BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF025O23

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002277641.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    149   1e-37   Vitis vinifera
ref|XP_009597215.1|  PREDICTED: uncharacterized protein LOC104093199    146   2e-37   Nicotiana tomentosiformis
ref|XP_011093846.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    148   2e-37   Sesamum indicum [beniseed]
ref|XP_011093845.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    146   8e-37   Sesamum indicum [beniseed]
emb|CDP03063.1|  unnamed protein product                                144   6e-36   Coffea canephora [robusta coffee]
ref|XP_009796968.1|  PREDICTED: uncharacterized protein LOC104243478    141   6e-36   Nicotiana sylvestris
gb|KDO73864.1|  hypothetical protein CISIN_1g004349mg                   144   8e-36   Citrus sinensis [apfelsine]
ref|XP_006474710.1|  PREDICTED: uncharacterized protein LOC102609180    143   1e-35   Citrus sinensis [apfelsine]
ref|XP_006452827.1|  hypothetical protein CICLE_v10007546mg             142   2e-35   Citrus clementina [clementine]
ref|XP_006342396.1|  PREDICTED: poly [ADP-ribose] polymerase 4-like     136   1e-34   Solanum tuberosum [potatoes]
ref|XP_011007767.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    134   3e-32   Populus euphratica
ref|XP_011078109.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    129   9e-32   
ref|XP_011078108.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    129   1e-31   
ref|XP_002324729.2|  inter-alpha-trypsin inhibitor heavy chain-re...    131   3e-31   
ref|XP_010654418.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    122   3e-31   Vitis vinifera
ref|XP_006345262.1|  PREDICTED: uncharacterized protein LOC102582049    122   5e-31   Solanum tuberosum [potatoes]
ref|XP_008242260.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    129   6e-31   
ref|XP_002271630.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    120   1e-30   Vitis vinifera
ref|XP_010047465.1|  PREDICTED: uncharacterized protein LOC104436401    129   2e-30   Eucalyptus grandis [rose gum]
ref|XP_011078106.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    125   2e-30   Sesamum indicum [beniseed]
ref|XP_006587053.1|  PREDICTED: uncharacterized protein LOC100820133    128   2e-30   Glycine max [soybeans]
ref|XP_011078107.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    125   3e-30   
gb|KDP33933.1|  hypothetical protein JCGZ_07504                         128   3e-30   Jatropha curcas
ref|XP_007204639.1|  hypothetical protein PRUPE_ppa001864mg             127   5e-30   Prunus persica
ref|XP_002516254.1|  inter-alpha-trypsin inhibitor heavy chain, p...    127   7e-30   Ricinus communis
ref|XP_009624355.1|  PREDICTED: uncharacterized protein LOC104115430    117   1e-29   Nicotiana tomentosiformis
ref|XP_009337232.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    126   1e-29   
ref|XP_008242259.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    126   2e-29   Prunus mume [ume]
ref|XP_004251694.1|  PREDICTED: uncharacterized protein LOC101250962    119   2e-29   Solanum lycopersicum
ref|XP_003595328.1|  Inter-alpha-trypsin inhibitor heavy chain H3       125   2e-29   Medicago truncatula
ref|XP_007154569.1|  hypothetical protein PHAVU_003G129800g             125   3e-29   Phaseolus vulgaris [French bean]
ref|XP_010654417.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    115   3e-29   Vitis vinifera
gb|KHN17734.1|  von Willebrand factor A domain-containing protein       125   4e-29   Glycine soja [wild soybean]
ref|XP_009777936.1|  PREDICTED: uncharacterized protein LOC104227395    117   4e-29   Nicotiana sylvestris
ref|XP_007154568.1|  hypothetical protein PHAVU_003G129800g             123   6e-29   Phaseolus vulgaris [French bean]
gb|EYU25841.1|  hypothetical protein MIMGU_mgv1a001817mg                118   8e-29   Erythranthe guttata [common monkey flower]
gb|KCW71312.1|  hypothetical protein EUGRSUZ_F04397                     123   9e-29   Eucalyptus grandis [rose gum]
gb|KHN12291.1|  Inter-alpha-trypsin inhibitor heavy chain H1            123   1e-28   Glycine soja [wild soybean]
ref|XP_010666845.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    118   1e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006416537.1|  hypothetical protein EUTSA_v10006890mg             123   1e-28   Eutrema salsugineum [saltwater cress]
ref|XP_010261798.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    123   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010242255.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    122   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_003551107.1|  PREDICTED: von Willebrand factor A domain-co...    122   3e-28   Glycine max [soybeans]
ref|NP_173345.2|  inter-alpha-trypsin inhibitor heavy chain-like ...    122   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79294.1|AC068602_17  F14D16.26                                    122   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004508009.1|  PREDICTED: uncharacterized protein LOC101514299    115   5e-28   Cicer arietinum [garbanzo]
ref|XP_008388928.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    120   5e-28   
ref|XP_003542365.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    119   5e-28   Glycine max [soybeans]
gb|KFK44049.1|  hypothetical protein AALP_AA1G209400                    118   7e-28   Arabis alpina [alpine rockcress]
emb|CDY26699.1|  BnaA06g13230D                                          119   7e-28   Brassica napus [oilseed rape]
ref|XP_009149386.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    119   7e-28   Brassica rapa
ref|XP_006426697.1|  hypothetical protein CICLE_v10024980mg             121   7e-28   
ref|XP_009359719.1|  PREDICTED: uncharacterized protein LOC103950254    117   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_007138645.1|  hypothetical protein PHAVU_009G226200g             120   1e-27   Phaseolus vulgaris [French bean]
ref|XP_007138646.1|  hypothetical protein PHAVU_009G226200g             120   1e-27   Phaseolus vulgaris [French bean]
emb|CDX83787.1|  BnaC08g18580D                                          117   1e-27   
