BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF026A06

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612160.1|  PREDICTED: uncharacterized protein LOC104105529    184   5e-54   Nicotiana tomentosiformis
ref|XP_004238010.1|  PREDICTED: uncharacterized protein LOC101259041    183   7e-54   Solanum lycopersicum
ref|XP_011074276.1|  PREDICTED: uncharacterized protein LOC105159041    175   6e-51   Sesamum indicum [beniseed]
ref|XP_009773482.1|  PREDICTED: uncharacterized protein LOC104223708    174   3e-50   Nicotiana sylvestris
emb|CDP00933.1|  unnamed protein product                                169   2e-48   Coffea canephora [robusta coffee]
gb|KJB58858.1|  hypothetical protein B456_009G228900                    156   2e-43   Gossypium raimondii
ref|XP_008338964.1|  PREDICTED: uncharacterized protein LOC103402004    151   3e-41   Malus domestica [apple tree]
ref|XP_003526555.1|  PREDICTED: anaphase-promoting complex subuni...    150   4e-41   Glycine max [soybeans]
ref|XP_003522769.1|  PREDICTED: uncharacterized protein LOC100799725    146   2e-39   Glycine max [soybeans]
ref|XP_011017014.1|  PREDICTED: uncharacterized protein LOC105120491    145   5e-39   Populus euphratica
ref|XP_010254565.1|  PREDICTED: uncharacterized protein LOC104595511    143   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_007018249.1|  Tetratricopeptide repeat-like superfamily pr...    144   9e-38   
ref|XP_006433807.1|  hypothetical protein CICLE_v10002461mg             140   2e-37   Citrus clementina [clementine]
ref|XP_006472445.1|  PREDICTED: uncharacterized protein LOC102615...    140   3e-37   Citrus sinensis [apfelsine]
ref|XP_002514058.1|  conserved hypothetical protein                     139   7e-37   Ricinus communis
ref|XP_009376255.1|  PREDICTED: uncharacterized protein LOC103964966    139   9e-37   Pyrus x bretschneideri [bai li]
ref|XP_003635542.1|  PREDICTED: uncharacterized protein LOC100854495    137   3e-36   Vitis vinifera
ref|XP_008378598.1|  PREDICTED: uncharacterized protein LOC103441677    138   7e-36   
ref|XP_003602892.1|  hypothetical protein MTR_3g100100                  136   8e-36   Medicago truncatula
ref|XP_002285656.1|  PREDICTED: uncharacterized protein LOC100248933    135   3e-35   Vitis vinifera
gb|AFK38269.1|  unknown                                                 135   3e-35   Medicago truncatula
ref|XP_010086878.1|  hypothetical protein L484_001326                   136   3e-35   
ref|XP_008444918.1|  PREDICTED: uncharacterized protein LOC103488119    134   4e-35   Cucumis melo [Oriental melon]
ref|XP_004152601.1|  PREDICTED: uncharacterized protein LOC101214...    133   1e-34   Cucumis sativus [cucumbers]
ref|XP_007136324.1|  hypothetical protein PHAVU_009G035900g             131   8e-34   Phaseolus vulgaris [French bean]
ref|XP_008219242.1|  PREDICTED: uncharacterized protein LOC103319477    131   1e-33   Prunus mume [ume]
ref|XP_004501659.1|  PREDICTED: uncharacterized protein LOC101488532    130   2e-33   Cicer arietinum [garbanzo]
ref|XP_004288856.2|  PREDICTED: uncharacterized protein LOC101291379    129   8e-33   Fragaria vesca subsp. vesca
gb|KHN08280.1|  hypothetical protein glysoja_017758                     128   1e-32   Glycine soja [wild soybean]
ref|XP_003544833.1|  PREDICTED: uncharacterized protein LOC100809739    127   4e-32   Glycine max [soybeans]
emb|CAN68131.1|  hypothetical protein VITISV_043709                     134   5e-32   Vitis vinifera
gb|KDP41492.1|  hypothetical protein JCGZ_15899                         125   2e-31   Jatropha curcas
ref|XP_002301124.2|  hypothetical protein POPTR_0002s11190g             124   3e-31   Populus trichocarpa [western balsam poplar]
gb|EYU36449.1|  hypothetical protein MIMGU_mgv11b018096mg               120   7e-30   Erythranthe guttata [common monkey flower]
gb|KCW66647.1|  hypothetical protein EUGRSUZ_F00428                     120   1e-29   Eucalyptus grandis [rose gum]
ref|XP_010060105.1|  PREDICTED: uncharacterized protein LOC104448032    120   1e-29   
ref|XP_007141279.1|  hypothetical protein PHAVU_008G182700g             120   2e-29   Phaseolus vulgaris [French bean]
ref|XP_011097467.1|  PREDICTED: uncharacterized protein LOC105176382    115   7e-28   Sesamum indicum [beniseed]
emb|CDP01574.1|  unnamed protein product                                112   2e-26   Coffea canephora [robusta coffee]
gb|EYU39292.1|  hypothetical protein MIMGU_mgv1a013758mg                108   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_008792076.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    108   5e-25   
ref|XP_009399759.1|  PREDICTED: uncharacterized protein LOC103984069    107   2e-24   
ref|XP_011468687.1|  PREDICTED: uncharacterized protein LOC101313748    106   4e-24   Fragaria vesca subsp. vesca
ref|XP_010671644.1|  PREDICTED: uncharacterized protein LOC104888384    104   2e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO81212.1|  hypothetical protein CISIN_1g039398mg                   101   8e-23   Citrus sinensis [apfelsine]
ref|XP_010680361.1|  PREDICTED: uncharacterized protein LOC104895521    101   1e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007227059.1|  hypothetical protein PRUPE_ppa020513mg             100   1e-22   
ref|XP_010914908.1|  PREDICTED: uncharacterized protein LOC105040190    101   2e-22   Elaeis guineensis
ref|XP_008236271.1|  PREDICTED: uncharacterized protein LOC103335053  98.2    3e-21   Prunus mume [ume]
ref|XP_004250524.1|  PREDICTED: uncharacterized protein LOC101263566  97.8    3e-21   Solanum lycopersicum
gb|KDP29775.1|  hypothetical protein JCGZ_18710                       97.8    3e-21   Jatropha curcas
ref|XP_009364809.1|  PREDICTED: uncharacterized protein LOC103954711  97.4    5e-21   Pyrus x bretschneideri [bai li]
ref|XP_008338466.1|  PREDICTED: uncharacterized protein LOC103401529  97.1    7e-21   
ref|XP_006353161.1|  PREDICTED: uncharacterized protein LOC102601514  96.7    9e-21   Solanum tuberosum [potatoes]
ref|XP_002533521.1|  conserved hypothetical protein                   93.6    1e-19   Ricinus communis
ref|XP_007047767.1|  Tetratricopeptide repeat (TPR)-like superfam...  90.1    2e-18   
ref|XP_009768508.1|  PREDICTED: uncharacterized protein LOC104219512  88.2    9e-18   Nicotiana sylvestris
ref|XP_009615438.1|  PREDICTED: uncharacterized protein LOC104108159  87.4    2e-17   Nicotiana tomentosiformis
ref|XP_007205948.1|  hypothetical protein PRUPE_ppa011845mg           85.9    5e-17   
ref|XP_010444514.1|  PREDICTED: uncharacterized protein LOC104727183  85.9    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010484348.1|  PREDICTED: uncharacterized protein LOC104762704  85.9    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002866676.1|  binding protein                                  85.9    7e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_010462984.1|  PREDICTED: uncharacterized protein LOC104743621  85.5    8e-17   Camelina sativa [gold-of-pleasure]
gb|KJB40331.1|  hypothetical protein B456_007G058400                  85.9    1e-16   Gossypium raimondii
ref|NP_201355.1|  tetratricopeptide repeat domain-containing protein  84.7    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28222.1|  hypothetical protein AALP_AA8G488400                  84.0    3e-16   Arabis alpina [alpine rockcress]
ref|XP_010523303.1|  PREDICTED: uncharacterized protein LOC104801678  84.0    4e-16   Tarenaya hassleriana [spider flower]
ref|NP_001147153.1|  TPR domain containing protein                    83.2    6e-16   Zea mays [maize]
ref|XP_007156466.1|  hypothetical protein PHAVU_003G288400g           82.4    1e-15   Phaseolus vulgaris [French bean]
gb|KHN08984.1|  hypothetical protein glysoja_021806                   79.3    7e-15   Glycine soja [wild soybean]
ref|XP_006279866.1|  hypothetical protein CARUB_v10028558mg           82.8    1e-14   
emb|CDY54712.1|  BnaA09g52440D                                        79.0    1e-14   Brassica napus [oilseed rape]
dbj|BAK01291.1|  predicted protein                                    79.0    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS67993.1|  hypothetical protein M569_06781                       77.8    4e-14   Genlisea aurea
ref|XP_009112189.1|  PREDICTED: uncharacterized protein LOC103837585  77.8    4e-14   Brassica rapa
emb|CDX81290.1|  BnaC09g07010D                                        77.8    4e-14   
ref|XP_006394020.1|  hypothetical protein EUTSA_v10005489mg           77.8    4e-14   
gb|ABK23813.1|  unknown                                               75.1    4e-13   Picea sitchensis
gb|ABK26430.1|  unknown                                               75.1    4e-13   Picea sitchensis
ref|XP_004509789.1|  PREDICTED: uncharacterized protein LOC101502186  74.3    6e-13   Cicer arietinum [garbanzo]
gb|KEH20108.1|  TPR domain protein                                    73.6    1e-12   Medicago truncatula
ref|XP_003571513.1|  PREDICTED: uncharacterized protein LOC100820913  72.0    5e-12   Brachypodium distachyon [annual false brome]
ref|XP_006852913.1|  hypothetical protein AMTR_s00033p00228810        71.2    7e-12   
ref|XP_002453513.1|  hypothetical protein SORBIDRAFT_04g007120        70.5    2e-11   
ref|XP_003530607.1|  PREDICTED: uncharacterized protein LOC100813867  67.4    2e-10   Glycine max [soybeans]
gb|ACN40942.1|  unknown                                               62.4    6e-09   Picea sitchensis
ref|XP_006648441.1|  PREDICTED: uncharacterized protein LOC102700687  60.1    2e-08   
ref|XP_004951519.1|  PREDICTED: uncharacterized protein LOC101758681  61.6    2e-08   Setaria italica
gb|ABK93348.1|  unknown                                               57.0    1e-07   Populus trichocarpa [western balsam poplar]
gb|EEC72705.1|  hypothetical protein OsI_06297                        50.8    2e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001046241.1|  Os02g0204000                                     50.8    2e-04   
ref|XP_008382429.1|  PREDICTED: uncharacterized protein LOC103445188  48.9    2e-04   
ref|XP_010030464.1|  PREDICTED: uncharacterized protein LOC104420296  50.4    2e-04   
ref|XP_010089040.1|  Oligopeptidase A                                 49.3    7e-04   



>ref|XP_009612160.1| PREDICTED: uncharacterized protein LOC104105529 [Nicotiana tomentosiformis]
Length=222

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 161/197 (82%), Gaps = 1/197 (1%)
 Frame = +3

Query  48   SISKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLA  227
            S S MW DLLLQAVLIL ++F +LFM+NIPQ  +SKL++R +A  +QA+RHFV GAQ L+
Sbjct  4    SDSNMWRDLLLQAVLILATVFMFLFMYNIPQKFFSKLRLRNRA-DMQAKRHFVQGAQLLS  62

Query  228  QARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNV  407
            QA+++     S   +LAKSAE EA+ AI +D +DAA H+LKA+AL++QGFKTSALD++++
Sbjct  63   QAKSSAAKDRSAAASLAKSAEAEADLAIALDPRDAAAHILKALALDLQGFKTSALDSIDI  122

Query  408  alsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLG  587
            ALSPLA KSLS PE+A+AL KRAEL+LAVS+  Q+DS +EDL ESVRLKGDNVK  CLLG
Sbjct  123  ALSPLAVKSLSEPEKADALFKRAELRLAVSRRGQVDSVIEDLTESVRLKGDNVKAFCLLG  182

Query  588  ECYEKKELSEEARKSYE  638
            +CYEKK L+EEA++ YE
Sbjct  183  DCYEKKGLTEEAQEVYE  199



>ref|XP_004238010.1| PREDICTED: uncharacterized protein LOC101259041 [Solanum lycopersicum]
Length=220

 Score =   183 bits (465),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 160/197 (81%), Gaps = 4/197 (2%)
 Frame = +3

Query  48   SISKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLA  227
            S + MW DLLLQAVLIL++IF +LFM+N+PQ  +SKL++R +A  +Q++RHFV GAQ L+
Sbjct  5    SDNHMWRDLLLQAVLILVTIFMFLFMYNVPQKYFSKLRLRNRA-DMQSKRHFVQGAQLLS  63

Query  228  QARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNV  407
            QA++A     S   +LAKSAE +A+ AI +D KDAA H+LKA+AL++QGFKTSALD+++V
Sbjct  64   QAKSAAAKDRSKSTSLAKSAEAQADLAIALDPKDAAAHILKALALDLQGFKTSALDSIDV  123

Query  408  alsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLG  587
            ALSPLA KSLS PE+A+AL KRA+L+LA    EQ+DS +EDL +SVRLKGDNVK  CLLG
Sbjct  124  ALSPLAVKSLSEPEKADALFKRAQLRLA---AEQVDSVIEDLSQSVRLKGDNVKAFCLLG  180

Query  588  ECYEKKELSEEARKSYE  638
            +CYEKK L EEARK+Y+
Sbjct  181  DCYEKKGLKEEARKAYQ  197



>ref|XP_011074276.1| PREDICTED: uncharacterized protein LOC105159041 [Sesamum indicum]
Length=210

 Score =   175 bits (444),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 153/193 (79%), Gaps = 9/193 (5%)
 Frame = +3

Query  57   KMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQAR  236
            +MW+DLLLQA +ILI++F +LF+H+IPQ L+SKL++  +    +A+RHFVLGAQ L+QAR
Sbjct  4    QMWSDLLLQAAIILIAVFMFLFIHSIPQKLFSKLRLLSRRSNFEAKRHFVLGAQLLSQAR  63

Query  237  TAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVals  416
            ++ D S + R      AE EA++AI ID KDAA H+LKA+ALE+QGFKTSALD++++ALS
Sbjct  64   SSSDRSLAHR------AEAEADRAISIDPKDAAYHILKALALELQGFKTSALDSLDIALS  117

Query  417  plaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
            PLAAKSLS  ERAEAL KRAEL+LAV  G     AVEDL+ESV+LKGDN +   LLGECY
Sbjct  118  PLAAKSLSDGERAEALFKRAELRLAVIDG---GGAVEDLVESVKLKGDNARAYGLLGECY  174

Query  597  EKKELSEEARKSY  635
            EKK L EEARK+Y
Sbjct  175  EKKGLKEEARKAY  187



>ref|XP_009773482.1| PREDICTED: uncharacterized protein LOC104223708 [Nicotiana sylvestris]
Length=222

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 157/197 (80%), Gaps = 1/197 (1%)
 Frame = +3

Query  48   SISKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLA  227
            S + MW DLLLQAVLIL ++F +LFM+NIPQ  +SKL++R +A  +QA+RHFV GAQ L+
Sbjct  4    SDNNMWRDLLLQAVLILATVFMFLFMYNIPQKFFSKLRLRNRA-DMQAKRHFVQGAQLLS  62

