G +FTPSMCN+KLI ARYFNKGL+A NPN
Sbjct  158  PESASFDDADMPPVPSRWRGTCEPGVEFTPSMCNRKLISARYFNKGLVAANPN  210



>ref|XP_010068558.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=765

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 123/195 (63%), Gaps = 6/195 (3%)
 Frame = +1

Query  94   RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----  258
            R     L  +S     + S   + +TYI+HMD S  P +F +H++W  AT+ SIS     
Sbjct  14   RNAILWLLLLSTVTSFVMSESEERQTYIIHMDHSQKPASFPTHETWHRATVDSISPSLSD  73

Query  259  -NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  435
                 +Y+Y +  HGFSA L+P+EL  I++SP +  + K++  K+ T+H+  FLGL    
Sbjct  74   GEDKFLYSYNHVTHGFSARLTPSELAKIEESPAHRATIKESFGKLFTTHSSKFLGLKHSS  133

Query  436  GAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLI  615
            G WP + YG  VIIG++DTG+WPES SF D GM  +P RWKGEC++GT F+PS CN+KLI
Sbjct  134  GLWPNSSYGEGVIIGILDTGIWPESASFCDKGMPPVPPRWKGECENGTAFSPSNCNRKLI  193

Query  616  GARYFNKGLLAKNPN  660
            GAR F+KGL A   N
Sbjct  194  GARSFSKGLAAAGLN  208



>gb|KCW63975.1| hypothetical protein EUGRSUZ_G01657, partial [Eucalyptus grandis]
Length=743

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 123/195 (63%), Gaps = 6/195 (3%)
 Frame = +1

Query  94   RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----  258
            R     L  +S     + S   + +TYI+HMD S  P +F +H++W  AT+ SIS     
Sbjct  9    RNAILWLLLLSTVTSFVMSESEERQTYIIHMDHSQKPASFPTHETWHRATVDSISPSLSD  68

Query  259  -NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  435
                 +Y+Y +  HGFSA L+P+EL  I++SP +  + K++  K+ T+H+  FLGL    
Sbjct  69   GEDKFLYSYNHVTHGFSARLTPSELAKIEESPAHRATIKESFGKLFTTHSSKFLGLKHSS  128

Query  436  GAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLI  615
            G WP + YG  VIIG++DTG+WPES SF D GM  +P RWKGEC++GT F+PS CN+KLI
Sbjct  129  GLWPNSSYGEGVIIGILDTGIWPESASFCDKGMPPVPPRWKGECENGTAFSPSNCNRKLI  188

Query  616  GARYFNKGLLAKNPN  660
            GAR F+KGL A   N
Sbjct  189  GARSFSKGLAAAGLN  203



>ref|XP_006434736.1| hypothetical protein CICLE_v10003898mg [Citrus clementina]
 gb|ESR47976.1| hypothetical protein CICLE_v10003898mg [Citrus clementina]
Length=757

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 5/170 (3%)
 Frame = +1

Query  166  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----NRGLVYAYTNAIHGFSAVLSPAEL  330
            +TYI+HMD S  P AF +H+SW  + L S S     N  L+Y+Y + I GFSA L+P++L
Sbjct  37   QTYIIHMDHSHKPSAFLTHESWHLSILKSASYPADRNNMLLYSYNHVIQGFSARLTPSQL  96

Query  331  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
              I+KSP +L +  ++  K+ T+H+P FLGL  + G WP+  YG+ VI+G+IDTG+WPES
Sbjct  97   SEIEKSPAHLATYPESFGKLFTTHSPNFLGLKPNSGLWPSARYGQGVIVGIIDTGIWPES  156

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +SF D GM  +P RW G C++GT F+P +CN+KLIGAR F+KGL A   N
Sbjct  157  ESFHDKGMPPVPRRWNGRCENGTAFSPFVCNRKLIGARSFSKGLQAAGIN  206



>gb|EMT18650.1| Subtilisin-like protease [Aegilops tauschii]
Length=682

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 121/190 (64%), Gaps = 16/190 (8%)
 Frame = +1

Query  133  FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATL-------------SSISNRGLV  273
            FL   + D Q  +YIVHMD S MP+A ++H+ W+S  L             +S     LV
Sbjct  19   FLTPVAAD-QRTSYIVHMDKSAMPQALSNHREWYSTVLASLAAAAVDSPGAASGDQPRLV  77