emb|CDX81914.1|  BnaC08g36870D                                          117   1e-27   
ref|XP_008337841.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    117   1e-27   Malus domestica [apple tree]
ref|XP_008342579.1|  PREDICTED: uncharacterized protein LOC103405374    113   1e-27   Malus domestica [apple tree]
ref|XP_008337842.1|  PREDICTED: von Willebrand factor A domain-co...    116   2e-27   
ref|XP_010064019.1|  PREDICTED: uncharacterized protein LOC104450974    120   2e-27   Eucalyptus grandis [rose gum]
emb|CDY41019.1|  BnaC05g14770D                                          117   2e-27   Brassica napus [oilseed rape]
gb|KHN07890.1|  von Willebrand factor A domain-containing protein       117   3e-27   Glycine soja [wild soybean]
ref|XP_010273855.1|  PREDICTED: uncharacterized protein LOC104609...    115   3e-27   Nelumbo nucifera [Indian lotus]
gb|KHG04434.1|  von Willebrand factor A domain-containing               118   4e-27   Gossypium arboreum [tree cotton]
ref|XP_010459567.1|  PREDICTED: uncharacterized protein LOC104740606    116   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010273853.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    114   5e-27   Nelumbo nucifera [Indian lotus]
ref|XP_004488096.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    118   5e-27   
ref|XP_006465891.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    119   6e-27   Citrus sinensis [apfelsine]
emb|CDY21682.1|  BnaA09g44330D                                          115   7e-27   Brassica napus [oilseed rape]
ref|XP_009117566.1|  PREDICTED: uncharacterized protein LOC103842665    115   7e-27   Brassica rapa
gb|KDO64972.1|  hypothetical protein CISIN_1g004469mg                   118   7e-27   Citrus sinensis [apfelsine]
ref|XP_006369125.1|  hypothetical protein POPTR_0001s16700g             114   7e-27   
ref|XP_010498320.1|  PREDICTED: uncharacterized protein LOC104776024    116   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004488095.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    118   8e-27   Cicer arietinum [garbanzo]
ref|XP_002532724.1|  inter-alpha-trypsin inhibitor heavy chain, p...    108   1e-26   Ricinus communis
gb|AES92187.2|  inter-alpha-trypsin inhibitor heavy chain-like pr...    109   1e-26   Medicago truncatula
ref|XP_009344471.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    111   1e-26   Pyrus x bretschneideri [bai li]
gb|KJB35005.1|  hypothetical protein B456_006G094900                    117   1e-26   Gossypium raimondii
gb|KEH32426.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...    109   2e-26   Medicago truncatula
ref|XP_003608035.1|  von Willebrand factor A domain-containing pr...    108   2e-26   
ref|XP_008356516.1|  PREDICTED: von Willebrand factor A domain-co...    113   2e-26   
gb|KJB82977.1|  hypothetical protein B456_013G222900                    113   5e-26   Gossypium raimondii
ref|XP_002890318.1|  hypothetical protein ARALYDRAFT_472131             115   5e-26   
gb|KJB82978.1|  hypothetical protein B456_013G222900                    113   5e-26   Gossypium raimondii
ref|XP_009110301.1|  PREDICTED: uncharacterized protein LOC103835866    114   5e-26   Brassica rapa
ref|XP_010477113.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    114   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_011035743.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    110   7e-26   Populus euphratica
ref|XP_006385524.1|  hypothetical protein POPTR_0003s06600g             113   8e-26   
ref|XP_011072601.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   9e-26   Sesamum indicum [beniseed]
ref|XP_006385523.1|  hypothetical protein POPTR_0003s06600g             113   1e-25   
gb|KDP40680.1|  hypothetical protein JCGZ_24679                         115   1e-25   Jatropha curcas
ref|XP_009625888.1|  PREDICTED: von Willebrand factor A domain-co...    114   1e-25   Nicotiana tomentosiformis
ref|XP_009625883.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    114   2e-25   
ref|XP_009625881.1|  PREDICTED: von Willebrand factor A domain-co...    114   2e-25   Nicotiana tomentosiformis
ref|XP_004235553.1|  PREDICTED: uncharacterized protein LOC101253...    114   2e-25   Solanum lycopersicum
emb|CDO97834.1|  unnamed protein product                                114   2e-25   Coffea canephora [robusta coffee]
ref|XP_006342928.1|  PREDICTED: uncharacterized protein LOC102599336    114   2e-25   Solanum tuberosum [potatoes]
ref|XP_011035744.1|  PREDICTED: uncharacterized protein LOC105133...    109   3e-25   Populus euphratica
emb|CDX96680.1|  BnaA08g22230D                                          111   3e-25   
gb|KJB07327.1|  hypothetical protein B456_001G016000                    109   3e-25   Gossypium raimondii
ref|XP_007024661.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    113   4e-25   
gb|KHG29331.1|  von Willebrand factor A domain-containing               112   4e-25   Gossypium arboreum [tree cotton]
ref|XP_010537668.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    113   5e-25   Tarenaya hassleriana [spider flower]
ref|XP_004144038.1|  PREDICTED: uncharacterized protein LOC101210279    109   7e-25   Cucumis sativus [cucumbers]
gb|KJB35006.1|  hypothetical protein B456_006G094900                    112   8e-25   Gossypium raimondii
gb|KJB35007.1|  hypothetical protein B456_006G094900                    112   8e-25   Gossypium raimondii
gb|KJB07329.1|  hypothetical protein B456_001G016000                    110   9e-25   Gossypium raimondii
ref|XP_010537666.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    112   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_004287649.1|  PREDICTED: uncharacterized protein LOC101300180    112   1e-24   Fragaria vesca subsp. vesca
gb|KJB65321.1|  hypothetical protein B456_010G089800                    108   2e-24   Gossypium raimondii
ref|XP_009764208.1|  PREDICTED: uncharacterized protein LOC104215...    111   2e-24   Nicotiana sylvestris
ref|XP_008373868.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    110   3e-24   Malus domestica [apple tree]
gb|KJB07325.1|  hypothetical protein B456_001G016000                    110   3e-24   Gossypium raimondii
ref|XP_007012610.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    110   4e-24   