Query  228  QARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNV  407
            QA++      S   +LAKSAE EA+ AI +D +DAA H+LKA+AL +QGFKTSALD++++
Sbjct  63   QAKSTFAKDRSAAASLAKSAEAEADLAIALDPRDAAAHILKALALVLQGFKTSALDSIDI  122

Query  408  alsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLG  587
            ALSPLA KSLS PE+A+AL KRAEL+LAVS+  Q+DS VEDL ESVRLKGDNVK   LLG
Sbjct  123  ALSPLAVKSLSEPEKADALFKRAELRLAVSRRGQVDSVVEDLTESVRLKGDNVKAFYLLG  182

Query  588  ECYEKKELSEEARKSYE  638
            +CYEKK L EEA++ YE
Sbjct  183  DCYEKKGLKEEAQEVYE  199



>emb|CDP00933.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            MW+DLL+QA +IL +IF +L+M NIPQ  +SKL++RRQA  +QA+RHF+ GAQ  +QA+ 
Sbjct  1    MWSDLLVQAGMILFTIFMFLYMQNIPQKFFSKLRLRRQA-NVQAKRHFIKGAQLYSQAKL  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            AKD SS+   +LAKSAEEEA+ AI +D+KDAA H+LKA+ LE++G K +A+D ++ ALSP
Sbjct  60   AKDRSSTS--SLAKSAEEEADVAIALDSKDAAAHILKALVLELRGLKAAAIDTLDTALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
              A+SLS  ER +AL KRAEL+LAVS+  Q+DSAVEDL+ESV+L+ DN +  CLLG+ Y+
Sbjct  118  GLARSLSGEERGDALFKRAELRLAVSRRGQVDSAVEDLVESVKLRHDNARAYCLLGDSYK  177

Query  600  KKELSEEARKSYE  638
            KK + EEA+K+YE
Sbjct  178  KKGMVEEAKKAYE  190



>gb|KJB58858.1| hypothetical protein B456_009G228900 [Gossypium raimondii]
Length=212

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 157/194 (81%), Gaps = 4/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            MWTDLLLQA +IL++IF +L MH+IP+ +++K++ R +A   QA+RHFVLGAQ LAQAR+
Sbjct  1    MWTDLLLQAAIILVTIFMFLAMHDIPKKIFTKIRYRNRA-DFQAKRHFVLGAQLLAQARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            +K  S S   +LAK AE EA+KAI +D KDAA ++LKA+AL++QGFKTSALD+++VALSP
Sbjct  60   SK--SRSSTASLAKQAEAEADKAISLDRKDAAAYILKALALDLQGFKTSALDSLDVALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSK-GEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
            +AAKSL+  ER +AL KRAELK+++++ G ++DSA++DL +++ L GDN K  CLLGECY
Sbjct  118  IAAKSLTDKERGDALFKRAELKMSMNRRGGRVDSAIDDLTKALELSGDNAKAFCLLGECY  177

Query  597  EKKELSEEARKSYE  638
            E K++  EA+ ++E
Sbjct  178  EMKKMKSEAKSAFE  191



>ref|XP_008338964.1| PREDICTED: uncharacterized protein LOC103402004 [Malus domestica]
Length=239

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 147/196 (75%), Gaps = 3/196 (2%)
 Frame = +3

Query  54   SKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMR-RQARTIQARRHFVLGAQRLAQ  230
            S++  D+LLQA LIL+ +  +L +HNIPQ L + L+ R R     QA+RHFVLGAQ L Q
Sbjct  24   SRIAKDILLQAGLILVVVVAFLSIHNIPQKLIANLRYRFRNKPAAQAKRHFVLGAQLLGQ  83

Query  231  ARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVa  410
            +R+A   SS+   +L++ A +EAEKAI +D KDAA H+LKA+AL+ QG+KTSALDA++VA
Sbjct  84   SRSANSRSSTA--SLSQQALDEAEKAIALDPKDAAAHILKALALDAQGYKTSALDAIDVA  141

Query  411  lsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGE  590
            LSPL  KSL+  +R +AL KRAE+KL++++  ++DS +EDL  +V L  +NVK  C LGE
Sbjct  142  LSPLCRKSLTEEDRGDALVKRAEIKLSMNRKARVDSVIEDLTRAVELSPENVKAFCTLGE  201

Query  591  CYEKKELSEEARKSYE  638
            CYE K+++EEARK+YE
Sbjct  202  CYEGKKMAEEARKAYE  217



>ref|XP_003526555.1| PREDICTED: anaphase-promoting complex subunit 7-like [Glycine 
max]
Length=222

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 145/194 (75%), Gaps = 3/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRR-QARTIQARRHFVLGAQRLAQAR  236
            M  D+ LQ V I ++IF++L+MH IPQNLY+KL+ R    R +QA+RHFV GAQ LAQAR
Sbjct  9    MIRDVALQVVFISLTIFSFLWMHGIPQNLYAKLRHRPPNPRAVQAKRHFVKGAQLLAQAR  68

Query  237  TAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVals  416
             +K  SS+   +LAK A  EAEKAI +D KDAA HLLK+MAL++QGF+T+ALDA++ ALS
Sbjct  69   RSKSASSAT--SLAKQALAEAEKAIALDPKDAASHLLKSMALDLQGFRTNALDALDAALS  126

Query  417  plaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
            PLAA SL+  ER +AL KRAELK+A+S+   +DS + DL ESV+L   N K  C+LGE Y
Sbjct  127  PLAAGSLAEDERGDALLKRAELKIAMSERRGVDSVLADLTESVKLSPRNAKAWCMLGETY  186

Query  597  EKKELSEEARKSYE  638
            E  ++ EEA+K+Y+
Sbjct  187  EGNKMGEEAKKAYK  200



>ref|XP_003522769.1| PREDICTED: uncharacterized protein LOC100799725 [Glycine max]
Length=221

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 148/194 (76%), Gaps = 4/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRR-QARTIQARRHFVLGAQRLAQAR  236
            M  D+ LQ V I ++IF++L+MH +PQNLY+KL+ R   +R +QA+RHFV GAQ LAQAR
Sbjct  9    MIRDVALQVVFISLTIFSFLWMHGLPQNLYAKLRHRPPNSRAVQAKRHFVQGAQLLAQAR  68

Query  237  TAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVals  416
             +K  S+S   +LAK A  EAEKA+ +D KDAA HLLK+MAL++QGF+T+ALDA++ ALS
Sbjct  69   RSK--SASAATSLAKQALAEAEKALALDPKDAASHLLKSMALDLQGFRTNALDALDAALS  126

Query  417  plaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
            PLAA SL+  ER +AL KRAELK+A+S+  ++DS + DL ESV+L   N K  C+LGECY
Sbjct  127  PLAAGSLAEEERGDALLKRAELKIAMSE-RRVDSVLADLTESVKLSPRNAKAWCMLGECY  185

Query  597  EKKELSEEARKSYE  638
            E  ++ EEA+K+Y+
Sbjct  186  EGNKMGEEAKKAYK  199



>ref|XP_011017014.1| PREDICTED: uncharacterized protein LOC105120491 [Populus euphratica]
Length=212

 Score =   145 bits (365),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M  DLLLQA LIL+ +F +L MHNIPQ   SKL+ R +A  +QA+RHFVLGAQ +AQAR+
Sbjct  1    MIFDLLLQAGLILVGVFMFLAMHNIPQKFLSKLRYRNRA-DLQAKRHFVLGAQLIAQARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
              + S S   +LAK AEEEA KAI +D KDAA H+LKA++L++QGF+TSAL+++NVALSP
Sbjct  60   PSN-SRSTATSLAKQAEEEANKAISLDPKDAASHILKALSLDLQGFRTSALESINVALSP  118

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
            LA KSLS  E+ +AL KRAEL + +++  +++ A++DL E+V+L  DN K  CLLGECYE
Sbjct  119  LAVKSLSASEKGDALFKRAELAMGMNRRGRVEPAIQDLTEAVKLNKDNAKAFCLLGECYE  178

Query  600  KKEL  611
             K++
Sbjct  179  AKKM  182



>ref|XP_010254565.1| PREDICTED: uncharacterized protein LOC104595511 [Nelumbo nucifera]
Length=214

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 145/193 (75%), Gaps = 4/193 (2%)
 Frame = +3

Query  63   W-TDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            W TD+L+Q V +L+++  YL M N P+   +K ++R +A  +QA+RHFV GAQ LA+ART
Sbjct  3    WATDILIQVVFLLLTLGMYLVMQNFPKQALAKFRLRGRA-NVQAKRHFVHGAQLLARART  61

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            A+  SS +  +LAK A +EA+KA+ +D KDAA H+LKA+AL++QG KTSAL +++ ALSP
Sbjct  62   ARSRSSCI--SLAKEATDEADKALSLDPKDAAAHILKALALDLQGHKTSALKSLDAALSP  119

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
             A KSL+  ER +AL KRAEL++ +++  ++DSAV DL+ESV L  +N K  CLLG+CYE
Sbjct  120  PAVKSLTDRERGDALFKRAELQVELNRRRRVDSAVSDLVESVNLSPENSKAFCLLGQCYE  179

Query  600  KKELSEEARKSYE  638
             KE+ EEARK+YE
Sbjct  180  HKEMREEARKAYE  192



>ref|XP_007018249.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY15474.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=296

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            MWTDLLLQ  +IL++IF +L MH+IP+ +++K++ R +A   QA+RHFVLGAQ LAQAR+
Sbjct  1    MWTDLLLQGAIILVTIFMFLAMHDIPKKIFTKIRYRNRA-DFQAKRHFVLGAQLLAQARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            +K  S S   +LAK AE EA KAI +D KDAA ++LKA+AL++QG+KTSALD++++ALSP
Sbjct  60   SK--SRSSTTSLAKQAESEANKAISLDPKDAAAYILKALALDLQGYKTSALDSLDIALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSK-GEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
            LAAKSL+  ER +AL KRAELK+A+++ G  +DSA+EDL ++V L  DN K  CLLGECY
Sbjct  118  LAAKSLTDKERGDALFKRAELKMAMNRRGSGVDSAIEDLTKAVELGADNGKAFCLLGECY  177

Query  597  E  599
            E
Sbjct  178  E  178



>ref|XP_006433807.1| hypothetical protein CICLE_v10002461mg [Citrus clementina]
 ref|XP_006433808.1| hypothetical protein CICLE_v10002461mg [Citrus clementina]
 gb|ESR47047.1| hypothetical protein CICLE_v10002461mg [Citrus clementina]
 gb|ESR47048.1| hypothetical protein CICLE_v10002461mg [Citrus clementina]
Length=212

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 150/194 (77%), Gaps = 4/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            MW D+LLQAVLIL  +F  L ++ IPQ   SKL+ R +  +IQA+RHFV+GAQ LAQAR+
Sbjct  1    MWGDILLQAVLILTGVFMLLALYEIPQKFISKLRFRNRG-SIQAKRHFVIGAQLLAQARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            +K  S S   +LAK AE EA+KAI  D KDAA H+LKA+AL++QGFKTSAL++ ++ALS 
Sbjct  60   SK--SKSSASSLAKQAEAEADKAISFDYKDAAAHILKALALDLQGFKTSALESFDLALSI  117

Query  420  laakslslpERAEALHKRAELKLAVSK-GEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
             A K+L+  E+ +AL KRAE+K+++++   ++DSA++DL E+V+++ DNVK LCLLGECY
Sbjct  118  PAVKTLTEKEKGDALFKRAEVKMSMNRRAGRVDSAIDDLTEAVKIQDDNVKALCLLGECY  177

Query  597  EKKELSEEARKSYE  638
            E K++ +EA+ +YE
Sbjct  178  EVKKMRDEAKTAYE  191



>ref|XP_006472445.1| PREDICTED: uncharacterized protein LOC102615118 isoform X1 [Citrus 
sinensis]
 ref|XP_006472446.1| PREDICTED: uncharacterized protein LOC102615118 isoform X2 [Citrus 
sinensis]
Length=212

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 150/194 (77%), Gaps = 4/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            MW D+LLQAVLIL  +F  L ++ IPQ   SKL+ R +  +IQA+RHFV+GAQ LAQAR+
Sbjct  1    MWGDILLQAVLILTGVFMLLALYEIPQKFISKLRFRNRG-SIQAKRHFVIGAQLLAQARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            +K  S S   +LAK AE EA+KAI  D KDAA H+LKA+AL++QGFKTSAL++ ++ALS 
Sbjct  60   SK--SKSSASSLAKQAEAEADKAISFDYKDAAAHILKALALDLQGFKTSALESFDLALSI  117

Query  420  laakslslpERAEALHKRAELKLAVSK-GEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
             A K+L+  E+ +AL KRAE+K+++++   ++DSA++DL E+V+++ DNVK LCLLGECY
Sbjct  118  PAVKTLTEKEKGDALFKRAEVKMSMNRRAGRVDSAIDDLTEAVKIQDDNVKALCLLGECY  177

Query  597  EKKELSEEARKSYE  638
            E K++ +EA+ +YE
Sbjct  178  EVKKMRDEAKTAYE  191



>ref|XP_002514058.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48641.1| conserved hypothetical protein [Ricinus communis]
Length=214

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M +D+L+QA LILIS+  YL MHNIPQ   +K +  R     +A+R FVLGAQ LAQAR+
Sbjct  1    MMSDILIQAALILISVIMYLAMHNIPQKALAKFREYRGRAGAEAKRQFVLGAQILAQARS  60

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
              + S S  ++LAK AEE A KAI +D KDAA H+LKA++L++QGFK+SALD+++VALSP
Sbjct  61   PSN-SRSRTISLAKQAEEAAIKAISLDPKDAAAHILKALSLDLQGFKSSALDSLDVALSP  119

Query  420  laakslslpERAEALHKRAELKLAVSKGEQ-IDSAVEDLIESVRLKGDNVKGLCLLGECY  596
            LA KSLS  E+ +AL KRAEL + ++K E+ ++SA+EDL E+V L  +N     LLGECY
Sbjct  120  LAVKSLSEREKGDALFKRAELVMGMNKKEKRVESAIEDLKEAVELSKENANAFRLLGECY  179

Query  597  EKKELSEEARKSYE  638
            E KE+SEEA+ +Y+
Sbjct  180  EVKEMSEEAKFAYQ  193



>ref|XP_009376255.1| PREDICTED: uncharacterized protein LOC103964966 [Pyrus x bretschneideri]
Length=241

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 149/196 (76%), Gaps = 1/196 (1%)
 Frame = +3

Query  54   SKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTI-QARRHFVLGAQRLAQ  230
            S++  D+LLQA LIL  +  +L ++NIPQ L++KL+ R + +T  +A+RHFVLGAQ LAQ
Sbjct  24   SRIVKDILLQAGLILFVVIAFLTINNIPQKLFAKLRYRFRNKTAARAKRHFVLGAQLLAQ  83

Query  231  ARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVa  410
            +R+A  LSSS   +L++ A +EAEKAI +  KDAA H+LK++AL+ QG+KTSALDA++VA
Sbjct  84   SRSADSLSSSASASLSQQALDEAEKAIALVPKDAAAHILKSLALDAQGYKTSALDAIDVA  143