Query  274  YAYTNAIHGFSAVLSPAELEAIKKSPGY--LYSTKDASVKVDTSHTPGFLGLSSDHGAWP  447
            Y Y +A+HGF+A LS +EL A+ ++PG+   Y  + + +  DT+H+  FL LS   G WP
Sbjct  78   YTYDDALHGFAATLSASELRALSRAPGFGSAYPDRRSDITHDTTHSTEFLHLSPFGGLWP  137

Query  448  ATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARY  627
            A   G DVIIG+IDTGVWPES SF D GM  +P+RW+G C+ G  F  S+CN+KLIGARY
Sbjct  138  AAKLGEDVIIGMIDTGVWPESASFNDAGMSPVPSRWRGTCEPGVAFPASLCNRKLIGARY  197

Query  628  FNKGLLAKNP  657
            FN+GL+A NP
Sbjct  198  FNRGLVAANP  207



>gb|EMS48839.1| Subtilisin-like protease [Triticum urartu]
Length=1050

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +1

Query  172  YIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-LVYAYTNAIHGFSAVLSPAELEAIKKS  348
            YIVHMD S MP  F+SH  W+ +TL++ +    + Y Y +A+HGF+A L   EL+ +++S
Sbjct  28   YIVHMDKSAMPSGFSSHLRWYESTLAAAAPAAEMFYVYDHAMHGFAARLPEEELDRLRRS  87

Query  349  PGYLYSTKD-ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGD  525
            PG++   +D A V  DT+HTP FLG+S+  G W A++YG +VIIGV+DTGVWPES SF D
Sbjct  88   PGFVSCYRDDARVVRDTTHTPEFLGVSAAGGIWEASNYGENVIIGVVDTGVWPESASFRD  147

Query  526  DGMGEIPARWKGECQSGTQFTPS-MCNKKLIGARYFNKGLLAKN  654
            DG+  +PARWKG C+SGT F  + +CN+KL+GAR FNKGL+A N
Sbjct  148  DGLPPVPARWKGFCESGTAFDAAKVCNRKLVGARKFNKGLIANN  191



>emb|CAN64996.1| hypothetical protein VITISV_001780 [Vitis vinifera]
Length=769

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 118/173 (68%), Gaps = 5/173 (3%)
 Frame = +1

Query  157  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----LVYAYTNAIHGFSAVLSP  321
            G   +YI+HMD S MP  F+SH  W+ +TLSSIS+        +Y Y + + GFSAV+S 
Sbjct  26   GDVGSYIIHMDKSAMPMTFSSHHDWYMSTLSSISSPDGSLPTHLYTYNHVLDGFSAVMSK  85

Query  322  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVW  501
            A L+ ++K PG+L +  D+  K+ T+H+P FLGL  + GAWP   +G D+II ++DTGVW
Sbjct  86   AHLDQLEKMPGHLATYPDSFGKLHTTHSPKFLGLEKNSGAWPEGKFGEDMIIAILDTGVW  145

Query  502  PESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            PES+SF D GMG +P RW+G C+SG +F  S CN+KLIGAR F++GL  +  N
Sbjct  146  PESESFRDKGMGPVPKRWRGACESGVEFKSSYCNRKLIGARSFSEGLKRRGLN  198



>gb|EMT29812.1| hypothetical protein F775_42283 [Aegilops tauschii]
Length=702

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +1

Query  163  SETYIVHMDLSFMPRAFTSHQSWFSATLS-SISNRGLVYAYTNAIHGFSAVLSPAELEAI  339
            + +YIVHMD S MP  F+SH  W+ +TL+ +     + Y Y +A+HGF+A L   EL+ +
Sbjct  25   ASSYIVHMDKSAMPSGFSSHLRWYESTLAVAAPGAEMFYVYDHAMHGFAARLPEDELDRL  84

Query  340  KKSPGYLYSTKD-ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKS  516
            ++SPG++   +D A V  DT+HTP FLG+S+  G W A+ YG +VIIGV+DTGVWPES S
Sbjct  85   RRSPGFVSCYRDDARVVRDTTHTPEFLGVSAAGGIWEASKYGENVIIGVVDTGVWPESAS  144