ref|XP_008450941.1|  PREDICTED: uncharacterized protein LOC103492379    107   5e-24   Cucumis melo [Oriental melon]
ref|XP_002304123.1|  hypothetical protein POPTR_0003s06600g             110   5e-24   
ref|XP_009625882.1|  PREDICTED: von Willebrand factor A domain-co...    110   5e-24   Nicotiana tomentosiformis
ref|XP_010531895.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    106   5e-24   Tarenaya hassleriana [spider flower]
gb|KJB65318.1|  hypothetical protein B456_010G089800                    108   5e-24   Gossypium raimondii
ref|XP_006385521.1|  hypothetical protein POPTR_0003s06600g             110   5e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011036460.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    109   7e-24   Populus euphratica
gb|KJB65322.1|  hypothetical protein B456_010G089800                    107   8e-24   Gossypium raimondii
ref|XP_011036459.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    109   1e-23   Populus euphratica
ref|XP_011036458.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    109   1e-23   Populus euphratica
ref|XP_010318474.1|  PREDICTED: uncharacterized protein LOC101253...    109   1e-23   Solanum lycopersicum
gb|KCW71310.1|  hypothetical protein EUGRSUZ_F04397                     108   2e-23   Eucalyptus grandis [rose gum]
gb|KHG11270.1|  von Willebrand factor A domain-containing               105   2e-23   Gossypium arboreum [tree cotton]
ref|XP_010537667.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    107   5e-23   Tarenaya hassleriana [spider flower]
ref|XP_009764209.1|  PREDICTED: uncharacterized protein LOC104215...    107   9e-23   Nicotiana sylvestris
ref|XP_006306812.1|  hypothetical protein CARUB_v10008355mg             102   1e-22   
ref|XP_010537665.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    106   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_004303707.1|  PREDICTED: von Willebrand factor A domain-co...    106   1e-22   Fragaria vesca subsp. vesca
dbj|BAJ95100.1|  predicted protein                                      103   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010318475.1|  PREDICTED: uncharacterized protein LOC101253...    106   1e-22   Solanum lycopersicum
ref|XP_007012611.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    106   2e-22   
gb|KJB07323.1|  hypothetical protein B456_001G016000                    100   2e-22   Gossypium raimondii
ref|XP_010685291.1|  PREDICTED: uncharacterized protein LOC104899734  99.0    3e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006390650.1|  hypothetical protein EUTSA_v10018177mg           99.8    4e-22   Eutrema salsugineum [saltwater cress]
ref|XP_009105911.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  97.1    9e-22   Brassica rapa
emb|CDX72920.1|  BnaC06g33680D                                        96.3    1e-21   
ref|XP_004141711.1|  PREDICTED: uncharacterized protein LOC101206287    102   2e-21   Cucumis sativus [cucumbers]
ref|XP_003557739.1|  PREDICTED: uncharacterized protein LOC100836064    100   3e-21   Brachypodium distachyon [annual false brome]
gb|EYU21307.1|  hypothetical protein MIMGU_mgv1a001939mg                102   3e-21   Erythranthe guttata [common monkey flower]
gb|KFK41669.1|  hypothetical protein AALP_AA2G157400                  94.7    5e-21   Arabis alpina [alpine rockcress]
ref|XP_009414822.1|  PREDICTED: uncharacterized protein LOC103995...  92.8    6e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010416000.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  93.6    8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010471276.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  93.2    9e-21   Camelina sativa [gold-of-pleasure]
ref|NP_177394.2|  uncharacterized protein                             92.0    9e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52586.1|AC016529_17  hypothetical protein; 14673-17893          92.0    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428136.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  93.2    1e-20   
ref|XP_010111991.1|  von Willebrand factor A domain-containing pr...    100   1e-20   
ref|XP_004984065.1|  PREDICTED: uncharacterized protein LOC101774...  97.1    1e-20   
ref|XP_002888881.1|  hypothetical protein ARALYDRAFT_476383           91.3    2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_008228173.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    100   2e-20   Prunus mume [ume]
gb|KHN01425.1|  Inter-alpha-trypsin inhibitor heavy chain H3          93.2    2e-20   Glycine soja [wild soybean]
ref|XP_008462288.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  99.4    2e-20   Cucumis melo [Oriental melon]
ref|XP_003528576.1|  PREDICTED: uncharacterized protein LOC100807...  93.2    2e-20   Glycine max [soybeans]
ref|XP_008667805.1|  PREDICTED: hypothetical protein isoform X1       95.5    4e-20   
ref|NP_001141509.1|  hypothetical protein                             96.3    5e-20   
ref|XP_004984064.1|  PREDICTED: uncharacterized protein LOC101774...  95.1    5e-20   Setaria italica
gb|ABF96528.1|  von Willebrand factor type A domain containing pr...  91.7    6e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010273854.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  98.6    6e-20   Nelumbo nucifera [Indian lotus]
ref|NP_001050335.2|  Os03g0407000                                     91.7    6e-20   
ref|XP_008462286.1|  PREDICTED: uncharacterized protein LOC103500...  98.2    7e-20   Cucumis melo [Oriental melon]
ref|XP_008462285.1|  PREDICTED: uncharacterized protein LOC103500...  98.2    7e-20   Cucumis melo [Oriental melon]
ref|XP_004958289.1|  PREDICTED: uncharacterized protein LOC101756562  94.4    8e-20   
dbj|BAC80088.1|  unknown protein                                      94.0    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060262.2|  Os07g0614300                                     93.6    1e-19   
gb|KHN39616.1|  Inter-alpha-trypsin inhibitor heavy chain H5          95.1    2e-19   Glycine soja [wild soybean]
ref|XP_006598837.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  94.7    2e-19   Glycine max [soybeans]