Query  411  lsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGE  590
            LSPL  KSL+  ER +AL KRAE+ L++++  Q+D  +EDL  +V L  +NVK  C LGE
Sbjct  144  LSPLCRKSLTDEERGDALVKRAEIMLSMNRKAQVDPVIEDLNRAVELSPENVKAFCTLGE  203

Query  591  CYEKKELSEEARKSYE  638
            CYE K+++EEARK+YE
Sbjct  204  CYEGKKMTEEARKAYE  219



>ref|XP_003635542.1| PREDICTED: uncharacterized protein LOC100854495 [Vitis vinifera]
Length=213

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 144/192 (75%), Gaps = 3/192 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M  D+L+QA L+++++  ++ M+ +P+   +KL+++ +A T+QA RHFV GAQ LA+AR+
Sbjct  1    MAPDVLVQAGLLILTLVIFVAMYKLPKQALAKLRLKNRA-TVQANRHFVQGAQLLARARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            A+  ++S+  TLA+ A  EA KA+ +D KDA   +LKA+AL++QG K+SAL +++ ALSP
Sbjct  60   AQKRATSL--TLAQGAVAEANKALNLDPKDAGAQILKALALDLQGHKSSALRSLDAALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
             A KSLS  ER +AL KRAEL++A+++  ++DSAV DL+E+VRL  DN K  CLLGECYE
Sbjct  118  PAVKSLSDRERGDALFKRAELRVAINRRRRVDSAVADLVEAVRLSEDNCKAFCLLGECYE  177

Query  600  KKELSEEARKSY  635
             K + +EARK++
Sbjct  178  HKGMKDEARKAF  189



>ref|XP_008378598.1| PREDICTED: uncharacterized protein LOC103441677 [Malus domestica]
Length=275

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 146/196 (74%), Gaps = 3/196 (2%)
 Frame = +3

Query  54   SKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTI-QARRHFVLGAQRLAQ  230
            S++  D+LLQA LIL  +  +L +HNIPQ L++KL+ R + +T  +A+RHFVLGAQ LAQ
Sbjct  60   SRIAKDILLQAGLILFVVVAFLTIHNIPQKLFAKLRYRFRNKTAARAKRHFVLGAQLLAQ  119

Query  231  ARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVa  410
            +R+A   S +   +L++ A +EAEKAI +  KDAA H+LK++AL+ QGFKTSALDA+ VA
Sbjct  120  SRSAD--SLASSASLSQQALDEAEKAIALVPKDAAAHILKSLALDAQGFKTSALDAIEVA  177

Query  411  lsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGE  590
            LSPL  KSL+  ER +A+ KRAE+ L++++  Q+D  +EDL  +V L  +NVK  C LGE
Sbjct  178  LSPLCRKSLTDEERGDAVVKRAEIMLSMNRKAQVDPVIEDLNRAVELSPENVKAFCTLGE  237

Query  591  CYEKKELSEEARKSYE  638
            CYE K+++EEARK+YE
Sbjct  238  CYEGKKMTEEARKAYE  253



>ref|XP_003602892.1| hypothetical protein MTR_3g100100 [Medicago truncatula]
 gb|AES73143.1| TPR domain protein [Medicago truncatula]
Length=223

 Score =   136 bits (343),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 137/193 (71%), Gaps = 1/193 (1%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M+ D+ LQ ++IL     +L MH IPQ   +KL+ + + + I+A+RHFV GAQ L QAR+
Sbjct  9    MYRDIGLQVIMILAMALIFLSMHGIPQKFLAKLRFQNR-KAIKAKRHFVRGAQLLTQARS  67

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            +K+ S S    LA  A  EAEKAI +D KDAA +LLKAM L++QGF+TSAL++++ ALSP
Sbjct  68   SKNKSRSAINNLANEALGEAEKAIELDPKDAASYLLKAMILDLQGFRTSALESLDAALSP  127

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
            LAA SL   ER +AL KRAELKLA S+  ++DSA+ DL ESV L   N K  C LGECYE
Sbjct  128  LAAGSLEQGERGDALFKRAELKLATSERGRVDSALADLTESVILSPKNAKAWCALGECYE  187

Query  600  KKELSEEARKSYE  638
             K++ EEA+K+Y+
Sbjct  188  GKKMDEEAKKAYK  200



>ref|XP_002285656.1| PREDICTED: uncharacterized protein LOC100248933 [Vitis vinifera]
Length=216

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 143/194 (74%), Gaps = 1/194 (1%)
 Frame = +3

Query  57   KMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQAR  236
            +M  D+ +Q  +IL ++  +L+M++IP    +KL +      ++A+RHFVLGAQRLAQAR
Sbjct  2    EMVNDIAIQVGMILFTVLLFLYMNDIPGKALAKLSLWYNQTNLEAKRHFVLGAQRLAQAR  61

Query  237  TAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVals  416
            +     S + ++LAK+A EEA+KA+ ++ KDAA H+LKA+AL++QGF+ SALD+++ ALS
Sbjct  62   SPNTPHSDV-ISLAKTAAEEADKALSLNPKDAAAHILKALALDLQGFRLSALDSLDAALS  120

Query  417  plaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
            PLA KSL+  ER +AL KRA+LK+ + K  ++DSAV DL+E+VR+  +  K  CLLGECY
Sbjct  121  PLAVKSLTDEERGDALIKRAQLKIGLDKVGRVDSAVADLVEAVRVGSEKDKAYCLLGECY  180

Query  597  EKKELSEEARKSYE  638
            E KE+ EEA K+Y+
Sbjct  181  EMKEMKEEATKAYQ  194



>gb|AFK38269.1| unknown [Medicago truncatula]
Length=223

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 137/193 (71%), Gaps = 1/193 (1%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M+ D+ LQ ++IL     +L MH IPQ   +KL+ + + + I+A+RHFV GAQ L QAR+
Sbjct  9    MYRDIGLQVIMILAMALIFLSMHGIPQKFLAKLRFQNR-KAIKAKRHFVRGAQLLTQARS  67

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            +K+ S S    LA  A  EAEKAI +D KDAA +LLKAM L++QGF+TSAL++++ ALSP
Sbjct  68   SKNKSRSAINNLANEALGEAEKAIELDPKDAASYLLKAMILDLQGFRTSALESLDAALSP  127

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
            LAA SL   ER +AL KRAELKLA S+  ++DSA+ DL ESV L   N K  C LG+CYE
Sbjct  128  LAAGSLEQGERGDALFKRAELKLATSERGRVDSALADLTESVILSPKNAKAWCALGDCYE  187

Query  600  KKELSEEARKSYE  638
             K++ EEA+K+Y+
Sbjct  188  GKKMDEEAKKAYK  200



>ref|XP_010086878.1| hypothetical protein L484_001326 [Morus notabilis]
 gb|EXB24430.1| hypothetical protein L484_001326 [Morus notabilis]
Length=276

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 146/196 (74%), Gaps = 1/196 (1%)
 Frame = +3

Query  51   ISKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQ  230
            +S M TD+LLQ  LIL+SIF +L +H+IP+ LY+K ++R +++  QA+RHFV+GAQ LA+
Sbjct  1    MSPMVTDILLQVGLILLSIFMFLALHDIPKKLYAKFRLRNRSQA-QAKRHFVVGAQLLAR  59

Query  231  ARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVa  410
            AR+  D S S    LA+ A  EA+KA+ +D  DAA H+L+++ L++QGFK+SALDA++ A
Sbjct  60   ARSRSDSSRSAVAPLAEQALAEADKAVALDPTDAAAHILRSLVLDLQGFKSSALDAIDAA  119

Query  411  lsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGE  590
            LSPLAAKSLS  E  +A  KRAELK+A+ +  +++SA+ DL  +V L  +N +  CLLGE
Sbjct  120  LSPLAAKSLSERELGDAFFKRAELKMAMGRRGKVESAIGDLDRAVELSPENARAFCLLGE  179

Query  591  CYEKKELSEEARKSYE  638
            CYE K++  EARK+YE
Sbjct  180  CYEAKKMEAEARKAYE  195



>ref|XP_008444918.1| PREDICTED: uncharacterized protein LOC103488119 [Cucumis melo]
Length=211

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 141/193 (73%), Gaps = 4/193 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M TD+LLQ  LIL+ +  +L MHNIPQ  ++KL++R ++  ++++RHFV GAQ LA+AR+
Sbjct  1    MVTDILLQIALILVMVVMFLAMHNIPQRYFAKLRLRFRS-NVESKRHFVRGAQLLARARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            A   SS+   +LA+    EA KAI +D KDAA H+LKA+AL+VQGFKTSAL++++ ALSP
Sbjct  60   APSRSSAT--SLAEEVVAEANKAIALDPKDAAAHILKALALDVQGFKTSALESLDTALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
            L AKSLS  ER +AL KRAELK++ ++   +DSA+ DL ESV L   N      LG+CYE
Sbjct  118  LVAKSLSDEERGDALFKRAELKMSTNRRALVDSALADLTESVTL-SQNANSYYWLGKCYE  176

Query  600  KKELSEEARKSYE  638
             K+L EEA+K+YE
Sbjct  177  MKKLREEAKKAYE  189



>ref|XP_004152601.1| PREDICTED: uncharacterized protein LOC101214199 isoform 1 [Cucumis 
sativus]
 ref|XP_004152602.1| PREDICTED: uncharacterized protein LOC101214199 isoform 2 [Cucumis 
sativus]
 ref|XP_004163954.1| PREDICTED: uncharacterized LOC101214199 isoform 1 [Cucumis sativus]
 ref|XP_004163955.1| PREDICTED: uncharacterized LOC101214199 isoform 2 [Cucumis sativus]
 gb|KGN62747.1| hypothetical protein Csa_2G370460 [Cucumis sativus]
Length=214

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 140/193 (73%), Gaps = 4/193 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M TD+LLQ  LIL+ +  +L MHNIPQ  ++KL++R ++  ++++RHFV GAQ LA+AR+
Sbjct  1    MVTDILLQIALILVMVVMFLAMHNIPQRYFAKLRLRFRS-NVESKRHFVRGAQLLARARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            A   SS+   +LA+    EA KAI +D KDAA H+LKA+AL+ QGFKTSAL++++ ALSP
Sbjct  60   APSRSSAT--SLAEEVVAEANKAIALDPKDAAAHILKALALDTQGFKTSALESLDTALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
            L AKSLS  ER +AL KRAELK++ ++   +DSA+ DL ESV L   N      LG+CYE
Sbjct  118  LVAKSLSDEERGDALFKRAELKMSTNRRALVDSALADLTESVTL-SQNANSYYWLGKCYE  176

Query  600  KKELSEEARKSYE  638
             K+L EEA+K+YE
Sbjct  177  TKKLREEAKKAYE  189



>ref|XP_007136324.1| hypothetical protein PHAVU_009G035900g [Phaseolus vulgaris]
 gb|ESW08318.1| hypothetical protein PHAVU_009G035900g [Phaseolus vulgaris]
Length=226

 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 144/194 (74%), Gaps = 4/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRR-QARTIQARRHFVLGAQRLAQAR  236
            M  D+ LQ ++I ++IF++L+MH IPQ LY+KL+ R    R +QA+ HFV GAQ +AQAR
Sbjct  9    MIRDIALQVIVISLAIFSFLWMHGIPQRLYAKLRYRPPNPRAVQAKGHFVKGAQLIAQAR  68

Query  237  TAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVals  416
             +K  ++S+  +LAK A  EAEKAI +D KDAA H LK+MAL++QGF+++ALDA++ ALS
Sbjct  69   RSK--TASVTTSLAKQALAEAEKAIELDPKDAASHFLKSMALDLQGFRSNALDALDAALS  126

Query  417  plaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
            PLAA SL+  ER +AL KRAELK+A+S+  + DS + DL ESV+L   N K  C+LGEC 
Sbjct  127  PLAAASLAADERGDALLKRAELKIALSE-RRADSVLADLNESVKLSPRNAKAWCMLGECC  185

Query  597  EKKELSEEARKSYE  638
            E  E+ EEA+K+Y+
Sbjct  186  EGNEMGEEAKKAYK  199



>ref|XP_008219242.1| PREDICTED: uncharacterized protein LOC103319477 [Prunus mume]
Length=218

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 146/197 (74%), Gaps = 3/197 (2%)
 Frame = +3

Query  51   ISKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMR-RQARTIQARRHFVLGAQRLA  227
            +S+M  DL LQA LIL+ +  +L +HNIPQ L + L+ R R     QA+RHFV+GAQ LA
Sbjct  2    MSQMVKDLFLQAGLILVVVVAFLAIHNIPQKLLANLRFRFRNKPKAQAKRHFVVGAQLLA  61

Query  228  QARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNV  407
            QAR+A   S S   +L++ A +EAEKAI +D KDAA H+LKA+AL+ QG+KTSALDA++V
Sbjct  62   QARSAA--SPSSASSLSQQALDEAEKAISLDPKDAAAHILKALALDSQGYKTSALDAIDV  119

Query  408  alsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLG  587
            ALSP AAKSL+  ER +AL KRAE++L++++  Q+D  + DL  +V L  +NVK  C LG
Sbjct  120  ALSPFAAKSLTEEERGDALVKRAEIRLSMNRRGQVDLVIADLTRAVELSPENVKAFCTLG  179

Query  588  ECYEKKELSEEARKSYE  638
            ECYE K+++EEARK+YE
Sbjct  180  ECYEGKKMTEEARKAYE  196



>ref|XP_004501659.1| PREDICTED: uncharacterized protein LOC101488532 [Cicer arietinum]
Length=228

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 144/193 (75%), Gaps = 1/193 (1%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M+ D+ LQ V+IL+ I  +L MH IPQ L +KL++R +   ++A+RHFV GAQ LAQAR+
Sbjct  9    MYRDIGLQIVMILLLILMFLGMHGIPQKLLAKLRLRNRT-GVKAKRHFVRGAQLLAQARS  67

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            +K+ S S   +LA  A  EAE+AI +D KDAA +LLKAM L++QGF+TSAL++++ ALSP
Sbjct  68   SKNKSRSAINSLANEALAEAEQAIALDPKDAASYLLKAMVLDLQGFRTSALESLDAALSP  127

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
            LAA SL+  ER +AL+KRAELKLA S+  ++DSA++DL ESV L   N K    LGECYE
Sbjct  128  LAAGSLAEGERGDALYKRAELKLATSERGRVDSALKDLTESVILSPKNAKAWSALGECYE  187

Query  600  KKELSEEARKSYE  638
             K++ EEA+K+Y+
Sbjct  188  GKKMEEEAKKAYK  200



>ref|XP_004288856.2| PREDICTED: uncharacterized protein LOC101291379 [Fragaria vesca 
subsp. vesca]
Length=222

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 150/198 (76%), Gaps = 3/198 (2%)
 Frame = +3

Query  54   SKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQART-IQARRHFVLGAQRLAQ  230
            S+M  D+LLQ  L+L+ +  +LF+HN+P+ + + L++R Q+++ IQ++RHFVLGAQ LAQ
Sbjct  3    SQMVDDILLQIGLVLLVVVVFLFIHNVPKRVLANLRLRLQSKSGIQSKRHFVLGAQLLAQ  62

Query  231  ARTAKDLSSSMRMTLaksaee--eaekaIGIdakdaalhllkamalEVQGFKTSALDAMN  404
            AR+A   +SS     + S +    A+KAI +D KDAA H+LKA+AL+ QGFKTSALDA+ 
Sbjct  63   ARSATQSTSSSSSAASLSKQALEHADKAIALDPKDAAAHILKALALDAQGFKTSALDAIE  122