Query  517  FGDDGMGEIPARWKGECQSGTQFTPS-MCNKKLIGARYFNKGLLA  648
            F DDG+  +PARWKG C+SGT F  + +CN+KL+GAR FNKGL+A
Sbjct  145  FRDDGLPPVPARWKGFCESGTAFDAAKVCNRKLVGARKFNKGLIA  189



>ref|XP_008220348.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=781

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 132/195 (68%), Gaps = 12/195 (6%)
 Frame = +1

Query  100  LFFHLAFISATFLQIFSIDGQSE---TYIVHMDLSFMPRAFTSHQSWFSATLSSI-----  255
            L+  ++ +    LQI +    +E   TYI+HMD S  P  F +H++W  +TL S+     
Sbjct  24   LYNVISILLLMLLQITNAASNAEEYQTYIIHMDHSHKPAYFLTHEAWHRSTLKSLSSTSP  83

Query  256  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  423
                 +  L+Y+Y++ +HGFSA L+P++L  ++ S  ++ +  ++  K+ T+H+P FLGL
Sbjct  84   ADRDDSEMLLYSYSHVMHGFSARLTPSQLSKLESSSAHVATYPESFGKMFTTHSPKFLGL  143

Query  424  SSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCN  603
              + G WPA  YG+DVIIG+ID+G+WPES+SFGD GM E+P RWKG C++GT FTPS+CN
Sbjct  144  RQNLGLWPAASYGQDVIIGIIDSGIWPESESFGDKGMSEVPERWKGACENGTAFTPSLCN  203

Query  604  KKLIGARYFNKGLLA  648
            KKLIGAR F+KGL A
Sbjct  204  KKLIGARSFSKGLEA  218



>ref|NP_001055646.1| Os05g0435800 [Oryza sativa Japonica Group]
 gb|AAT58881.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF17560.1| Os05g0435800 [Oryza sativa Japonica Group]
 gb|EEE63841.1| hypothetical protein OsJ_18665 [Oryza sativa Japonica Group]
Length=761

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 119/168 (71%), Gaps = 5/168 (3%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGLVYAYTNAIHGFSAVLSPAELEA  336
             +  YIVHMD S MPRAF S  SW+ +TL++ +    + Y Y NA+HGF+A ++  ELE 
Sbjct  34   DTAAYIVHMDKSAMPRAFASQASWYESTLAAAAPGADMFYVYDNAMHGFAARVTADELEK  93

Query  337  IKKSPGYL--YSTKDASVKVDTSHTPGFLGLS-SDHGAWPATDYGRDVIIGVIDTGVWPE  507
            ++ S G++  Y     +V+ DT+HTP FLG+S S  G W A++YG DVI+GV+DTGVWPE
Sbjct  94   LRGSRGFVSCYPDDARAVRRDTTHTPEFLGVSASSGGLWEASEYGEDVIVGVVDTGVWPE  153

Query  508  SKSFGDDGMGEIPARWKGECQSGTQFTP-SMCNKKLIGARYFNKGLLA  648
            S SF DDG+  +PARWKG C+SGT F    +CN+KL+GAR FNKGL+A
Sbjct  154  SASFRDDGLPPVPARWKGYCESGTAFDAGKVCNRKLVGARKFNKGLVA  201



>ref|XP_007224572.1| hypothetical protein PRUPE_ppa1027224mg [Prunus persica]
 gb|EMJ25771.1| hypothetical protein PRUPE_ppa1027224mg [Prunus persica]
Length=760

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 131/191 (69%), Gaps = 12/191 (6%)
 Frame = +1

Query  112  LAFISATFLQIFSIDGQSE---TYIVHMDLSFMPRAFTSHQSWFSATLSSIS--------  258
            ++ +    LQI +    +E   TYI+HMD S  P  F +H++W  +TL S+S        
Sbjct  7    ISILLLMLLQITNAASNAEEYQTYIIHMDHSHKPAYFLTHEAWHRSTLKSLSSTSPADRD  66

Query  259  -NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  435
             +  L+Y+Y++ +HGFSA L+P++L  ++ S  ++ +  ++  K+ T+H+P FLGL  + 
Sbjct  67   DSEMLLYSYSHVMHGFSARLTPSQLSKLESSSAHVATYPESFGKMFTTHSPKFLGLRQNL  126