gb|ABF96527.1|  von Willebrand factor type A domain containing pr...  89.0    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEE67586.1|  hypothetical protein OsJ_25118                        92.4    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82439.1|  hypothetical protein OsI_26857                        92.0    5e-19   Oryza sativa Indica Group [Indian rice]
gb|EEE59232.1|  hypothetical protein OsJ_11214                        88.6    6e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007135423.1|  hypothetical protein PHAVU_010G128200g           86.7    7e-19   Phaseolus vulgaris [French bean]
ref|XP_006650182.1|  PREDICTED: uncharacterized protein LOC102717967  92.4    1e-18   Oryza brachyantha
ref|XP_006658810.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  88.6    2e-18   
ref|XP_006301970.1|  hypothetical protein CARUB_v10022450mg           85.5    2e-18   Capsella rubella
ref|XP_008653341.1|  PREDICTED: von Willebrand factor A domain-co...  87.4    2e-18   
ref|XP_008782726.1|  PREDICTED: LOW QUALITY PROTEIN: inter alpha-...  88.2    2e-18   
gb|KEH18484.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...  88.6    3e-18   Medicago truncatula
ref|XP_002461009.1|  hypothetical protein SORBIDRAFT_02g039160        86.7    4e-18   Sorghum bicolor [broomcorn]
gb|AET01809.2|  inter-alpha-trypsin inhibitor heavy chain-like pr...  88.6    5e-18   Medicago truncatula
tpg|DAA63586.1|  TPA: hypothetical protein ZEAMMB73_270893            85.9    6e-18   
ref|XP_002465153.1|  hypothetical protein SORBIDRAFT_01g032840        90.5    7e-18   Sorghum bicolor [broomcorn]
ref|XP_010235662.1|  PREDICTED: uncharacterized protein LOC100843408  85.5    8e-18   Brachypodium distachyon [annual false brome]
ref|XP_003627335.1|  hypothetical protein MTR_8g021260                88.6    1e-17   
ref|XP_009404352.1|  PREDICTED: uncharacterized protein LOC103987694  90.1    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937323.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  79.7    1e-16   Elaeis guineensis
dbj|BAK07105.1|  predicted protein                                    82.0    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009389548.1|  PREDICTED: uncharacterized protein LOC103976087  79.7    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB83726.1|  hypothetical protein B456_013G261400                  79.0    4e-16   Gossypium raimondii
ref|XP_006583165.1|  PREDICTED: uncharacterized protein LOC100807...  86.3    8e-16   Glycine max [soybeans]
gb|EMT10977.1|  hypothetical protein F775_14225                       77.4    3e-15   
ref|XP_010537629.1|  PREDICTED: uncharacterized protein LOC104812256  72.4    9e-15   Tarenaya hassleriana [spider flower]
ref|XP_004510514.1|  PREDICTED: uncharacterized protein LOC101499440  73.9    6e-14   Cicer arietinum [garbanzo]
ref|XP_003609990.1|  von Willebrand factor A domain-containing pr...  65.5    2e-13   
ref|XP_006836596.1|  hypothetical protein AMTR_s00131p00098870        76.6    1e-12   Amborella trichopoda
gb|KJB65319.1|  hypothetical protein B456_010G089800                  68.6    2e-12   Gossypium raimondii
gb|AAU89244.1|  von Willebrand factor type A domain containing pr...  66.2    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007135424.1|  hypothetical protein PHAVU_010G128200g           63.2    6e-12   Phaseolus vulgaris [French bean]
gb|ABF96529.1|  von Willebrand factor type A domain containing pr...  62.4    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010318476.1|  PREDICTED: von Willebrand factor A domain-co...  70.5    1e-10   Solanum lycopersicum
gb|KDO73865.1|  hypothetical protein CISIN_1g004349mg                 58.2    5e-10   Citrus sinensis [apfelsine]
ref|XP_006452826.1|  hypothetical protein CICLE_v10007546mg           57.0    1e-09   
gb|KHN06057.1|  hypothetical protein glysoja_035963                   62.0    8e-09   Glycine soja [wild soybean]
gb|KEH18485.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...  55.8    2e-08   Medicago truncatula
ref|XP_006385522.1|  hypothetical protein POPTR_0003s06600g           63.5    2e-08   
tpg|DAA41433.1|  TPA: hypothetical protein ZEAMMB73_769800            63.2    3e-08   
ref|XP_007216978.1|  hypothetical protein PRUPE_ppa002885mg           62.8    3e-08   
gb|KEH18487.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...  54.3    3e-08   Medicago truncatula
ref|XP_010477112.1|  PREDICTED: uncharacterized protein LOC104756252  59.3    4e-08   Camelina sativa [gold-of-pleasure]
tpg|DAA41434.1|  TPA: hypothetical protein ZEAMMB73_769800            62.4    5e-08   
ref|XP_011035745.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  50.4    5e-08   Populus euphratica
gb|EMT04548.1|  hypothetical protein F775_32683                       52.8    1e-07   
gb|ABF96530.1|  von Willebrand factor type A domain containing pr...  50.4    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011035746.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  49.3    1e-07   Populus euphratica
gb|KCW71308.1|  hypothetical protein EUGRSUZ_F04395                   57.0    2e-07   Eucalyptus grandis [rose gum]
gb|EPS65940.1|  hypothetical protein M569_08838                       55.8    7e-07   Genlisea aurea
gb|ETO27230.1|  hypothetical protein RFI_09901                        56.2    1e-06   Reticulomyxa filosa
gb|ETO32114.1|  hypothetical protein RFI_05003                        56.2    3e-06   Reticulomyxa filosa
ref|XP_001762340.1|  predicted protein                                51.2    1e-05   
gb|KJB07324.1|  hypothetical protein B456_001G016000                  52.4    1e-04   Gossypium raimondii
ref|XP_002503574.1|  predicted protein                                51.2    2e-04   Micromonas commoda
ref|XP_001768544.1|  predicted protein                                51.2    2e-04   
ref|XP_010462785.1|  PREDICTED: uncharacterized protein LOC104743395  50.4    3e-04   
gb|ETO24316.1|  hypothetical protein RFI_12842                        50.1    4e-04   Reticulomyxa filosa
gb|ETO23352.1|  hypothetical protein RFI_13832                        49.7    6e-04   Reticulomyxa filosa
ref|XP_003055556.1|  predicted protein                                50.1    7e-04   Micromonas pusilla CCMP1545
gb|ETO29250.1|  hypothetical protein RFI_07873                        49.7    8e-04   Reticulomyxa filosa