Query  405  ValsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLL  584
            VALSPL  KSL+  ER +AL KRAE+K+++++  ++DS +EDL  +V+L  +NVK  C L
Sbjct  123  VALSPLCRKSLADDERGDALCKRAEIKMSMNRPARVDSVIEDLTLAVKLSPENVKAFCTL  182

Query  585  GECYEKKELSEEARKSYE  638
            GECYE+K+++EEA+K+YE
Sbjct  183  GECYEEKKMTEEAKKAYE  200



>gb|KHN08280.1| hypothetical protein glysoja_017758 [Glycine soja]
Length=208

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 120/194 (62%), Gaps = 17/194 (9%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRR-QARTIQARRHFVLGAQRLAQAR  236
            M  D+ LQ V I ++IF++L+MH +PQNLY+KL+ R   +R +QA+RHFV GAQ LAQAR
Sbjct  9    MIRDVALQVVFISLTIFSFLWMHGLPQNLYAKLRHRPPNSRAVQAKRHFVQGAQLLAQAR  68

Query  237  TAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVals  416
             +K  S++  +                    A      A+  +       ALDA++ ALS
Sbjct  69   RSKSASAATSLA---------------KQALAEAEKALALDPKDAASHLHALDALDAALS  113

Query  417  plaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
            PLAA SL+  ER +AL KRAELK+A+S+  ++DS + DL ESV+L   N K  C+LGECY
Sbjct  114  PLAAGSLAEEERGDALLKRAELKIAMSE-RRVDSVLADLTESVKLSPRNAKAWCMLGECY  172

Query  597  EKKELSEEARKSYE  638
            E  ++ EEA+K+Y+
Sbjct  173  EGNKMGEEAKKAYK  186



>ref|XP_003544833.1| PREDICTED: uncharacterized protein LOC100809739 [Glycine max]
Length=221

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 131/191 (69%), Gaps = 7/191 (4%)
 Frame = +3

Query  63   WTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTA  242
            W D++LQ V++L+ + +Y FMH++P+ L++KL++  +A  IQA+RHFV GAQ LA+AR +
Sbjct  11   WNDIVLQGVMVLVMVLSYFFMHDVPKKLWAKLRLSNRA-DIQAKRHFVQGAQLLARARAS  69

Query  243  KDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValspl  422
            K  + +                  +D  DAA HLLKA+AL+  G +++ALD+++ ALSP 
Sbjct  70   KSKALAKEAQAQAQRAIA------LDPSDAAPHLLKALALDFLGLRSAALDSLDEALSPA  123

Query  423  aakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEK  602
            AAKSLS  ER +AL KRAEL+L  S+  ++DSA+ DL ESVRL  +N K    LG+CYE+
Sbjct  124  AAKSLSDSERGDALLKRAELRLGTSQRGRVDSALADLTESVRLSPNNAKAFFALGDCYER  183

Query  603  KELSEEARKSY  635
            K+++++A ++Y
Sbjct  184  KKMNDDAIRAY  194



>emb|CAN68131.1| hypothetical protein VITISV_043709 [Vitis vinifera]
Length=1169

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 143/194 (74%), Gaps = 1/194 (1%)
 Frame = +3

Query  57    KMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQAR  236
             +M  D+ +Q  +IL ++  +L+M++IP    +KL +      ++A+RHFVLGAQRLAQAR
Sbjct  955   EMVNDIAIQVGMILFTVLLFLYMNDIPGKALAKLSLWYNQTNLEAKRHFVLGAQRLAQAR  1014

Query  237   TAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVals  416
             +     S + ++LAK+A EEA+KA+ ++ KDAA H+LKA+AL++QGF+ SALD+++ ALS
Sbjct  1015  SPNTPHSDV-ISLAKTAAEEADKALSLNPKDAAAHILKALALDLQGFRLSALDSLDAALS  1073

Query  417   plaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
             PLA KSL+  ER +AL KRA+LK+ + K  ++DSAV DL+E+VR+  +  K  CLLGECY
Sbjct  1074  PLAVKSLTDEERGDALIKRAQLKIGLDKVGRVDSAVADLVEAVRVGSEKDKAYCLLGECY  1133

Query  597   EKKELSEEARKSYE  638
             E KE+ EEA K+Y+
Sbjct  1134  EMKEMKEEATKAYQ  1147



>gb|KDP41492.1| hypothetical protein JCGZ_15899 [Jatropha curcas]
Length=218

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 149/196 (76%), Gaps = 1/196 (1%)
 Frame = +3

Query  51   ISKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQ  230
            + KM  D+LLQA+LILI IF YL++H IPQ   +K +  R    ++A+RHFVLGA+ L+ 
Sbjct  1    MEKMVADILLQALLILIGIFGYLYVHEIPQKALAKFREYRSRPGVEAKRHFVLGARTLSL  60

Query  231  ARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVa  410
            AR+  D S S  ++LAK AE+EA+KAI +D KDAA+H+LKA++L++QGFK+SALD+++VA
Sbjct  61   ARSP-DNSHSTTISLAKKAEDEADKAISLDPKDAAVHILKALSLDLQGFKSSALDSLDVA  119

Query  411  lsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGE  590
            LSPLA KSL+  E+ +AL KRAEL +  ++ E++D+A++DL ++V+L  +N     LLGE
Sbjct  120  LSPLAVKSLTESEKGDALFKRAELVVGTNRSERVDAAIQDLTQAVKLNKENANAFRLLGE  179

Query  591  CYEKKELSEEARKSYE  638
            CYE K++ EEA+ +YE
Sbjct  180  CYEAKKMEEEAKSAYE  195



>ref|XP_002301124.2| hypothetical protein POPTR_0002s11190g [Populus trichocarpa]
 gb|EEE80397.2| hypothetical protein POPTR_0002s11190g [Populus trichocarpa]
Length=212

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 128/169 (76%), Gaps = 2/169 (1%)
 Frame = +3

Query  105  IFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaks  284
            +F +L MHNIPQ   SKL+ R +   +QA+RHFVLGAQ +AQAR+  + S S   +LAK 
Sbjct  16   VFMFLAMHNIPQKFLSKLRYRNRT-DLQAKRHFVLGAQLIAQARSPSN-SRSTATSLAKQ  73

Query  285  aeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsplaakslslpERAEAL  464
            AE+EA KAI +D KDAA H+LKA++L++QGF+TSAL+++NVALSPLA KSLS  E+ +AL
Sbjct  74   AEDEANKAISLDPKDAASHILKALSLDLQGFRTSALESINVALSPLAVKSLSASEKGDAL  133

Query  465  HKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKEL  611
             KRAEL + +++  +++ A++DL E+V+L  DN K  CLLGECYE  ++
Sbjct  134  FKRAELAMGMNRRGRVEPAIQDLTEAVKLNKDNAKAFCLLGECYEANKM  182



>gb|EYU36449.1| hypothetical protein MIMGU_mgv11b018096mg [Erythranthe guttata]
Length=208

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 145/193 (75%), Gaps = 6/193 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M  D+LLQ  + L+ +F +LF+H +PQ L SKL++  +   +QARRHFV+GAQ L+QAR+
Sbjct  1    MLFDILLQVAIFLVLLFMFLFVHEVPQKLISKLRLLTRRSNLQARRHFVIGAQLLSQARS  60

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                SSS   +LA+ A  EA+KAI +D K+AA H+LKA+ALE+ GFKTSALD+++ ALSP
Sbjct  61   ----SSSDFRSLAERAAAEADKAIALDPKEAASHILKALALELLGFKTSALDSLDAALSP  116

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
            LAAKSLS  ER +AL KRAEL+ AV  G    +AVEDL+ESVRLKGDN K   LLGECYE
Sbjct  117  LAAKSLSDEERGDALFKRAELRAAVDGGGG--AAVEDLVESVRLKGDNAKAYGLLGECYE  174

Query  600  KKELSEEARKSYE  638
            KK L +EA+K+YE
Sbjct  175  KKGLIDEAQKAYE  187



>gb|KCW66647.1| hypothetical protein EUGRSUZ_F00428 [Eucalyptus grandis]
Length=217

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 146/193 (76%), Gaps = 4/193 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            MW D+LLQA ++L+++F +L MH+IPQ   SKL+ R + + ++A++HFV GAQ L QAR+
Sbjct  1    MWYDILLQAGIMLVTVFMFLAMHDIPQRFLSKLRFRGR-KGLRAKQHFVRGAQLLGQARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            A   S S   +LAK A  EA++AI +D +DAA H+LKA+AL++QGF+TSALD+++VALSP
Sbjct  60   AP--SRSAASSLAKDAAAEADRAILLDPRDAASHILKALALDLQGFRTSALDSLDVALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
            LA++SLS  ER +AL +RAELK A+S+  ++DSA++DL  +V+L     K L LLG+C+E
Sbjct  118  LASRSLSDRERGDALFRRAELKFALSRRGRVDSAIDDLTVAVKLSC-GAKALLLLGQCHE  176

Query  600  KKELSEEARKSYE  638
             K+  EEA K+Y+
Sbjct  177  AKKSKEEAVKAYQ  189



>ref|XP_010060105.1| PREDICTED: uncharacterized protein LOC104448032 [Eucalyptus grandis]
Length=210

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 146/193 (76%), Gaps = 4/193 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            MW D+LLQA ++L+++F +L MH+IPQ   SKL+ R + + ++A++HFV GAQ L QAR+
Sbjct  1    MWYDILLQAGIMLVTVFMFLAMHDIPQRFLSKLRFRGR-KGLRAKQHFVRGAQLLGQARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
            A   S S   +LAK A  EA++AI +D +DAA H+LKA+AL++QGF+TSALD+++VALSP
Sbjct  60   AP--SRSAASSLAKDAAAEADRAILLDPRDAASHILKALALDLQGFRTSALDSLDVALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
            LA++SLS  ER +AL +RAELK A+S+  ++DSA++DL  +V+L     K L LLG+C+E
Sbjct  118  LASRSLSDRERGDALFRRAELKFALSRRGRVDSAIDDLTVAVKLSC-GAKALLLLGQCHE  176

Query  600  KKELSEEARKSYE  638
             K+  EEA K+Y+
Sbjct  177  AKKSKEEAVKAYQ  189



>ref|XP_007141279.1| hypothetical protein PHAVU_008G182700g [Phaseolus vulgaris]
 gb|ESW13273.1| hypothetical protein PHAVU_008G182700g [Phaseolus vulgaris]
Length=220

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 140/191 (73%), Gaps = 7/191 (4%)
 Frame = +3

Query  66   TDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAK  245
             D++LQ  ++++ +  YLFMHN+P+ L+S+L++R +A  IQA+RHFV GAQ LA+AR +K
Sbjct  11   NDIVLQVGMVVLMLLFYLFMHNVPKKLWSELRLRNRA-DIQAKRHFVQGAQLLARARASK  69

Query  246  DLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValspla  425
              + +           +A++AI +D +DAA HLLKA+AL+  GF+++ALD+++ ALSPLA
Sbjct  70   SKALAKEAQ------AQAQRAIALDPRDAAPHLLKALALDFLGFRSAALDSLDDALSPLA  123

Query  426  akslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKK  605
            A SLS  ERA+AL KRAEL+LA ++  ++DSA+ DL ESV+L  +N K    LGEC+E+K
Sbjct  124  ATSLSNSERADALLKRAELRLASTQRARVDSALADLSESVKLSPNNSKAFFALGECFERK  183

Query  606  ELSEEARKSYE  638
            ++++ A ++Y+
Sbjct  184  KMNDAAVEAYQ  194



>ref|XP_011097467.1| PREDICTED: uncharacterized protein LOC105176382 [Sesamum indicum]
Length=211

 Score =   115 bits (288),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 135/194 (70%), Gaps = 5/194 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQAR-TIQARRHFVLGAQRLAQAR  236
            M  D+L+Q  +++ ++  +  +H++P+  +SKL  R QAR + QA RHF+ GAQ L++AR
Sbjct  1    MEKDVLVQLGILIFTLCIFYVLHSLPKRAFSKL--RSQARPSNQAHRHFIQGAQFLSRAR  58

Query  237  TAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVals  416
            + K  + S    LAKSA  EA+KA+ ++ +D A H+LKAMA  + G+KTSAL +++ ALS
Sbjct  59   SMK--TKSTVFNLAKSAVNEADKALALEPRDPAAHILKAMAQSLMGYKTSALKSLDTALS  116

Query  417  plaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECY  596
            P A K LS  E+ +AL KRAEL+  +++  +++SA+ DLIE+V L  DN +  CLLG+CY
Sbjct  117  PPAVKMLSGREKGDALFKRAELQFGLNRKRRVESAIGDLIEAVGLSSDNSRAFCLLGQCY  176

Query  597  EKKELSEEARKSYE  638
            E K L EEA+K++E
Sbjct  177  EIKGLREEAKKAFE  190



>emb|CDP01574.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 130/194 (67%), Gaps = 4/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQART-IQARRHFVLGAQRLAQAR  236
            M TD+ LQ  +++ ++  +  +H++P+   SKL  R +AR  +QA RHF+ GAQ LA+AR
Sbjct  1    MGTDVTLQLAVLIFTLCIFYLLHHLPKQALSKL--RSKARPNVQAHRHFISGAQFLARAR  58

Query  237  TAK-DLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVal  413
            + +   + S    LAKSA  EA+KA+ I  KD A H+LKA+AL++ G K  AL +++VAL
Sbjct  59   SVQFKNNKSTAFNLAKSAATEADKALAIQPKDPAAHILKAVALDIMGHKGPALKSLDVAL  118

Query  414  splaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGEC  593
            SP   K LS  +R +AL KRAEL++A+++  ++DSAV DL+E+V+L  DN     LLG C
Sbjct  119  SPAVVKGLSEKDRGDALFKRAELQIAINRRRRVDSAVSDLVEAVKLSCDNADAFGLLGRC  178

Query  594  YEKKELSEEARKSY  635
            YE K L EEA+ ++
Sbjct  179  YEMKGLMEEAKNAF  192



>gb|EYU39292.1| hypothetical protein MIMGU_mgv1a013758mg [Erythranthe guttata]
Length=211

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 132/192 (69%), Gaps = 3/192 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M  ++LLQ  +++ S+  +  +H++P+ +++KL+ + +    QA RHF+LGAQ L++AR+
Sbjct  1    MEREILLQLGILIFSLGIFYVLHSLPKRVFTKLRSKTRPNN-QAHRHFILGAQLLSRARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
             K  S++    LAKSA +EA+KA+ ++ +D A H+LKAMA  + G KT+A+ +++ ALSP
Sbjct  60   TKTKSTAF--NLAKSAADEADKALALEPRDPAAHILKAMAQGLMGHKTAAVKSLDTALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYE  599
             A K LS  E+ +AL KRAEL+  +++  ++DSA+ DL+E+V L  DN K  CLLG CYE
Sbjct  118  PAVKMLSGTEKGDALFKRAELQFEMNRKRRVDSAISDLVEAVGLNPDNCKAFCLLGRCYE  177

Query  600  KKELSEEARKSY  635
             K L E+A  ++
Sbjct  178  IKGLKEDAMNAF  189