Query  436  GAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLI  615
            G WPA  YG+DVIIG+ID+G+WPES+SFGD GM E+P RWKG C++GT FTPS+CNKKLI
Sbjct  127  GLWPAASYGQDVIIGIIDSGIWPESESFGDKGMSEVPERWKGACENGTAFTPSLCNKKLI  186

Query  616  GARYFNKGLLA  648
            GAR F+KGL A
Sbjct  187  GARSFSKGLEA  197



>ref|XP_008352138.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=620

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 122/171 (71%), Gaps = 10/171 (6%)
 Frame = +1

Query  166  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS----------NRGLVYAYTNAIHGFSAVL  315
            +TYI+HMD S  P +F +H++W  +T+ S+S          +  L+Y+Y++ +HGFSA L
Sbjct  28   QTYIIHMDHSHKPESFLTHEAWHKSTVKSLSSSSPXENGDGSEMLLYSYSHVMHGFSARL  87

Query  316  SPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTG  495
            +P++L  ++KSP ++ +  ++  K+ T+H+P FLGL  + G WP   +G+DVIIG+IDTG
Sbjct  88   TPSQLSRLEKSPAHVATYXESFGKMFTTHSPKFLGLRQNLGLWPNASFGQDVIIGIIDTG  147

Query  496  VWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            +WPES+SF D GM  +P RWKG C++GT FT S+CNKKLIGAR F+KGL A
Sbjct  148  IWPESESFSDKGMSXVPLRWKGVCENGTAFTXSLCNKKLIGARSFSKGLEA  198



>ref|XP_010233560.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=799

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 122/191 (64%), Gaps = 12/191 (6%)
 Frame = +1

Query  118  FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN------RG-LVY  276
             I ATFL   +   +  +YIVHMD S MP   + H++W+S  ++S+++      RG L Y
Sbjct  134  LICATFLAPVAA-AERASYIVHMDKSAMPPRHSGHRAWYSTVVASLADDSSTDGRGELFY  192

Query  277  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKV----DTSHTPGFLGLSSDHGAW  444
             Y +A+HGF+A LS +EL A+   PG++ +  D    V    DT+H+  FLGLS   G  
Sbjct  193  TYDDALHGFAATLSASELRALSSVPGFVSAYPDRRADVGARHDTTHSTEFLGLSPLAGLL  252

Query  445  PATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGAR  624
            PA   G  VI+G+IDTGVWPES SF D GM   P++W+G C+ G  FT +MCN+KLIGAR
Sbjct  253  PAAKLGEGVIVGMIDTGVWPESASFDDAGMSPAPSKWRGTCEPGQAFTAAMCNRKLIGAR  312

Query  625  YFNKGLLAKNP  657
            YFNKGL+A NP
Sbjct  313  YFNKGLVAANP  323



>ref|XP_006374912.1| hypothetical protein POPTR_0014s02640g [Populus trichocarpa]
 gb|ERP52709.1| hypothetical protein POPTR_0014s02640g [Populus trichocarpa]
Length=760

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 117/166 (70%), Gaps = 5/166 (3%)
 Frame = +1

Query  166  ETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----LVYAYTNAIHGFSAVLSPAEL  330
            +TYIVHMD S  P  F +H+SW   TL S+SN        +Y+Y++ + GFSA L+P++L
Sbjct  33   QTYIVHMDSSHKPATFLTHESWHRFTLRSLSNPADGEGTFLYSYSHVMQGFSARLTPSQL  92

Query  331  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
              I+KSP ++ + +++  K+ T+H+P FLGL  + G  P    G  VIIG+IDTG+WPES
Sbjct  93   AEIEKSPAHIGTYRESFGKLFTTHSPKFLGLRQNSGILPTASRGEGVIIGIIDTGIWPES  152

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            +SF D GM  +P RWKG+C++GT F+PS CN+KLIGAR F+KGL+A
Sbjct  153  ESFHDKGMPPVPQRWKGKCENGTAFSPSACNRKLIGARSFSKGLIA  198