>ref|XP_002277641.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Vitis 
vinifera]
 emb|CBI27786.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 123/166 (74%), Gaps = 12/166 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AKEIPL +VLAKQQI  LTA+AWF++NK+LEEKIA  S+Q G++SEYT M  + T+
Sbjct  568  KVQKAKEIPLDRVLAKQQIGWLTAQAWFSENKQLEEKIAEMSIQTGVISEYTRMILLETQ  627

Query  249  ETKGTTEPSKV---------NKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--T  395
                 +EP +V          +   D K+QK II+L++LG+GFG++ ATAEN PPGS   
Sbjct  628  GGAQVSEPGRVQEPPKTMEYQRPVVDSKVQK-IILLQSLGVGFGNVNATAENYPPGSEEV  686

Query  396  SKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              PEAAE+FV+AASNCC  +C  CCCMCCI+MC+++NDQCA+V+TQ
Sbjct  687  KLPEAAEIFVKAASNCCAKMCGYCCCMCCIRMCTRMNDQCAIVLTQ  732



>ref|XP_009597215.1| PREDICTED: uncharacterized protein LOC104093199 [Nicotiana tomentosiformis]
Length=753

 Score =   146 bits (368),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 121/162 (75%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KA +AK+IPL KVLA+QQ+E+LTA+AW T+NK LE+KIA+ S+QH ++SEYT M  + T+
Sbjct  570  KAVQAKDIPLDKVLARQQVELLTAQAWLTENKDLEQKIAQTSIQHAVISEYTRMILMETD  629

Query  249  ETKGTTEP------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPE  407
              K  TE       S   KK  +PKL+K  I+L+NL +GFG+ +AT EN PPG S +KPE
Sbjct  630  RGKVVTESTSKRKVSTAAKKIEEPKLEKK-ILLQNLAVGFGNYSATVENIPPGASETKPE  688

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             AE+  +AASNCC  +CD CCCMCCI+ CSK+NDQCA+V+TQ
Sbjct  689  TAEILAKAASNCCGKMCDICCCMCCIRTCSKMNDQCAIVLTQ  730


 Score = 37.4 bits (85),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G FPE L+A+G+LAD++NFS+ L+
Sbjct  547  GAFPEVLKAKGVLADLSNFSVDLK  570



>ref|XP_011093846.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Sesamum indicum]
Length=756

 Score =   148 bits (374),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 92/165 (56%), Positives = 125/165 (76%), Gaps = 11/165 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K  EAKE+P+ K++ K QIE LTA+AW+T+N++L+EKIA+ SVQ+ I+SEYTNM  + T+
Sbjct  569  KVHEAKEMPIDKIVVKHQIEQLTAQAWYTENQELKEKIAKMSVQNAIISEYTNMVLLETD  628

Query  249  ETKGTTEPSKVNKKTG--------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TS  398
            + K   + + V K +G        DPK QK IIML N+G+GFG+LTATAEN PPGS  T 
Sbjct  629  KGKINADSAVVKKVSGKGDHHKAEDPKPQK-IIMLPNMGIGFGNLTATAENIPPGSSYTR  687

Query  399  KPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             P+AAE+F +AAS+CC  +C +CCCMCCIQ CS++NDQCA+++TQ
Sbjct  688  PPDAAEVFAKAASDCCASLCGRCCCMCCIQTCSRMNDQCAILITQ  732



>ref|XP_011093845.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Sesamum indicum]
Length=758

 Score =   146 bits (369),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 92/167 (55%), Positives = 124/167 (74%), Gaps = 13/167 (8%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K  EAKE+P+ K++ K QIE LTA+AW+T+N++L+EKIA+ SVQ+ I+SEYTNM  + T+
Sbjct  569  KVHEAKEMPIDKIVVKHQIEQLTAQAWYTENQELKEKIAKMSVQNAIISEYTNMVLLETD  628

Query  249  ETKGTTEPSKVNK----------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--  392
            + K   + + V K          K  DPK QK IIML N+G+GFG+LTATAEN PPGS  
Sbjct  629  KGKINADSAVVKKLQVSGKGDHHKAEDPKPQK-IIMLPNMGIGFGNLTATAENIPPGSSY  687

Query  393  TSKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            T  P+AAE+F +AAS+CC  +C +CCCMCCIQ CS++NDQCA+++TQ
Sbjct  688  TRPPDAAEVFAKAASDCCASLCGRCCCMCCIQTCSRMNDQCAILITQ  734



>emb|CDP03063.1| unnamed protein product [Coffea canephora]
Length=748

 Score =   144 bits (363),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 92/158 (58%), Positives = 122/158 (77%), Gaps = 4/158 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K   AK+IPL KV AKQ+IE+LTAEAWF +NK+LE KIA+ S+Q+ ++SE+T++  + T+
Sbjct  569  KVHHAKDIPLHKVQAKQEIELLTAEAWFAENKELETKIAKLSLQNSVISEFTHLLLLETD  628

Query  249  ETKGTTEPSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEM  419
                   P KV+ ++  DPK QK II+ RNLG+GFG+LTATA+N PPGS  T   EAAE+
Sbjct  629  MVNKKQVPKKVDPQRAEDPKAQK-IIVKRNLGVGFGNLTATADNIPPGSDETKHLEAAEI  687

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             V+AASNCC  +CD CCCMCCI++CS++NDQCAVV+TQ
Sbjct  688  IVKAASNCCGKLCDYCCCMCCIKVCSRLNDQCAVVLTQ  725



>ref|XP_009796968.1| PREDICTED: uncharacterized protein LOC104243478 [Nicotiana sylvestris]
Length=753

 Score =   141 bits (356),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 119/162 (73%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KA ++K+IPL KVLA+QQ+E++TA+AW T+NK LE+KIA+ S+QH ++SEYT M  + T+
Sbjct  570  KAVQSKDIPLDKVLARQQVELITAQAWLTENKDLEQKIAQTSIQHAVISEYTRMILMETD  629

Query  249  ETKGTTEP------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPE  407
              K  TE       S   K   +PKL+K  I+L NL +GFG+ +AT EN PPG S +KPE
Sbjct  630  RGKVVTESTSKRKVSTAAKNIEEPKLEKK-ILLENLAVGFGNYSATVENIPPGASETKPE  688

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             AE+  +AASNCC  +CD CCCMCCI+ CSK+NDQCA+V+TQ
Sbjct  689  TAEILAKAASNCCGKMCDICCCMCCIRTCSKMNDQCAIVLTQ  730


 Score = 36.6 bits (83),  Expect(2) = 6e-36, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G FPE L+A+G+LAD++NFS+ L+
Sbjct  547  GVFPEMLKAKGVLADLSNFSVDLK  570



>gb|KDO73864.1| hypothetical protein CISIN_1g004349mg [Citrus sinensis]
Length=759

 Score =   144 bits (362),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 86/164 (52%), Positives = 118/164 (72%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK+IPL ++ AKQQI++LTA+AWF+++K+LEEK+++ SVQ G++ EYT M  + T+
Sbjct  571  KLQLAKDIPLDRICAKQQIDLLTAQAWFSEDKRLEEKVSKMSVQTGVLCEYTRMIIVETD  630

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGST--SK  401
            E    +E     K +     QK +       IML+NLG+GFGDLTATAEN PPGS     
Sbjct  631  ERNNASESPGTKKGSKKSDHQKILDSEVPKTIMLQNLGIGFGDLTATAENFPPGSEIPKL  690