>ref|XP_008792076.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103708778 
[Phoenix dactylifera]
Length=227

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 124/199 (62%), Gaps = 8/199 (4%)
 Frame = +3

Query  63   WTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTA  242
             T++L+Q +L+L ++  +L +H IP+   S L+ RR   +  ARRHF  G Q LA+AR+A
Sbjct  3    GTEILVQGLLLLFALGIFLGLHAIPRRALSGLR-RRSHSSAAARRHFFQGGQLLARARSA  61

Query  243  KDLSSSMRMTLaksaeeeaek-------aIGIdakdaalhllkamalEVQGFKTSALDAM  401
               + +            A         AI ++ +DAA H+LKA+AL++QG    AL A+
Sbjct  62   PSGAXAPPXXXXXXXAALARSAADEADCAIALEPRDAAHHILKALALDLQGRPLPALRAL  121

Query  402  NValsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCL  581
            + ALSP AAKSL+  ER +AL KRAEL LAV++  ++D A+ DL+E+VRL  DN +   L
Sbjct  122  DAALSPPAAKSLAPRERGDALAKRAELHLAVNRRRRLDQALADLLEAVRLSPDNARAFSL  181

Query  582  LGECYEKKELSEEARKSYE  638
            LGECYE K  +EEAR +Y+
Sbjct  182  LGECYEHKAAAEEARTAYQ  200



>ref|XP_009399759.1| PREDICTED: uncharacterized protein LOC103984069 [Musa acuminata 
subsp. malaccensis]
Length=228

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 136/199 (68%), Gaps = 9/199 (5%)
 Frame = +3

Query  54   SKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQA  233
            S +W    +QA+++L ++  +L + + P++  S+L+   Q+ ++QARRHFV GAQ LA+A
Sbjct  9    SSVW----VQALVLLFTLAAFLGLRSFPKHALSRLRRPSQS-SLQARRHFVNGAQLLARA  63

Query  234  RT----AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAM  401
            R                LA+SA +EA++AI +D +DAA H+LKA+AL++ G +  AL ++
Sbjct  64   RARPSGDSSSGGGSTTALARSACDEADRAIALDPRDAAPHILKALALDLLGRRLPALRSL  123

Query  402  NValsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCL  581
            + ALSP A+KSL+  ER +AL KRAEL LAV++  ++D A+ DL+++VRL  +N K  CL
Sbjct  124  DAALSPPASKSLAPRERGDALFKRAELHLAVNRRRRLDQALSDLLQAVRLSPENAKAFCL  183

Query  582  LGECYEKKELSEEARKSYE  638
            LGECYE+K L +EA K+YE
Sbjct  184  LGECYEEKGLLDEATKAYE  202



>ref|XP_011468687.1| PREDICTED: uncharacterized protein LOC101313748 [Fragaria vesca 
subsp. vesca]
Length=255

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 134/199 (67%), Gaps = 7/199 (4%)
 Frame = +3

Query  51   ISKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQ  230
            + KM  +++LQ  L+++++  +  +H + +   +KL+   +A T+QA RHFVLG+Q L +
Sbjct  29   LQKMAAEVVLQVALLILTLTIFYTIHKLSKKALTKLRTNNRA-TLQATRHFVLGSQLLTR  87

Query  231  ARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVa  410
            AR+A   + S   + AK+A  EAE A+ +  +D   H+LKA+AL++ G + +AL +++ A
Sbjct  88   ARSAPHKTQSH--SHAKTALTEAEIALSLSPRDPGPHILKALALDLLGHRAAALRSLDAA  145

Query  411  lsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCL  581
            LSP   K L+  ER EAL KRAELKLAV++  ++DSAVEDL+E+V L   +GD     CL
Sbjct  146  LSPPCVKLLAERERGEALVKRAELKLAVNRRRRVDSAVEDLVEAVGLSEGEGDTT-AFCL  204

Query  582  LGECYEKKELSEEARKSYE  638
            LG+CYE K + EEAR+++E
Sbjct  205  LGQCYEWKNMREEAREAFE  223



>ref|XP_010671644.1| PREDICTED: uncharacterized protein LOC104888384 [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 128/202 (63%), Gaps = 22/202 (11%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            MW DL LQA++ ++SI +YL+ +NIPQ L++K    R     Q+RRHFV  A+ LA +  
Sbjct  3    MWWDLSLQALIFIVSILSYLWTNNIPQKLFTKYHTYRNRHKHQSRRHFVKAAEHLANS--  60

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
              DLSS++            + AI +D  DAA H++K++ALE+QG+ TSALDA++VALSP
Sbjct  61   --DLSSAVSQA---------DAAILLDPTDAANHIIKSLALELQGYTTSALDALDVALSP  109

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVE---------DLIESVRLKGDNVKG  572
            LA  SL + ERA+A+ KRA L++ VS+  +++S V+         +L E+V+++ ++ + 
Sbjct  110  LAIASLGVDERADAIAKRAGLRMEVSRLGRVESGVDVEVWSAAERELREAVKVRRESGRA  169

Query  573  LCLLGECYEKKELSEEARKSYE  638
             CLL EC       +EAR ++E
Sbjct  170  WCLLAECCLGLGKIDEARDAFE  191



>gb|KDO81212.1| hypothetical protein CISIN_1g039398mg, partial [Citrus sinensis]
Length=172

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = +3

Query  183  IQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamal  362
            IQA+RHFV+GAQ LAQAR++K  S S   +LAK AE EA+KAI  D KDAA H+LKA+AL
Sbjct  1    IQAKRHFVIGAQLLAQARSSK--SKSSASSLAKQAEAEADKAISFDYKDAAAHILKALAL  58

Query  363  EVQGFKTSALDAMNValsplaakslslpERAEALHKRAELKLAVSK-GEQIDSAVEDLIE  539
            ++QGFKTSAL++ ++ALS  A K+L+  E+ +AL KRAE+K+++++   ++DSA++DL E
Sbjct  59   DLQGFKTSALESFDLALSIPAVKTLTEKEKGDALFKRAEVKMSMNRRAGRVDSAIDDLTE  118

Query  540  SVRLKGDNVKGLCLLGECYEKKELSEEARKSYE  638
            +V+++ DNVK LCLLGECYE K++ +EA+ +YE
Sbjct  119  AVKIQDDNVKALCLLGECYEVKKMRDEAKTAYE  151



>ref|XP_010680361.1| PREDICTED: uncharacterized protein LOC104895521 [Beta vulgaris 
subsp. vulgaris]
Length=214

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 136/190 (72%), Gaps = 3/190 (2%)
 Frame = +3

Query  66   TDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAK  245
            +++ +Q   +L+++  +L ++N+P+  +SKL+   +A + Q+ RHF+ GAQ L++AR+  
Sbjct  6    SEIAIQVAFLLLTLAIFLIIYNLPKKAFSKLRSNTRANS-QSSRHFLNGAQLLSRARSTN  64

Query  246  DLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValspla  425
            + +++   +LAK A  +A+ A+ +  +D A  +L+A+AL+V G ++SAL +++ AL+P A
Sbjct  65   NRATAE--SLAKDAVTQADMALSLLPRDGAALILRALALDVLGRRSSALRSLDAALAPPA  122

Query  426  akslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKK  605
            A++LS  ER +AL KRAEL+L+V++  ++DSA+ DL+E+V L  DN KG CLLG+CYE K
Sbjct  123  ARTLSGRERGDALVKRAELQLSVNRRRRVDSALLDLVEAVSLTRDNFKGFCLLGQCYEIK  182

Query  606  ELSEEARKSY  635
             + +EA +++
Sbjct  183  GMKDEACEAF  192



>ref|XP_007227059.1| hypothetical protein PRUPE_ppa020513mg, partial [Prunus persica]
 gb|EMJ28258.1| hypothetical protein PRUPE_ppa020513mg, partial [Prunus persica]
Length=174

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = +3

Query  51   ISKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMR-RQARTIQARRHFVLGAQRLA  227
            +S+M  DL LQA LIL+ +  +L +HNIPQ L + L+ R R     QA+RHFVLGAQ LA
Sbjct  1    MSQMVKDLFLQAGLILVVVVAFLTIHNIPQKLLANLRFRFRNKPKAQAKRHFVLGAQLLA  60

Query  228  QARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNV  407
            QAR+A   S S   +L+K A +EAEKAI +D KDAA H+LKA+AL+ QG+KTSALDA++V
Sbjct  61   QARSAA--SPSSASSLSKQALDEAEKAISLDPKDAAAHILKALALDSQGYKTSALDAIDV  118

Query  408  alsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGL  575
            ALSP AAKSL+  ER +AL KRAE++L++++  Q+DS + DLI +V L  +NVK  
Sbjct  119  ALSPFAAKSLTEEERGDALVKRAEIRLSMNRRGQVDSVIADLIRAVELSPENVKAF  174



>ref|XP_010914908.1| PREDICTED: uncharacterized protein LOC105040190 [Elaeis guineensis]
 ref|XP_010914909.1| PREDICTED: uncharacterized protein LOC105040190 [Elaeis guineensis]
 ref|XP_010914911.1| PREDICTED: uncharacterized protein LOC105040190 [Elaeis guineensis]
 ref|XP_010914912.1| PREDICTED: uncharacterized protein LOC105040190 [Elaeis guineensis]
 ref|XP_010914913.1| PREDICTED: uncharacterized protein LOC105040190 [Elaeis guineensis]
Length=220

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 131/194 (68%), Gaps = 5/194 (3%)
 Frame = +3

Query  63   WTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTA  242
             T++L+Q +L+L ++  +L + +IP+   S L  RR   +  ARRHF  G Q LA+AR+A
Sbjct  3    GTEILVQGLLLLFALGIFLGLRSIPRRALSGLH-RRSHSSAAARRHFFQGGQLLARARSA  61

Query  243  KDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValspl  422
                 +   +LA+SA +EA++AI ++ +DAA H+LKA+AL++QG    AL A++ ALSP 
Sbjct  62   P--PGARATSLARSAADEADRAIALEPRDAAHHILKALALDLQGRLLPALRALDTALSPP  119

Query  423  aakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEK  602
            AAKSLS  ER +AL KRAE+ LAV++  ++D A+ DL+E+V L  DN +   LLGECYE 
Sbjct  120  AAKSLSHRERGDALAKRAEIHLAVNRRRRLDQALADLLEAVHLSPDNARAFSLLGECYEL  179

Query  603  K--ELSEEARKSYE  638
            K   + EEAR +Y+
Sbjct  180  KGAGMEEEARTAYQ  193



>ref|XP_008236271.1| PREDICTED: uncharacterized protein LOC103335053 [Prunus mume]
Length=214

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 121/178 (68%), Gaps = 6/178 (3%)
 Frame = +3

Query  114  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  293
            +  +H I +   +KL+   +A  +Q+ RHFV G+  L +AR+    + S     AK+A  
Sbjct  19   FFAIHKISRKALTKLRTNNRA-NLQSTRHFVQGSHLLTRARSNPHKAQSQ--AHAKNALT  75

Query  294  eaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsplaakslslpERAEALHKR  473
            EAEKA+ +  +D   H+LKA+AL++ G KTSAL + +VALSP   KSLS  ER EAL KR
Sbjct  76   EAEKALALSPRDPGPHILKALALDLLGHKTSALKSFDVALSPPCVKSLSERERGEALVKR  135

Query  474  AELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCLLGECYEKKELSEEARKSYE  638
            AELK+ +++  ++DSAVEDL+++VRL   +GD+V   CLLG+CYE KE+ EEAR+++E
Sbjct  136  AELKIGLNRRRRVDSAVEDLVQAVRLSRGEGDDVTSFCLLGQCYEWKEMKEEAREAFE  193



>ref|XP_004250524.1| PREDICTED: uncharacterized protein LOC101263566 [Solanum lycopersicum]
Length=212

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 132/194 (68%), Gaps = 3/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M TD+L+Q V++L ++  +  ++N P+   ++L+ + ++ T QA  HF+ GAQ L++A++
Sbjct  1    METDILIQLVILLFTLGIFYTIYNFPKQALTRLRSKTRS-TNQANSHFIKGAQFLSRAKS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
             +    S+   LAK A  EA+KA+ ID KD A H+LKA++L++ G K SAL +++ ALSP
Sbjct  60   NRS-KKSISFNLAKLAAGEADKALSIDPKDPAAHILKALSLDLIGHKLSALRSLDSALSP  118

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLK-GDNVKGLCLLGECY  596
             A K LS  ERA+AL KRAEL +A+++  ++DSA+ DL+E+V+L   D  K  CLLG+CY
Sbjct  119  PAVKLLSGGERADALLKRAELLVALNRKRRVDSALMDLLEAVKLNCSDRAKAFCLLGQCY  178

Query  597  EKKELSEEARKSYE  638
            E K L  EA  ++E
Sbjct  179  EIKGLKIEAHNAFE  192



>gb|KDP29775.1| hypothetical protein JCGZ_18710 [Jatropha curcas]
Length=212

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 125/191 (65%), Gaps = 3/191 (2%)
 Frame = +3

Query  66   TDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAK  245
            TD+ +Q  ++L++   ++ +   P+   +KL+ + +  +IQ+ RHF+ G   LA+A++  
Sbjct  4    TDVAIQVAILLLAFAMFIAIQYFPKQALNKLRAKNRT-SIQSNRHFIQGTHFLARAKSTP  62

Query  246  DLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValspla  425
            + S S   TLAK+A  EAE AI +  +DAA  +LKA+AL++ G K SAL A++ ALS   
Sbjct  63   NKSQSQ--TLAKNALIEAETAISLSPRDAAPLILKALALDLLGHKASALKALDSALSSPR  120

Query  426  akslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKK  605
             KSL   +R +AL KRAELK+AV++  ++DSA+EDL  +V L  +  K  CLLG+CYE K
Sbjct  121  EKSLERRDRGDALVKRAELKMAVNRRRRVDSAIEDLKCAVELSREGEKAFCLLGQCYEWK  180

Query  606  ELSEEARKSYE  638
             + +EA+ ++E
Sbjct  181  GMGDEAKWAFE  191



>ref|XP_009364809.1| PREDICTED: uncharacterized protein LOC103954711 [Pyrus x bretschneideri]
Length=213

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 131/196 (67%), Gaps = 7/196 (4%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M  +++LQ  L+++++  +  +HN+ +N+ +KL+   +A  +Q+ RHFV G+  L +AR+
Sbjct  1    MTPEVVLQVGLLILTLAMFFAIHNLSRNVLTKLRTNNRA-NLQSTRHFVHGSHLLTRARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                + S      K+A  EAEKA+ +  +D   H+LKA++L++ G KTSAL +++VALSP
Sbjct  60   TPHKAQSQAHA--KNALTEAEKALSLSPRDPGPHILKALSLDLLGHKTSALKSLDVALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCLLGE  590
               KSLS  ER +AL KRAELKL +++  ++DSAVEDL+++V+L   +GD     CLLG+
Sbjct  118  PCVKSLSEKERGDALVKRAELKLGLNRRRRVDSAVEDLVDAVKLGRAEGD-ATAFCLLGQ  176

Query  591  CYEKKELSEEARKSYE  638
            CYE K + +EA  ++E
Sbjct  177  CYEWKGMRDEAIDAFE  192



>ref|XP_008338466.1| PREDICTED: uncharacterized protein LOC103401529 [Malus domestica]
Length=213