>ref|XP_011029629.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=764

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 118/168 (70%), Gaps = 5/168 (3%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----LVYAYTNAIHGFSAVLSPA  324
            + +TYIVHMD S  P  F +H+SW   TL S+SN        +Y+Y++ + GFSA L+P+
Sbjct  35   EYQTYIVHMDNSHKPATFLTHESWHRFTLRSLSNPADGEGTFLYSYSHVMQGFSARLTPS  94

Query  325  ELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWP  504
            +L  I+KSP ++ + +++  K+ T+H+P FLGL  + G  P    G  VIIG+IDTG+WP
Sbjct  95   QLAEIEKSPAHIGTYRESFGKLFTTHSPKFLGLRQNSGILPTASRGEGVIIGIIDTGIWP  154

Query  505  ESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLA  648
            ES+SF D GM  +P RWKG+C++GT F+PS CN+KLIGAR F+KGL+A
Sbjct  155  ESESFHDKGMPPVPQRWKGKCENGTAFSPSACNRKLIGARSFSKGLIA  202



>ref|XP_006655358.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=761

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 118/167 (71%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  QSETYIVHMDLSFMPRAFTSHQSWF-SATLSSISNRGLVYAYTNAIHGFSAVLSPAELEA  336
            + E YIVHMD S MPRAF S  SW+ S   ++     ++Y Y +A+HGF+A ++  E+E 
Sbjct  35   EKEGYIVHMDKSAMPRAFASQASWYESPPAAAAPGADMLYVYDHAMHGFAAGVTAEEMER  94

Query  337  IKKSPGYLYSTKD--ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
            ++ S G++   +D   +V+ DT+HTP FLG+S+  G W A+ YG DVI+GV+DTGVWPES
Sbjct  95   LRASRGFVSCYRDDGRAVRRDTTHTPEFLGVSASGGLWEASRYGEDVIVGVVDTGVWPES  154

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTP-SMCNKKLIGARYFNKGLLA  648
             SF DDG+  +PARWKG C+SGT F    +CN+KL+GAR FNKG++A
Sbjct  155  ASFRDDGLPPVPARWKGYCESGTAFDAGKVCNRKLVGARKFNKGVVA  201



>ref|XP_008793983.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 117/176 (66%), Gaps = 6/176 (3%)
 Frame = +1

Query  151  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------GLVYAYTNAIHGFSAV  312
            +D     YI+HMD S MP  F++H+SW ++ LSS+ +         +Y Y++ +HGFSAV
Sbjct  27   LDDDRRPYIIHMDPSAMPVPFSTHESWHTSILSSLPSPPGAAPPDHLYTYSHVMHGFSAV  86

Query  313  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  492
            LS A +E + + PG++    D+  ++ T+HTP FLGLS   G WP + +G D+IIG++D+
Sbjct  87   LSSAHVEHLARRPGHVAIHPDSYGRLHTTHTPKFLGLSRHSGLWPMSGFGDDMIIGLVDS  146

Query  493  GVWPESKSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            G+WPES SF D GM  IP RWKG C++GT+F  S CN+KLIGARYF KG   +  N
Sbjct  147  GIWPESDSFDDKGMPPIPERWKGTCETGTKFNSSNCNRKLIGARYFGKGQRQRGLN  202



>gb|ACN40199.1| unknown [Picea sitchensis]
Length=766

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 124/212 (58%), Gaps = 25/212 (12%)
 Frame = +1

Query  82   MANHRALFFHLAFISATF-----------------LQIFSIDGQSETYIVHMDLSFMPRA  210
            M N RA +  L F+ A F                  ++  I  QS  YIV+MD S  P  
Sbjct  1    MENSRACYV-LVFVMAAFASGVPNSDALDTSHEQETKVMEITKQS--YIVYMDKSMKPEH  57

Query  211  FTSHQSWFSATLSSISNR-----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKD  375
            F+ HQ W+++ +  +S        ++Y Y    HGF+A L+  E +A++ + G L    D
Sbjct  58   FSLHQHWYTSLIDEVSGSNSDPAAMLYTYDTVTHGFAAKLTSTEAQAMENTDGCLAVFPD  117

Query  376  ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARW  555
            +  ++ T+ TP FLGLSS HG WP + Y  D+I+GV+DTG+WPESKSF D G+ ++PARW
Sbjct  118  SVYRLHTTRTPDFLGLSSSHGLWPLSHYADDIIVGVLDTGIWPESKSFSDQGLTQVPARW  177