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PE AE+FV+AASNCC  + +KCCC+CCI+ C+K+NDQC +V+TQ
Sbjct  691  PEVAEIFVKAASNCCSTLGNKCCCLCCIECCNKLNDQCVIVLTQ  734



>ref|XP_006474710.1| PREDICTED: uncharacterized protein LOC102609180 [Citrus sinensis]
Length=759

 Score =   143 bits (361),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 86/164 (52%), Positives = 118/164 (72%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK+IPL ++ AKQQI++LTA+AWF+++K+LEEK+++ SVQ G++ EYT M  + T+
Sbjct  571  KLQLAKDIPLDRICAKQQIDLLTAQAWFSEDKRLEEKVSKMSVQIGVLCEYTRMIIVETD  630

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGST--SK  401
            E    +E     K +     QK +       IML+NLG+GFGDLTATAEN PPGS     
Sbjct  631  ERNNASESPGTKKGSKKSDHQKILDSEVPKTIMLQNLGIGFGDLTATAENFPPGSEIPKL  690

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PE AE+FV+AASNCC  + +KCCC+CCI+ C+K+NDQC +V+TQ
Sbjct  691  PEVAEIFVKAASNCCSTLGNKCCCLCCIECCNKLNDQCVIVLTQ  734



>ref|XP_006452827.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
 gb|ESR66067.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
Length=758

 Score =   142 bits (359),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 85/164 (52%), Positives = 118/164 (72%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK++PL ++ AKQQI++LTA+AWF+++K+LEEK+++ SVQ G++ EYT M  + T+
Sbjct  571  KLQLAKDLPLDRICAKQQIDLLTAQAWFSEDKRLEEKVSKMSVQTGVLCEYTRMIIVETD  630

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGST--SK  401
            E    +E     K +     QK +       IML+NLG+GFGDLTATAEN PPGS     
Sbjct  631  ERNNASESPGTKKGSKKSDHQKILDSEVPKTIMLQNLGIGFGDLTATAENFPPGSEIPKL  690

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PE AE+FV+AASNCC  + +KCCC+CCI+ C+K+NDQC +V+TQ
Sbjct  691  PEVAEIFVKAASNCCSTLGNKCCCLCCIECCNKLNDQCVIVLTQ  734



>ref|XP_006342396.1| PREDICTED: poly [ADP-ribose] polymerase 4-like [Solanum tuberosum]
Length=752

 Score =   136 bits (342),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 117/162 (72%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KA + K+IPL KVLA+QQIE+LTA+AW T NK LE+KIA+ S+Q+G++SEYT M  I T+
Sbjct  569  KAIQTKDIPLDKVLARQQIELLTAQAWLTDNKDLEQKIAQTSIQNGVISEYTRMILIETD  628

Query  249  ETKGTTEP------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-KPE  407
            + K  TE       S   KK  + KLQK   +L+NLG GFG+ +AT EN  PG T  KPE
Sbjct  629  KGKVITESTSKRKVSTAPKKIEEAKLQKK-TLLQNLGAGFGNYSATIENISPGITEKKPE  687

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             AE+  +AASNCC  +CD CCCMCCI+ CSK+NDQCA+V+TQ
Sbjct  688  TAEILAKAASNCCGKMCDICCCMCCIRTCSKMNDQCAIVLTQ  729


 Score = 37.7 bits (86),  Expect(2) = 1e-34, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G FP++L+A+G+LAD++NFSL L+
Sbjct  546  GVFPDTLKAKGVLADLSNFSLDLK  569



>ref|XP_011007767.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Populus 
euphratica]
Length=756

 Score =   134 bits (336),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 88/164 (54%), Positives = 122/164 (74%), Gaps = 10/164 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT-  245
            K Q+AK+IPL  V AKQQI++LTA+AWF++NK+LEEK+A+ S+Q G++SEYT M+ + T 
Sbjct  569  KVQQAKDIPLHSVSAKQQIDLLTAQAWFSENKQLEEKVAKLSIQTGVISEYTCMSLLETD  628

Query  246  ------EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--  401
                  E   G   P +VN +  D + ++  I LRNLG+GFG+LTATAEN  PG+     
Sbjct  629  RGNQAAESPGGRKLPRQVNPQKVDFQGRRR-IFLRNLGVGFGNLTATAENLRPGAEESKL  687

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PEAAE+ ++AASNCC ++C++CCCMCC+Q CSKIN+Q A+V+TQ
Sbjct  688  PEAAEIIIKAASNCCSIMCNQCCCMCCVQCCSKINNQFAIVLTQ  731



>ref|XP_011078109.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H4-like 
isoform X4 [Sesamum indicum]
Length=613

 Score =   129 bits (324),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 118/163 (72%), Gaps = 11/163 (7%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            QEAK+IP+ K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + TE  
Sbjct  430  QEAKDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLETERM  489

Query  255  KGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KP  404
            K T +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++   P
Sbjct  490  KITADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAPKPP  548

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            EA + +++ AS CC  +C+  CC CC+ +CS++N++CA +MTQ
Sbjct  549  EAGDAYIKGASRCCSWLCNHRCCWCCMGVCSRMNNECANLMTQ  591


 Score = 34.7 bits (78),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE+L+ +G L DM+NFS+ L  ++ +
Sbjct  405  GTFPETLKVKGFLPDMSNFSVDLSVQEAK  433



>ref|XP_011078108.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Sesamum indicum]
Length=641

 Score =   129 bits (324),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 118/163 (72%), Gaps = 11/163 (7%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            QEAK+IP+ K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + TE  
Sbjct  458  QEAKDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLETERM  517

Query  255  KGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KP  404
            K T +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++   P
Sbjct  518  KITADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAPKPP  576

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            EA + +++ AS CC  +C+  CC CC+ +CS++N++CA +MTQ
Sbjct  577  EAGDAYIKGASRCCSWLCNHRCCWCCMGVCSRMNNECANLMTQ  619


 Score = 34.7 bits (78),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE+L+ +G L DM+NFS+ L  ++ +
Sbjct  433  GTFPETLKVKGFLPDMSNFSVDLSVQEAK  461