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 130/196 (66%), Gaps = 7/196 (4%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M  +++LQ  L+++++  +  +HN+ +N+ +KL+   +A  +Q+ RHFV G+  L +AR+
Sbjct  1    MTPEVVLQVGLLILTLAMFFAIHNLSRNVLTKLRTNNRA-NLQSTRHFVHGSHLLTRARS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                + S      K+A  EAEKA+ +  +D   H+LKA++L++ G KTSAL +++ ALSP
Sbjct  60   TPHKAQSQAHA--KNALTEAEKALSLSPRDPGPHILKALSLDLLGHKTSALKSLDAALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCLLGE  590
               KSLS  ER +AL KRAELKL +++  ++DSAVEDL+++V+L   +GD     CLLG+
Sbjct  118  PCVKSLSEKERGDALVKRAELKLGLNRRRRVDSAVEDLVDAVKLGRAEGD-ATAFCLLGQ  176

Query  591  CYEKKELSEEARKSYE  638
            CYE K + +EA  ++E
Sbjct  177  CYEXKGMRDEAIDAFE  192



>ref|XP_006353161.1| PREDICTED: uncharacterized protein LOC102601514 [Solanum tuberosum]
Length=212

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 132/194 (68%), Gaps = 3/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M TD+L+Q V++L ++  +  ++N P+   ++L+ + ++ T QA  HF+ GAQ L++A++
Sbjct  1    METDILIQLVILLFTLGIFYTIYNFPKQALTRLRSKTRS-TNQANSHFIKGAQFLSRAKS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
             +    S    LAK A  EA+KA+ ID KD A H+LKA++L++ G K +AL +++ ALSP
Sbjct  60   NRS-KKSTSFNLAKLAAGEADKALSIDPKDPAAHILKALSLDLIGHKLAALKSLDSALSP  118

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLK-GDNVKGLCLLGECY  596
             A KSLS  ERA+AL KRAEL +A+++  ++DSA+ DL+E+V+L   D  K  CLLG+CY
Sbjct  119  PAVKSLSGGERADALLKRAELLVALNRKRRVDSALMDLLEAVKLNCSDRAKAFCLLGQCY  178

Query  597  EKKELSEEARKSYE  638
            E K L  EA  ++E
Sbjct  179  EIKGLKIEAHNAFE  192



>ref|XP_002533521.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28865.1| conserved hypothetical protein [Ricinus communis]
Length=214

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 123/190 (65%), Gaps = 1/190 (1%)
 Frame = +3

Query  66   TDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAK  245
            T++ LQ  ++L+++  ++ +   P+   +KL+ + +  ++QA RH +     L++A++  
Sbjct  4    TEVALQVAILLLTLAMFIAIQYFPKQALTKLRAKNRT-SLQANRHLIQATHFLSKAKSIP  62

Query  246  DLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValspla  425
              + S   TLA++A  EAE AI +  +D A  +LKA+ L++ G K SAL ++++ALS   
Sbjct  63   HNNKSQSQTLARNALLEAESAISLSPRDPAPLILKALVLDLLGHKGSALKSLDLALSSPR  122

Query  426  akslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKK  605
             KSL   ER +AL KRAELK +V++  ++DSA+EDL E+V+L G++ +  CLLG+CYE K
Sbjct  123  VKSLEGRERGDALVKRAELKTSVNRRRRVDSAIEDLREAVKLSGESERVYCLLGQCYEWK  182

Query  606  ELSEEARKSY  635
               +EAR +Y
Sbjct  183  GKKDEARWAY  192



>ref|XP_007047767.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
 gb|EOX91924.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
Length=216

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 124/197 (63%), Gaps = 7/197 (4%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M T++ LQ  ++ +++  +  + + P+   +K ++  +A T Q +RH       L++A++
Sbjct  1    MATEVFLQVAILTLTLAIFFAIRHFPKQALTKHRIDHRA-TTQTQRHLTRATHLLSRAKS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                  S   TLAKSA  E EKA+ +  KD   H+LK++AL++ G K SAL ++++AL+ 
Sbjct  60   NPHKDQSQ--TLAKSAISEIEKALSLSPKDPTPHVLKSLALDLLGHKGSALRSLDLALTS  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLK----GDNVKGLCLLG  587
              +KSL+  ER EA+ +RAELKLAV+K  ++DSAV DL E++R+     G   +  CLLG
Sbjct  118  PRSKSLAQRERVEAMVRRAELKLAVNKRRRVDSAVTDLEEAIRVSEEEGGVKTRAFCLLG  177

Query  588  ECYEKKELSEEARKSYE  638
            ECYE K + EEA+K++E
Sbjct  178  ECYELKGMREEAKKAFE  194



>ref|XP_009768508.1| PREDICTED: uncharacterized protein LOC104219512 [Nicotiana sylvestris]
Length=211

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 137/194 (71%), Gaps = 4/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M TD+L+Q +++L ++  +  M+N P+   ++L+ + ++ T QA  HF+ GAQ L++A++
Sbjct  1    METDILIQLIILLFTLGIFYAMYNFPKQALTRLRSKNRS-TDQAHIHFIKGAQLLSRAKS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
             ++ S+S    LAKSA  EA+KA+ ++ KD A H+LKA++L++ G K +AL  +++ALSP
Sbjct  60   NRNKSTSF--NLAKSAAGEADKALALEPKDPAAHILKALSLDLMGHKIAALRYLDLALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLK-GDNVKGLCLLGECY  596
             A K+LS  ER +AL KRAEL++A+++  ++DSA+ DL+E+V+L   D  K  CLLG+CY
Sbjct  118  PAVKALSDGERGDALLKRAELQVALNRKRRVDSALLDLLEAVKLGCSDQAKAFCLLGQCY  177

Query  597  EKKELSEEARKSYE  638
            E K L  EA+ ++E
Sbjct  178  EMKGLKIEAQNAFE  191



>ref|XP_009615438.1| PREDICTED: uncharacterized protein LOC104108159 [Nicotiana tomentosiformis]
Length=211

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 136/194 (70%), Gaps = 4/194 (2%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M TD+L+Q +++L ++  +  M+N P+   + L+ + ++ T QA  HF+ GAQ L++A++
Sbjct  1    METDILIQLIILLFTLGIFYAMYNFPKQALTPLRSKNRS-TNQAHIHFIKGAQLLSRAKS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
             ++ S+S    LAKSA  EA+KA+ ++ KD A H+LKA++L++ G K +AL  +++ALSP
Sbjct  60   NRNKSTSF--NLAKSAAGEADKALALEPKDPAAHILKALSLDLMGRKIAALKYLDLALSP  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLK-GDNVKGLCLLGECY  596
             A K+LS  ER +AL KRAEL++A+++  ++DSA+ DL+E+V+L   D  K  CLLG+CY
Sbjct  118  PAVKALSDGERGDALLKRAELQVALNRKRRVDSAMLDLLETVKLGCSDQAKAFCLLGQCY  177

Query  597  EKKELSEEARKSYE  638
            E K L  EA+ ++E
Sbjct  178  EMKGLKIEAQNAFE  191



>ref|XP_007205948.1| hypothetical protein PRUPE_ppa011845mg [Prunus persica]
 gb|EMJ07147.1| hypothetical protein PRUPE_ppa011845mg [Prunus persica]
Length=193

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 110/166 (66%), Gaps = 6/166 (4%)
 Frame = +3

Query  114  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  293
            +  +H I +   +KL+   +A  +Q+ RHFV G+  L +AR+    + S      K+A  
Sbjct  19   FFAIHKISRKALTKLRTNNRA-NLQSTRHFVQGSHLLTRARSNPHKAQSQAHA--KNALT  75

Query  294  eaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsplaakslslpERAEALHKR  473
            EAEKA+ +  +D   H+LKA+AL++ G KTSAL + +VALSP   KSLS  ER EAL KR
Sbjct  76   EAEKALALSPRDPGPHILKALALDLLGHKTSALKSFDVALSPPCVKSLSERERGEALVKR  135

Query  474  AELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCLLGECYEK  602
            AELK+ +++  ++DSAVEDL+++VRL   +GD+V   CLLG+CYEK
Sbjct  136  AELKIGLNRRRRVDSAVEDLVQAVRLSRGEGDDVTSFCLLGQCYEK  181



>ref|XP_010444514.1| PREDICTED: uncharacterized protein LOC104727183 [Camelina sativa]
Length=208

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 125/194 (64%), Gaps = 5/194 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M T+ ++Q  ++ ++  T+  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART
Sbjct  1    MATETIIQGAILALTFITFWAIKYLSQRGLTKFRNKHRA-TLQTQRQLIQASRLLARART  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                S S   +LAK+A  EA+  I I  +DAA H+++A+AL++ G  TSAL + + AL+ 
Sbjct  60   TPKKSQSQ--SLAKTALSEADDVISISPEDAAGHIVRALALDLLGHHTSALKSFDTALTY  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGEC  593
               KSLS+ ERA+AL KRAE+KLAV++  +IDSA+EDL E+VRL    D  +   LLGEC
Sbjct  118  PRLKSLSMGERADALVKRAEMKLAVNRRRRIDSAIEDLEEAVRLAAGTDTARLFRLLGEC  177

Query  594  YEKKELSEEARKSY  635
            YE K L+E+A  ++
Sbjct  178  YEFKGLNEKAHWAF  191



>ref|XP_010484348.1| PREDICTED: uncharacterized protein LOC104762704 [Camelina sativa]
Length=207

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 124/194 (64%), Gaps = 5/194 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M T+ ++Q  ++ ++  T+  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART
Sbjct  1    MATETIIQGAILALTFITFWAIKYLSQRGLTKFRNKHRA-TLQTQRQLIQASRLLARART  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                S S   +LAK+A  EA+  I I   DAA H+++A+AL++ G  TSAL + + AL+ 
Sbjct  60   TPKKSQSQ--SLAKTALSEADDVISISPDDAAGHIVRALALDLLGHHTSALKSFDTALTY  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGEC  593
               KSLS+ ERA+AL KRAE+KLAV++  +IDSA+EDL E+VRL    D  +   LLGEC
Sbjct  118  PRLKSLSVGERADALVKRAEMKLAVNRRRRIDSAIEDLEEAVRLAAGTDTARLFRLLGEC  177

Query  594  YEKKELSEEARKSY  635
            YE K L+E+A  ++
Sbjct  178  YEFKGLNEKAHWAF  191



>ref|XP_002866676.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42935.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 125/192 (65%), Gaps = 5/192 (3%)
 Frame = +3

Query  66   TDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAK  245
            T+ ++Q  ++++++  +  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART  
Sbjct  4    TETIIQGAILVLTLVIFWAIKYLSQRGLTKFRTKHRA-TLQTQRQLIQASRLLARARTTP  62

Query  246  DLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValspla  425
              S S   +LAK+A  EA+  I I   DAA H+++A+AL++ G  TSAL + ++AL+   
Sbjct  63   KKSQSQ--SLAKTALTEADNVISISPDDAAGHIVRALALDLLGHHTSALKSFDMALTYPR  120

Query  426  akslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYE  599
             KSLS+ ERA+AL KRAE+KLAV++  +IDSA+EDL E+VRL    D  +   LLGECYE
Sbjct  121  LKSLSVGERADALVKRAEMKLAVNRRRRIDSAIEDLEEAVRLAAGTDTARLFRLLGECYE  180

Query  600  KKELSEEARKSY  635
             K LSE+A  ++
Sbjct  181  FKGLSEKAHWAF  192



>ref|XP_010462984.1| PREDICTED: uncharacterized protein LOC104743621 [Camelina sativa]
Length=205

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 124/194 (64%), Gaps = 5/194 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M T+ ++Q  ++ ++  T+  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART
Sbjct  1    MTTETIIQGAILALTFVTFWAIKYLSQRGLTKFRNKHRA-TLQTQRQLIQASRLLARART  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                S S   +LAK+A  EA+  I I   DAA H+++A+AL++ G  TSAL + + AL+ 
Sbjct  60   TPKKSQSQ--SLAKTALSEADDVISISPDDAAGHIVRALALDLLGHHTSALKSFDTALTY  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGEC  593
               KSLS+ ERA+AL KRAE+KLAV++  +IDSA+EDL E+VRL    D  +   LLGEC
Sbjct  118  PRLKSLSVGERADALVKRAEMKLAVNRRRRIDSAIEDLEEAVRLAAGTDTARLFRLLGEC  177

Query  594  YEKKELSEEARKSY  635
            YE K L+E+A  ++
Sbjct  178  YEFKGLNEKAHWAF  191



>gb|KJB40331.1| hypothetical protein B456_007G058400 [Gossypium raimondii]
Length=286

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 123/196 (63%), Gaps = 7/196 (4%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M TD+++Q  ++L+++     +  +P+   +K +   +A T Q +RH     Q L +A++
Sbjct  1    MATDIIIQTAILLLTLAIVFAIQYVPKQTLTKHRTDHRA-TTQTQRHLSRATQLLCRAKS  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                  S   TLAK+A  E EKA+ +  KD   H+LK++AL++ G K SAL ++++AL+ 
Sbjct  60   NPQKDQSQ--TLAKTAITEIEKALSLFPKDPTPHILKSLALDLLGHKGSALRSLDLALAF  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRL---KGDN-VKGLCLLG  587
               KSLS  ER EAL +RAELKLAV+K  ++DSAV DL E+V++   +G+   K  CLLG
Sbjct  118  PRVKSLSEKERVEALVRRAELKLAVNKRRRVDSAVSDLEEAVKVSDKEGETKTKAFCLLG  177

Query  588  ECYEKKELSEEARKSY  635
             CYE K + EE+RK++
Sbjct  178  VCYELKGMREESRKAF  193



>ref|NP_201355.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAA98171.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC43609.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64052.1| unknown protein [Arabidopsis thaliana]
 gb|AED98066.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=206

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 125/192 (65%), Gaps = 5/192 (3%)
 Frame = +3

Query  66   TDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAK  245
            T+ ++Q  ++++++  +  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART  
Sbjct  4    TETIIQGAILVLTLVMFWAIKYLSQRGLTKFRTKHRA-TLQTQRQLIQASRLLARARTTP  62

Query  246  DLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValspla  425
              S S   +LAK+A  EA+  I I   DAA H+++A+AL++ G  TSAL + ++AL+   
Sbjct  63   KKSQSQ--SLAKTALTEADNVIAISPDDAAGHIVRALALDLLGHHTSALKSFDMALTYPR  120

Query  426  akslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYE  599
             KSLS+ ERA+AL KRAE+KLAV++  +IDSAVEDL E+VRL    D  +   LLGECYE
Sbjct  121  LKSLSVGERADALVKRAEMKLAVNRRRRIDSAVEDLEEAVRLAAGTDTARLFRLLGECYE  180

Query  600  KKELSEEARKSY  635
             K L E+A+ ++
Sbjct  181  FKGLKEKAQWAF  192