Query  556  KGECQSGTQFTPSMCNKKLIGARYFNKGLLAK  651
            KGEC+ GT+F  S CN KLIGAR+F KG  AK
Sbjct  178  KGECEMGTEFNASHCNNKLIGARFFLKGYEAK  209



>gb|ABR18065.1| unknown [Picea sitchensis]
Length=783

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 123/212 (58%), Gaps = 25/212 (12%)
 Frame = +1

Query  82   MANHRALFFHLAFISATF-----------------LQIFSIDGQSETYIVHMDLSFMPRA  210
            M N RA +  L F+ A F                  ++  I  QS  YIV+MD S  P  
Sbjct  1    MENSRACYV-LVFVMAAFASGVPNSDALDTSHEQETKVMEITKQS--YIVYMDKSMKPEH  57

Query  211  FTSHQSWFSATLSSISNR-----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKD  375
            F+ HQ W+++ +  +S        ++Y Y    HGF+A L+  E +A++ + G L    D
Sbjct  58   FSLHQHWYTSLIDEVSGSNSDPAAMLYTYDTVTHGFAAKLTSTEAQAMENTDGCLAVFPD  117

Query  376  ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGDDGMGEIPARW  555
               +V T+ TP FLGLSS HG WP + Y  D+I+GV+DTG+WPESKSF D G+ ++PARW
Sbjct  118  YVYRVHTTRTPDFLGLSSSHGLWPLSHYADDIIVGVLDTGIWPESKSFSDQGLTQVPARW  177

Query  556  KGECQSGTQFTPSMCNKKLIGARYFNKGLLAK  651
            KGEC+ GT+F  S CN KLIGAR+F KG  AK
Sbjct  178  KGECEMGTEFNASHCNNKLIGARFFLKGYEAK  209



>emb|CAN64995.1| hypothetical protein VITISV_001779 [Vitis vinifera]
Length=766

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 117/170 (69%), Gaps = 5/170 (3%)
 Frame = +1

Query  166  ETYIVHMDLSFMPRAFTSHQSWFSATLSSI-SNRGLV----YAYTNAIHGFSAVLSPAEL  330
             TYIVHMD S MP  F+SH  W+ +TLSS  S  G++    Y Y + + GFSAVLS + L
Sbjct  29   RTYIVHMDKSAMPIPFSSHHDWYLSTLSSFYSPDGILPTHLYTYNHVLDGFSAVLSQSHL  88

Query  331  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPES  510
            + ++K PG+L +  +    + T+HTP FLGL ++ G+WP  ++G D++IG++DTG+WPES
Sbjct  89   DQLEKMPGHLATYPETFGTIHTTHTPKFLGLENNFGSWPGGNFGEDMVIGILDTGIWPES  148

Query  511  KSFGDDGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKGLLAKNPN  660
            +SF D GM  +P RW+G C+SG +F  S+CN+KLIGAR F+K L  +  N
Sbjct  149  ESFQDKGMAPVPDRWRGACESGAEFNSSLCNRKLIGARSFSKALKQRGLN  198



>ref|XP_004287970.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=761

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 108/158 (68%), Gaps = 1/158 (1%)
 Frame = +1

Query  169  TYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-LVYAYTNAIHGFSAVLSPAELEAIKK  345
            TYIVHM  S MP +F  H  W+ A+L S S+   ++Y Y+NAIHGFS  L+P E E +K 
Sbjct  28   TYIVHMAKSEMPASFQHHTHWYDASLKSASDSAEMLYTYSNAIHGFSTQLTPEEAEMLKF  87

Query  346  SPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDTGVWPESKSFGD  525
             PG L+   +   ++ T+ TP FLGL  ++  +P +    DVIIGV+DTGVWPESKSF D
Sbjct  88   QPGVLFVLPELKYELHTTRTPEFLGLDQNNELFPESQSASDVIIGVLDTGVWPESKSFDD  147

Query  526  DGMGEIPARWKGECQSGTQFTPSMCNKKLIGARYFNKG  639
             G+G +PA WKG C+ GT F+ S CN+KLIGARYF+KG
Sbjct  148  SGLGPVPASWKGTCEVGTNFSSSACNRKLIGARYFSKG  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320