>ref|XP_002324729.2| inter-alpha-trypsin inhibitor heavy chain-related family protein 
[Populus trichocarpa]
 gb|EEF03294.2| inter-alpha-trypsin inhibitor heavy chain-related family protein 
[Populus trichocarpa]
Length=752

 Score =   131 bits (329),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 84/160 (53%), Positives = 117/160 (73%), Gaps = 5/160 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+IPL  V AKQQI++LTA+AWF++NK+LEEK+A+ S+Q G++SEYT M+ + T+
Sbjct  569  KVQKAKDIPLHSVSAKQQIDLLTAQAWFSENKQLEEKVAKLSIQTGVISEYTCMSLLETD  628

Query  249  ETKGTTEPSKVNKKTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAA  413
                  E    +K   + K+    +  I LRNLG+GFG+LTATAEN  PG+     PEAA
Sbjct  629  RGNQAAESPGGHKVCANLKVDSQGRRRIFLRNLGVGFGNLTATAENLRPGAEESKLPEAA  688

Query  414  EMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E+ ++AASNCC ++C +CCCMCC+Q C KIN+Q A+V+TQ
Sbjct  689  EIIIKAASNCCSIMCKQCCCMCCVQCCFKINNQFAIVLTQ  728



>ref|XP_010654418.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 isoform 
X3 [Vitis vinifera]
Length=624

 Score =   122 bits (306),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 109/157 (69%), Gaps = 3/157 (2%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AKEIPL +V A++QI +LT +AW +++K+LEE+IAR S+Q G  SEYT M  + T+
Sbjct  447  KIQKAKEIPLDRVFARRQINLLTVQAWLSESKQLEERIARMSMQTGFPSEYTCMILLVTD  506

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMF  422
            + K  +E   + +K  D   QK II+L  LG+GFGDLTAT+EN P G      PE  ++ 
Sbjct  507  KGKQASESVMLQEKMVDSIGQK-IILLGTLGIGFGDLTATSENLPSGVEEPKPPEGTDVI  565

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +AA+NCC MV D+ CCMC IQ CSK+N+QCA+  TQ
Sbjct  566  FKAATNCCAMVADRICCMCFIQACSKLNNQCAIAFTQ  602


 Score = 40.0 bits (92),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQRK  90
            GEFP+SL+A G LADM+NF++ L+ +K ++
Sbjct  424  GEFPDSLKASGSLADMSNFTIDLKIQKAKE  453



>ref|XP_006345262.1| PREDICTED: uncharacterized protein LOC102582049 [Solanum tuberosum]
Length=754

 Score =   122 bits (306),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 107/161 (66%), Gaps = 6/161 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K  ++K IPL K   KQQIEILTA+AWFT+NK LE+KIA+ S+Q  ++SEYT MA + TE
Sbjct  571  KGFKSKAIPLDKARVKQQIEILTAQAWFTQNKDLEQKIAKMSIQDAVISEYTRMALVETE  630

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGSTS-KPEAA  413
            + K     +K    + D K+++ +    I+L  LG GFG+LTAT EN PPG+   + EAA
Sbjct  631  KVKIIKPTTKRKVHSDDEKIEERLVQKTILLHYLGFGFGNLTATIENIPPGAIDIEDEAA  690

Query  414  EMFVQAASNcc-kmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E+  +A SNC  K+    CCC CCI+ CS +N QCA+ +TQ
Sbjct  691  EIIAKATSNCFGKLCGLCCCCSCCIRTCSTMNHQCAIALTQ  731


 Score = 39.3 bits (90),  Expect(2) = 5e-31, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE L+A+GILADM+NFS+ L+  K +
Sbjct  548  GVFPEMLKAKGILADMSNFSVELKGFKSK  576



>ref|XP_008242260.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X2 [Prunus mume]
Length=592

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+IPL +V AK QIE+LTA+AW   NK+LE+K+A+ S+Q  +VSEYT M  +  E
Sbjct  411  KLQDAKDIPLDRVCAKGQIELLTAQAWLADNKQLEDKVAKLSIQSHVVSEYTRMIIVDKE  470

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEMF  422
            ++     P K   K  D + Q+  I+L +L +GFG+L AT+EN PPGS    +PEAAE+F
Sbjct  471  QSGPQEAPKKSRIKMKDSESQRP-ILLPSLSIGFGNLVATSENVPPGSEEPKQPEAAEIF  529

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +AASNCC  +C  CCCM CI+  S+IN QCA V  Q
Sbjct  530  ARAASNCCGSMCTHCCCMGCIKCFSRINPQCANVFAQ  566



>ref|XP_002271630.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X1 [Vitis vinifera]
 emb|CBI35850.3| unnamed protein product [Vitis vinifera]
Length=747

 Score =   120 bits (302),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 80/157 (51%), Positives = 109/157 (69%), Gaps = 3/157 (2%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AKEIPL +V A++QI +LT +AW +++K+LEE+IAR S+Q G  SEYT M  + T+
Sbjct  570  KIQKAKEIPLDRVFARRQINLLTVQAWLSESKQLEERIARMSMQTGFPSEYTCMILLVTD  629

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMF  422
            + K  +E   + +K  D   QK II+L  LG+GFGDLTAT+EN P G      PE  ++ 
Sbjct  630  KGKQASESVMLQEKMVDSIGQK-IILLGTLGIGFGDLTATSENLPSGVEEPKPPEGTDVI  688

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +AA+NCC MV D+ CCMC IQ CSK+N+QCA+  TQ
Sbjct  689  FKAATNCCAMVADRICCMCFIQACSKLNNQCAIAFTQ  725


 Score = 39.7 bits (91),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQRK  90
            GEFP+SL+A G LADM+NF++ L+ +K ++
Sbjct  547  GEFPDSLKASGSLADMSNFTIDLKIQKAKE  576



>ref|XP_010047465.1| PREDICTED: uncharacterized protein LOC104436401 [Eucalyptus grandis]
 gb|KCW79379.1| hypothetical protein EUGRSUZ_C00792 [Eucalyptus grandis]
Length=755

 Score =   129 bits (323),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 86/160 (54%), Positives = 114/160 (71%), Gaps = 6/160 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K   AK+I L ++ AKQQI+  TA+AWF+++K+LEEK+A+ S+Q GI SE+T M  I  +
Sbjct  574  KILRAKDILLDRLFAKQQIDHFTAKAWFSEDKQLEEKVAKLSIQSGIASEFTRMILIEAD  633