>gb|KFK28222.1| hypothetical protein AALP_AA8G488400 [Arabis alpina]
Length=207

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 123/194 (63%), Gaps = 5/194 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M TD++++  ++++++   L +  I Q   +K + + +A T+Q +R  +   + +A+AR 
Sbjct  1    MDTDIIIKGAMVVLTLLMVLAVKKIAQKRLTKYRTKHRA-TLQTQRQLIQATRLIARARA  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                S S   +LAKSA  EA+  I I   DAA H+++A+AL++ G +T+AL A + AL+ 
Sbjct  60   TPKKSQSQ--SLAKSALLEADDVIAISPDDAAGHIVRALALDLLGHQTAALKAFDTALTY  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGEC  593
               KSL + ERA+AL KRAE+KLAV++  +IDSA+EDL E+ RL    D  +   LLGEC
Sbjct  118  PRLKSLEVGERADALVKRAEMKLAVNRRRRIDSAIEDLEEAARLAAGTDTARIFRLLGEC  177

Query  594  YEKKELSEEARKSY  635
            YE K L E+A+ ++
Sbjct  178  YEFKGLEEKAQWAF  191



>ref|XP_010523303.1| PREDICTED: uncharacterized protein LOC104801678 [Tarenaya hassleriana]
Length=225

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 128/199 (64%), Gaps = 13/199 (7%)
 Frame = +3

Query  72   LLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDL  251
            +++Q  ++L+++  +  +  +P+   +  + + +A T+Q +R  +  ++ LA+ART  + 
Sbjct  9    MMVQVAILLLTLAMFWAVTYLPKRTLANFRTKHRA-TVQTQRQLIQASRLLARARTTTNR  67

Query  252  SSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsplaak  431
            S S+  +LAKSA  EA+ AI +   DAA H+++A+AL++ G +TSAL + + AL+    K
Sbjct  68   SHSL--SLAKSALAEADDAISLSPDDAAAHIVRALALDLLGHRTSALKSFDSALTYPRVK  125

Query  432  slslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRL---------KGDNVKGL-CL  581
            SLS  ERA+AL KRAE+KLAV++  +I SA+EDL E+V+L         +GDN   + C+
Sbjct  126  SLSDGERADALVKRAEMKLAVNRRRRIGSAIEDLEEAVKLADAAAGDGGRGDNTARMHCV  185

Query  582  LGECYEKKELSEEARKSYE  638
            LGECYE   L E+A  +Y+
Sbjct  186  LGECYEFMGLKEKAHWAYD  204



>ref|NP_001147153.1| TPR domain containing protein [Zea mays]
 gb|ACG25713.1| TPR domain containing protein [Zea mays]
 gb|AFW70649.1| TPR domain containing protein [Zea mays]
Length=232

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 125/198 (63%), Gaps = 6/198 (3%)
 Frame = +3

Query  54   SKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQAR---TIQARRHFVLGAQRL  224
            +  W + ++Q +L L++    L +H++P+    +L+    A      Q+RRHF  GAQ L
Sbjct  9    AGTWPEAVIQCLLFLLAAGMLLALHSLPRRAALRLRRSGAAGGSYAAQSRRHFAQGAQLL  68

Query  225  AQARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMN  404
            A+AR     +      LA++A  EA++AI +D +DAA  +LKA+AL++QG +  AL A++
Sbjct  69   ARARA---TAPKPPGPLARAAVAEADRAIALDPRDAAPLILKALALDLQGHRLPALRALD  125

Query  405  ValsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLL  584
             AL+P  A+SL   ER +AL KRAE+ LA+ +  ++D A  DL E+VRL  +N +   LL
Sbjct  126  GALAPPLARSLEPRERGDALAKRAEIALALHRRRRLDQAAVDLAEAVRLSPENARAHALL  185

Query  585  GECYEKKELSEEARKSYE  638
            GECYEKK L+ EAR++++
Sbjct  186  GECYEKKGLAAEAREAFK  203



>ref|XP_007156466.1| hypothetical protein PHAVU_003G288400g [Phaseolus vulgaris]
 gb|ESW28460.1| hypothetical protein PHAVU_003G288400g [Phaseolus vulgaris]
Length=219

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 125/199 (63%), Gaps = 11/199 (6%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNI---PQNLYSKLQMRRQARTIQARRHFVLGAQRLAQ  230
            M T+ ++Q  ++++++  +  MH I        ++   R + R  +  RH    ++ LA+
Sbjct  1    MATEAMVQLGILILTLSLFFIMHTIRTQTAQARTRNPARNKNRQSEPNRHLTQASRHLAR  60

Query  231  ARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVa  410
            AR     S+S R   AKSA  E +KA+ I  +D   H+L+A +L++ G +T+A+ +++ A
Sbjct  61   AR-----STSHRALHAKSALTETDKALSIWPRDPWAHILRAQSLDLMGHRTAAIKSLDTA  115

Query  411  lsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCL  581
            LS  AA+SLS  ERA+AL +RAE+K+ V++  +++SA+EDL+ +V L   KGD  + +CL
Sbjct  116  LSSPAARSLSAVERADALVRRAEMKVGVNRRRRVESAMEDLVAAVELDGRKGDEWEVMCL  175

Query  582  LGECYEKKELSEEARKSYE  638
            LG+CYE K + EEA+ +++
Sbjct  176  LGKCYEWKGMKEEAKDTFQ  194



>gb|KHN08984.1| hypothetical protein glysoja_021806 [Glycine soja]
Length=171

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMR-RQARTIQARRHFVLGAQRLAQAR  236
            M  D+ LQ V I ++IF++L+MH IPQNLY+KL+ R    R +QA+RHFV GAQ LAQAR
Sbjct  9    MIRDVALQVVFISLTIFSFLWMHGIPQNLYAKLRHRPPNPRAVQAKRHFVKGAQLLAQAR  68

Query  237  TAKDLSSS  260
             +K  SS+
Sbjct  69   RSKSASSA  76


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  507  QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE  638
            ++DS + DL ESV+L   N K  C+LGE YE  ++ EEA+K+Y+
Sbjct  106  RVDSVLADLTESVKLSPRNAKAWCMLGETYEGNKMGEEAKKAYK  149



>ref|XP_006279866.1| hypothetical protein CARUB_v10028558mg [Capsella rubella]
 gb|EOA12764.1| hypothetical protein CARUB_v10028558mg [Capsella rubella]
Length=699

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 124/194 (64%), Gaps = 5/194 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M T+ ++Q  ++ ++  T+  +  + Q   +K + + +A T+Q +R  +  ++ LA+AR+
Sbjct  493  MATETIIQGAILALTFVTFWAIKYLSQRGLTKFRTKHRA-TLQTQRQLIQASRLLARARS  551

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                S S   +LAK+A  EA+  I +   DAA H+++A+AL++ G  TSAL + + AL+ 
Sbjct  552  TPKKSQSQ--SLAKTALTEADDVISLSPDDAAGHIVRALALDLLGHHTSALKSFDTALTY  609

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGEC  593
               KSLS+ ERA+AL KRAE+KLAV++  +IDSA+EDL E+VRL    D  +   LLGEC
Sbjct  610  PRLKSLSVGERADALVKRAEMKLAVNRRRRIDSAIEDLEEAVRLAAGTDTARLFRLLGEC  669

Query  594  YEKKELSEEARKSY  635
            YE K L+E+A  ++
Sbjct  670  YEFKGLNEKAHWAF  683



>emb|CDY54712.1| BnaA09g52440D [Brassica napus]
Length=197

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 121/194 (62%), Gaps = 5/194 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M T+ L+Q  +IL++   +  +  + Q   +K + + +A T+Q +R  +  ++ LA+AR 
Sbjct  1    MATEPLIQGAIILLAFVMFWALKYLSQQGLTKFRSKHRA-TLQTQRQLIQASRLLARARA  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                S S   +LAK+A  EA+  I +   DAA H+++A++L++ G  T+AL + + AL+ 
Sbjct  60   TTKKSQSQ--SLAKTALTEADDVIALSPDDAAGHIVRALSLDLLGHHTAALKSFDTALTY  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGEC  593
               KSLS  ERA+AL KRAE+K+AV++  + DSA+EDL E+VRL    D  +   LLGEC
Sbjct  118  PRLKSLSAGERADALVKRAEMKVAVNRRRRNDSAIEDLEEAVRLAAGTDTARIFRLLGEC  177

Query  594  YEKKELSEEARKSY  635
            YE K L E+A+ ++
Sbjct  178  YEYKGLGEKAQWAF  191



>dbj|BAK01291.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 123/196 (63%), Gaps = 4/196 (2%)
 Frame = +3

Query  54   SKMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTI-QARRHFVLGAQRLAQ  230
            +  W + ++Q +L + +    + +H++P+ +  +L+ R    +  Q+RRHF LGAQ    
Sbjct  9    AATWPEAVVQCLLFVFAAGMLVALHSLPRRVAHRLRRRAGGSSAAQSRRHFALGAQ---L  65

Query  231  ARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVa  410
               A+  +      LA++A  EA++AI +D +DAA  +LKA+AL++QG +  AL  ++VA
Sbjct  66   LARARAAAPKPPGPLARAALAEADRAIALDPRDAAPLILKALALDLQGHRLPALRTLDVA  125

Query  411  lsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGE  590
            L P  A+SL   ER +AL KRAE+ LA+++  ++D A  DL E+VRL  +N +   LLGE
Sbjct  126  LGPPLARSLEPRERGDALAKRAEIALALNRRRRLDQAAADLTEAVRLSPENPRAHALLGE  185

Query  591  CYEKKELSEEARKSYE  638
            CYE+K L+ EAR S++
Sbjct  186  CYERKGLTAEARNSFK  201



>gb|EPS67993.1| hypothetical protein M569_06781, partial [Genlisea aurea]
Length=193

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 129/192 (67%), Gaps = 4/192 (2%)
 Frame = +3

Query  66   TDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAK  245
            TD+++Q  +++ S+  + F+H++P+   S L+ + +   + A RHFV GA  L++AR++ 
Sbjct  1    TDVIVQLGILIFSVGVFYFLHSVPRRTLSSLRSKSRPSNL-ADRHFVQGAALLSRARSSG  59

Query  246  DLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValspla  425
              S++ +  LAKSA  EA+KA+ ++ +D A H+LKAMAL + G K+SAL +++ ALS  A
Sbjct  60   SRSAANK--LAKSAAGEADKALALEPRDPAAHILKAMALSLMGHKSSALKSLDSALSLPA  117

Query  426  akslslpERAEALHKRAELKLAVSKGEQI-DSAVEDLIESVRLKGDNVKGLCLLGECYEK  602
             K LS  E+ +AL KRAE++L V++  ++ D A++DL E+ RL  DN +   LLG+C+E 
Sbjct  118  VKRLSEQEKGDALVKRAEIQLEVNRRRRVVDGAIDDLREATRLNPDNARAFFLLGQCHEI  177

Query  603  KELSEEARKSYE  638
            K+   EA +++E
Sbjct  178  KDSKAEAVQAFE  189



>ref|XP_009112189.1| PREDICTED: uncharacterized protein LOC103837585 [Brassica rapa]
Length=197

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 121/194 (62%), Gaps = 5/194 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M T+ L+Q  ++L++   +  +  + Q   +K + + +A T+Q +R  +  ++ LA+AR 
Sbjct  1    MATEPLIQGAIMLLAFVMFWALKYLSQQGLTKFRSKHRA-TLQTQRQLIQASRLLARARA  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                S S   +LAK+A  EA+  I +   DAA H+++A++L++ G  T+AL + + AL+ 
Sbjct  60   TTKKSQSQ--SLAKTALTEADDVIALSPDDAAGHIVRALSLDLLGHHTAALKSFDTALTY  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGEC  593
               KSLS  ERA+AL KRAE+K+AV++  + DSA+EDL E+VRL    D  +   LLGEC
Sbjct  118  PRLKSLSAGERADALVKRAEMKVAVNRRRRNDSAIEDLEEAVRLAAGTDTARIFRLLGEC  177

Query  594  YEKKELSEEARKSY  635
            YE K L E+A+ ++
Sbjct  178  YEYKGLGEKAQWAF  191



>emb|CDX81290.1| BnaC09g07010D [Brassica napus]
Length=194

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 121/191 (63%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M T+ L+Q  ++L++   +  +  + Q   +K + + +A T+Q +R  +  ++ LA+AR 
Sbjct  1    MATEPLIQGAIMLLAFAMFWALKYLSQQGLTKFRSKHRA-TLQTQRQLIQASRLLARARA  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                S S   +LAK+A  EA+  I I   DAA H+++A+AL++ G  T+AL + + AL+ 
Sbjct  60   TTKKSQSQ--SLAKTALTEADDVIAISPDDAAGHIVRALALDLLGHHTAALKSFDTALTY  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGEC  593
               KSLS+ ERA+AL KRAE+K+AV++  + DSA+EDL E+VRL    D  +   LLGEC
Sbjct  118  PRLKSLSVGERADALVKRAEMKVAVNRRRRNDSAIEDLEEAVRLAAGTDTARIFRLLGEC  177

Query  594  YEKKELSEEAR  626
            YE K L+E+A+
Sbjct  178  YEYKGLNEKAQ  188



>ref|XP_006394020.1| hypothetical protein EUTSA_v10005489mg, partial [Eutrema salsugineum]
 gb|ESQ31306.1| hypothetical protein EUTSA_v10005489mg, partial [Eutrema salsugineum]
Length=199

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 122/194 (63%), Gaps = 5/194 (3%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART  239
            M T++++Q  ++ ++  T+  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART
Sbjct  1    MDTEIIIQGAILALTFVTFWAIKYLSQQGITKFRTKHRA-TLQTQRQLIQASRLLARART  59

Query  240  AKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsp  419
                S S   +LAK+A  EA+  I +   DAA ++++A+AL++ G   +AL + + AL+ 
Sbjct  60   TNKKSQSQ--SLAKTALTEADDVISLSPYDAAGYIVRALALDLLGHHAAALKSFDTALTY  117

Query  420  laakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGEC  593
               KSLS+ ERA+AL KRAE+KLAV++  + DSA+EDL E++RL    D  +   LLGEC
Sbjct  118  PQLKSLSVGERADALVKRAEMKLAVNRRRRNDSAIEDLEEAIRLAAGTDTARIFRLLGEC  177

Query  594  YEKKELSEEARKSY  635
            YE K   E+A+ ++
Sbjct  178  YEYKGFKEKAQWAF  191



>gb|ABK23813.1| unknown [Picea sitchensis]
Length=220

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 122/189 (65%), Gaps = 5/189 (3%)
 Frame = +3

Query  78   LQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSS  257
             Q +L L+++     +  +P++L SKL+ R ++R    R HFV GAQ L ++R A   +S
Sbjct  15   FQVILALVALGLMWALQGLPRSLISKLRRRSRSREQSRR-HFVRGAQLLGRSRAASAQNS  73

Query  258  SMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsplaaksl  437
                +LA+ A  EA+KAI +D  DAA H+LKA+ALE QG  T+A+  ++ AL+P  +KSL
Sbjct  74   GR--SLAREAAAEADKAIALDPMDAASHILKALALERQGHATAAIGCLDAALAPPVSKSL  131

Query  438  slpERAEALHKRAELKLAVSKGEQ--IDSAVEDLIESVRLKGDNVKGLCLLGECYEKKEL  611
            S PE+++ L KRAEL+L  S  ++  +++AV+DL  SV     N K LCLLG CYEKK +
Sbjct  132  SAPEKSDGLLKRAELELETSNSKRRGLEAAVDDLKASVGFNARNFKALCLLGTCYEKKGM  191

Query  612  SEEARKSYE  638
              EARK ++
Sbjct  192  LVEARKVFQ  200



>gb|ABK26430.1| unknown [Picea sitchensis]
Length=220

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 122/189 (65%), Gaps = 5/189 (3%)
 Frame = +3

Query  78   LQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSS  257
             Q +L L+++     +  +P++L SKL+ R ++R    R HFV GAQ L ++R A   +S
Sbjct  15   FQVILALVALGLMWALQGLPRSLISKLRRRSRSREQSRR-HFVRGAQLLGRSRAATAQNS  73

Query  258  SMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsplaaksl  437
                +LA+ A  EA+KAI +D  DAA H+LKA+ALE QG  T+A+  ++ AL+P  +KSL
Sbjct  74   GR--SLAREAAAEADKAIALDPMDAASHILKALALERQGHATAAIGCLDAALAPPVSKSL  131

Query  438  slpERAEALHKRAELKLAVSKGEQ--IDSAVEDLIESVRLKGDNVKGLCLLGECYEKKEL  611
            S PE+++ L KRAEL+L  S  ++  +++AV+DL  SV     N K LCLLG CYEKK +
Sbjct  132  SAPEKSDGLLKRAELELETSNSKRRGLEAAVDDLKASVGFNARNFKALCLLGTCYEKKGM  191

Query  612  SEEARKSYE  638
              EARK ++
Sbjct  192  LVEARKVFQ  200



>ref|XP_004509789.1| PREDICTED: uncharacterized protein LOC101502186 [Cicer arietinum]
Length=215

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 116/192 (60%), Gaps = 10/192 (5%)
 Frame = +3

Query  75   LLQAVLILISIFTYLFMHNI-PQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDL  251
            ++Q  ++++++  +  MH    Q + SK + R + R  +  RH    ++ L +AR+    
Sbjct  7    IIQLGILILTLSVFFLMHTFRNQTIQSKTRTRNKTRQPEQNRHLNQASRHLNRARSTAHK  66

Query  252  SSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValsplaak  431
            +   +  L+++ +      + I  KD ++H+L+A AL + G + +A+ +++ ALS  AAK
Sbjct  67   AQHTKNALSEANQA-----LSITPKDPSVHILRARALYIAGHRATAIRSLDSALSLPAAK  121

Query  432  slslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDN----VKGLCLLGECYE  599
             L+  ERA+AL  RAE+KLAV++  ++DSA+EDL+E++ + G+      + +CLL +CYE
Sbjct  122  FLNPTERADALVFRAEMKLAVNRRRRVDSAIEDLVEAIGVSGEGSESKSEAMCLLAKCYE  181

Query  600  KKELSEEARKSY  635
             K + EEA+ ++
Sbjct  182  WKGMIEEAKNAF  193



>gb|KEH20108.1| TPR domain protein [Medicago truncatula]
Length=216

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 117/196 (60%), Gaps = 10/196 (5%)
 Frame = +3

Query  66   TDLLLQAVLILISIFTYLFMHNI-PQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTA  242
            T+ ++Q  ++++++  +   H +  Q  ++K + R +    +  RH       L +AR+ 
Sbjct  5    TEAIIQFGILILTLSLFFLTHYLRNQKTHNKTRTRNKTHQPEPTRHLNQALHHLNRARST  64

Query  243  KDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNValspl  422
             + S   + +L ++ +      + I  +D ++H+L+A AL +   +T+A+ +++ A S  
Sbjct  65   TNRSQHAKNSLFEANQA-----LSISPRDPSIHILRAKALHLMNHRTAAIKSLDTAFSLP  119

Query  423  aakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG----DNVKGLCLLGE  590
            +AK LS  ERA+AL  RAE+KL V++  +++SA+ED++E++ L G    +N++ LCLLG+
Sbjct  120  SAKMLSSEERADALVFRAEMKLEVNRRRRVESAMEDIVEAIGLSGGEECENLEALCLLGK  179

Query  591  CYEKKELSEEARKSYE  638
            CYE K + EEA+  ++
Sbjct  180  CYEWKGMREEAKNVFQ  195



>ref|XP_003571513.1| PREDICTED: uncharacterized protein LOC100820913 [Brachypodium 
distachyon]
Length=230

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  363  EVQGFKTSALDAMNValsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIES  542
            ++QG +  AL  +++AL+PL A+SL   ER +AL KRAE+ LA+++  ++D A  DL E+
Sbjct  110  DLQGHRLPALRTLDLALAPLLARSLEPRERGDALAKRAEIALALNRRRRVDQAAADLAEA  169

Query  543  VRLKGDNVKGLCLLGECYEKKELSEEARKSYE  638
            VRL  +N +   LLGECYE+K L+ EARKS++
Sbjct  170  VRLSPENPRAHALLGECYERKGLAAEARKSFK  201



>ref|XP_006852913.1| hypothetical protein AMTR_s00033p00228810 [Amborella trichopoda]
 gb|ERN14380.1| hypothetical protein AMTR_s00033p00228810 [Amborella trichopoda]
Length=215

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 130/197 (66%), Gaps = 6/197 (3%)
 Frame = +3

Query  57   KMWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQAR  236
            ++ T  L+Q ++++ ++      +N P  + + L+ R ++ + QA+RHF+ GAQ LAQAR
Sbjct  2    ELETGTLVQGLVLIFALALAFLAYNFPARVLAPLRARGRS-SAQAKRHFIQGAQLLAQAR  60

Query  237  TAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVals  416
            +A     S+  +LA+S+  +A++A+ +D KDAA H+LKA+ L++ G    AL +++ ALS
Sbjct  61   SAPSKKDSL--SLARSSLNQADQALTLDPKDAAAHILKALGLQLLGQLPQALASLDNALS  118

Query  417  plaakslslpERAEALHKRAELKLAVSKG--EQIDSAVEDLIESVRLKG-DNVKGLCLLG  587
            P A KSL+  ERA+AL KRAE++L +      + + A+ DL+  + +K  +N +  C+LG
Sbjct  119  PPALKSLAKSERADALFKRAEIRLKMEPKSRHRAELAMADLLAGITMKELENSRVFCMLG  178

Query  588  ECYEKKELSEEARKSYE  638
            +CY +KE+ +EA+K++E
Sbjct  179  DCYLRKEMVDEAKKAFE  195



>ref|XP_002453513.1| hypothetical protein SORBIDRAFT_04g007120 [Sorghum bicolor]
 gb|EES06489.1| hypothetical protein SORBIDRAFT_04g007120 [Sorghum bicolor]
Length=233

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 120/198 (61%), Gaps = 11/198 (6%)
 Frame = +3

Query  63   WTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQA------RRHFVLGAQRL  224
            W + ++Q +L L++    + +H++P+ +   L++RR             RRHF   AQ  
Sbjct  12   WPEAVIQCLLFLLAAGMLVALHSLPRRVA--LRLRRSGAGGAGSSAAQSRRHF---AQGA  66

Query  225  AQARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMN  404
                 A+  +      LA++A  EA++AI +D +DAA  +LKA+AL++QG +  AL A++
Sbjct  67   QLLARARAAAPKAPGPLARAAVAEADRAIALDPRDAAPLILKALALDLQGHRLPALRALD  126

Query  405  ValsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLL  584
             AL+P  A+SL   ER +AL KRAE+ LA+ +  ++D A  DL E+VRL  +N +   LL
Sbjct  127  AALAPPLARSLEPRERGDALAKRAEIALALHRRRRLDQAAADLAETVRLSPENARAHALL  186

Query  585  GECYEKKELSEEARKSYE  638
            GECYEKK L+ EAR++++
Sbjct  187  GECYEKKGLAAEAREAFK  204



>ref|XP_003530607.1| PREDICTED: uncharacterized protein LOC100813867 [Glycine max]
Length=213

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 126/197 (64%), Gaps = 10/197 (5%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQA--RRHFVLGAQRLAQA  233
            M T+ +LQ  ++++++  +  MHNI     ++ + R + +T Q+   RH    ++ LA+A
Sbjct  1    MATEAMLQLGILILTLSLFFIMHNI-HTQTTQARTRTRNKTSQSEPNRHLAQASRHLARA  59

Query  234  RTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVal  413
            R     S+S R   AK+A  EA+KA+ +  +D   H+L+A AL + G + +A+ A++ AL
Sbjct  60   R-----STSHRAQHAKNALAEADKALAVWPRDPRAHILRAQALHLTGQRAAAIKALDAAL  114

Query  414  splaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLG  587
            S  AA+SLS  ER  AL +RAELK+A+++  ++DSAV+DL+E+V L G  D    LCLLG
Sbjct  115  SSAAARSLSAAERVRALVERAELKVAMNQRRRVDSAVKDLVEAVGLSGGSDLEDALCLLG  174

Query  588  ECYEKKELSEEARKSYE  638
            +CYE K + EEA+ +++
Sbjct  175  KCYEWKGMKEEAKDAFQ  191



>gb|ACN40942.1| unknown [Picea sitchensis]
Length=198

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  363  EVQGFKTSALDAMNValsplaakslslpERAEALHKRAELKLAVSKG--EQIDSAVEDLI  536
            E QG   SAL ++N ALS    KSLSL E+AEAL KRA++ LA S G   +++ A+ DL 
Sbjct  86   ERQGHVGSALRSLNTALSLPVVKSLSLSEKAEALVKRADVVLAGSPGGKRRLEVALGDLH  145

Query  537  ESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE  638
             S+ +  DN K   LLG CYE+K L  EAR+++E
Sbjct  146  ASLAINPDNAKAYYLLGRCYERKGLKAEARQAFE  179



>ref|XP_006648441.1| PREDICTED: uncharacterized protein LOC102700687 [Oryza brachyantha]
Length=124

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +3

Query  462  LHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE  638
            L KRAE+ LA+++  ++D A  DL E+VRL   N +   LLGECYE+K L+ EAR +++
Sbjct  37   LAKRAEIALALNRRRRLDQAAADLAEAVRLSPQNARAHSLLGECYERKGLAAEARDAFK  95



>ref|XP_004951519.1| PREDICTED: uncharacterized protein LOC101758681 [Setaria italica]
Length=233

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 116/196 (59%), Gaps = 7/196 (4%)
 Frame = +3

Query  63   WTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTI----QARRHFVLGAQRLAQ  230
            W + ++Q +L L++    + +H++P+    +L+            Q+RRHF   AQ    
Sbjct  12   WPEAIVQCLLFLLAAGMLVALHSLPRRAALRLRRSSAGGGGSSAAQSRRHF---AQGAQL  68

Query  231  ARTAKDLSSSMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVa  410
               A+  +      LA++A  EA+ AI +D +DAA  +LKA+AL++QG +  AL A++ A
Sbjct  69   LARARAAAPKPPGPLARAALAEADLAIALDPRDAAPLILKALALDLQGHRLPALRALDAA  128

Query  411  lsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGE  590
            L+P  A+SL   ER +AL KRAE+ LA+ +  ++D A  DL E+VRL  +N +   +LGE
Sbjct  129  LAPPLARSLEPRERGDALAKRAEIALALHRRRRLDQAAADLAEAVRLSPENARAHAMLGE  188

Query  591  CYEKKELSEEARKSYE  638
            CYE+K  + +AR +++
Sbjct  189  CYERKGQAAQARDAFK  204



>gb|ABK93348.1| unknown [Populus trichocarpa]
Length=93

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +3

Query  105  IFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKD  248
            +F +L MHNIPQ   SKL+ R +   +QA+RHFVLGAQ +AQAR+  +
Sbjct  16   VFMFLAMHNIPQKFLSKLRYRNRT-DLQAKRHFVLGAQLIAQARSPSN  62



>gb|EEC72705.1| hypothetical protein OsI_06297 [Oryza sativa Indica Group]
Length=215

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +3

Query  447  ERAEALHKRAELKLAVSKGEQI--DSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE  620
            ER +AL KRAE+ LA+ +  +   D A +DL E+VRL   N +   LLGECYE+K ++ E
Sbjct  119  ERGDALAKRAEIALALHRRHRRRLDQAADDLAEAVRLSPQNARAHALLGECYERKGMAAE  178

Query  621  ARKSYE  638
            A  +++
Sbjct  179  ALDAFK  184



>ref|NP_001046241.1| Os02g0204000 [Oryza sativa Japonica Group]
 dbj|BAD16003.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08155.1| Os02g0204000 [Oryza sativa Japonica Group]
Length=242

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +3

Query  447  ERAEALHKRAELKLAVSKGEQI--DSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE  620
            ER +AL KRAE+ LA+ +  +   D A +DL E+VRL   N +   LLGECYE+K ++ E
Sbjct  146  ERGDALAKRAEIALALHRRHRRRLDQAADDLAEAVRLSPQNARAHALLGECYERKGMAAE  205

Query  621  ARKSYE  638
            A  +++
Sbjct  206  ALDAFK  211



>ref|XP_008382429.1| PREDICTED: uncharacterized protein LOC103445188 [Malus domestica]
Length=132

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = +3

Query  369  QGFKTSALDAMNValsplaakslslpERAEALHKRAELKLAVSKGEQIDSAVEDLIESVR  548
            +GFKTS LDA+++   P   KSL+  +R +AL KR  +KL++++  ++DS +EDL     
Sbjct  25   KGFKTSTLDAIDITXXPXYRKSLTKEDRGDALVKRXXMKLSMNRKARVDSVIEDLNSGC-  83

Query  549  LKGDNVKGLCLLGECYEKKELSEEARKSYE  638
              G   +  C +   YE K+++++ARK+ E
Sbjct  84   --GAESREWCFVR--YESKKMTKKARKTPE  109



>ref|XP_010030464.1| PREDICTED: uncharacterized protein LOC104420296 [Eucalyptus grandis]
Length=227

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 113/195 (58%), Gaps = 11/195 (6%)
 Frame = +3

Query  60   MWTDLLLQAVLILISIFTYLF-MHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQAR  236
            M TDLLLQ  +++ S+   +F +  +      KL+ + ++   +  RH +  +  LAQAR
Sbjct  1    MPTDLLLQFAILVSSLAMLVFAVRRLSAPPSPKLRTKTRSAAAEPSRHSLRASALLAQAR  60

Query  237  TAKDLSS--SMRMTLaksaeeeaekaIGIdakdaalhllkamalEVQGFKTSALDAMNVa  410
            ++    +  +   TLA++A  EAE AI    KDAA H+LKA+AL+  G ++SAL +++ A
Sbjct  61   SSPTHHAHRAQAPTLARAALAEAEAAISQAPKDAAPHVLKALALDTLGRRSSALRSLDAA  120

Query  411  lsplaakslslpERAEALHKRAELKLAVSKGEQID--------SAVEDLIESVRLKGDNV  566
            LS   A+SLS  ERAEAL +RAELK+ ++ G +          SAVED  E+VR+     
Sbjct  121  LSAPRARSLSGSERAEALARRAELKMGMAGGGERRRGRRRRAESAVEDAREAVRVGPGEA  180

Query  567  KGLCLLGECYEKKEL  611
                +LGEC E++ L
Sbjct  181  AAWRVLGECCEREGL  195



>ref|XP_010089040.1| Oligopeptidase A [Morus notabilis]
 gb|EXB37276.1| Oligopeptidase A [Morus notabilis]
Length=253

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  486  LAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE  638
            +A+ +  +++SA+ DL  +V L  +N +  CLL ECYE K++  E RK+YE
Sbjct  1    MAMGRRGKVESAIGDLDRAVELSPENARAFCLLEECYEAKKMEAEVRKAYE  51



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125