Query  249  ETKGTTEPS---KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAA  413
            E    TE +   K  +K  DPK+ K  IMLR+L +GFG+LTAT EN PPG+     PEAA
Sbjct  634  EATKATESAGSDKAPRKMPDPKVYKQ-IMLRSLCIGFGNLTATIENIPPGAEQVKLPEAA  692

Query  414  EMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E+ V+AASNCC  +C+ CCCMCCIQ CS++NDQ  +VMTQ
Sbjct  693  EILVKAASNCCGTICNHCCCMCCIQCCSRLNDQFVMVMTQ  732



>ref|XP_011078106.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X1 [Sesamum indicum]
Length=764

 Score =   125 bits (314),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 82/163 (50%), Positives = 118/163 (72%), Gaps = 11/163 (7%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            QEAK+IP+ K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + TE  
Sbjct  581  QEAKDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLETERM  640

Query  255  KGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KP  404
            K T +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++   P
Sbjct  641  KITADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAPKPP  699

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            EA + +++ AS CC  +C+  CC CC+ +CS++N++CA +MTQ
Sbjct  700  EAGDAYIKGASRCCSWLCNHRCCWCCMGVCSRMNNECANLMTQ  742


 Score = 34.3 bits (77),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE+L+ +G L DM+NFS+ L  ++ +
Sbjct  556  GTFPETLKVKGFLPDMSNFSVDLSVQEAK  584



>ref|XP_006587053.1| PREDICTED: uncharacterized protein LOC100820133 [Glycine max]
Length=759

 Score =   128 bits (322),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 78/163 (48%), Positives = 112/163 (69%), Gaps = 8/163 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI---  239
            K QEAK IP+ ++ A+ QIE LTA+AW +K++KLE+ +A+ S+Q G  SEYT+M  +   
Sbjct  573  KIQEAKGIPVQRICARDQIEYLTAQAWLSKDEKLEQMVAKLSLQTGFTSEYTSMTILEID  632

Query  240  ---GTEETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKP  404
                 +E+ G     K N ++G  + ++ +I+L  LG+GFG+LTATAEN  PGS  T  P
Sbjct  633  LRKKAKESDGKKVSKKSNPQSGAKEQEQRVILLPPLGIGFGNLTATAENIQPGSEETKGP  692

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            + AE+FV+AA+NCC   C+ CCCMCCIQ  ++IN+QCA+  TQ
Sbjct  693  DGAEIFVKAATNCCGTCCNYCCCMCCIQAFTRINNQCAIAFTQ  735



>ref|XP_011078107.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Sesamum indicum]
Length=664

 Score =   125 bits (314),  Expect(2) = 3e-30, Method: Composition-based stats.
 Identities = 82/163 (50%), Positives = 118/163 (72%), Gaps = 11/163 (7%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            QEAK+IP+ K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + TE  
Sbjct  481  QEAKDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLETERM  540

Query  255  KGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KP  404
            K T +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++   P
Sbjct  541  KITADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAPKPP  599

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            EA + +++ AS CC  +C+  CC CC+ +CS++N++CA +MTQ
Sbjct  600  EAGDAYIKGASRCCSWLCNHRCCWCCMGVCSRMNNECANLMTQ  642


 Score = 33.9 bits (76),  Expect(2) = 3e-30, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE+L+ +G L DM+NFS+ L  ++ +
Sbjct  456  GTFPETLKVKGFLPDMSNFSVDLSVQEAK  484



>gb|KDP33933.1| hypothetical protein JCGZ_07504 [Jatropha curcas]
Length=756

 Score =   128 bits (321),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 83/164 (51%), Positives = 115/164 (70%), Gaps = 10/164 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K  + K++P  ++ AKQQI++LTA+AWF++NK+LEEK+ + S+Q G+ SEYT +  + T+
Sbjct  569  KIHKEKDMPFERIFAKQQIDLLTAQAWFSENKRLEEKVVKMSIQTGVFSEYTRLTLLETQ  628

Query  249  E-TKGTTEPS------KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSK  401
               + T  PS      K +    D + +K  I+L+NLG+GFG+L ATAEN PPG      
Sbjct  629  RGNQATDSPSTRTLLHKGDSSKVDSQGRKR-ILLQNLGVGFGNLAATAENIPPGIEEPKL  687

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PEAAE+ ++AASNCC  +C  CCCMCCIQ CSKINDQCA+V+TQ
Sbjct  688  PEAAEIIIKAASNCCGRICSHCCCMCCIQCCSKINDQCAIVLTQ  731



>ref|XP_007204639.1| hypothetical protein PRUPE_ppa001864mg [Prunus persica]
 gb|EMJ05838.1| hypothetical protein PRUPE_ppa001864mg [Prunus persica]
Length=753

 Score =   127 bits (320),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+IPL +V AK QIE+LTA+AW   NK+LE+K+A+ S+Q  +VSEYT M  +G E
Sbjct  572  KLQDAKDIPLDRVCAKGQIELLTAQAWLADNKQLEDKVAKLSIQSHVVSEYTRMIILGKE  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAAEMF  422
            ++     P K   K  D + Q+  I+L +L +GFG+L AT+EN PPGS    +PEAAE+F
Sbjct  632  QSGPQEVPKKSRIKMKDSESQRP-ILLPSLSIGFGNLVATSENIPPGSEEPKQPEAAEIF  690

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +AASNCC  +C  CCCM CI+  S+IN QCA V  Q
Sbjct  691  ARAASNCCGSMCTHCCCMGCIKCFSRINPQCANVFAQ  727



>ref|XP_002516254.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
 gb|EEF46256.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
Length=755

 Score =   127 bits (319),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 80/163 (49%), Positives = 114/163 (70%), Gaps = 8/163 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+ K++P  K+ AKQQI++LTA+AW+++NK+LEEK+A+ S+Q G+ SEYT +  +  E
Sbjct  569  KIQKTKDVPFDKIFAKQQIDLLTAQAWYSENKQLEEKVAKMSIQTGVASEYTRLTLLEME  628

Query  249  ETKGTTEPSKVNK---KTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPG--STSKP  404
                  E  + +K   KT   K+    +  I+L+N G+GFG+L ATA+N PPG      P
Sbjct  629  RGNQAIESPRAHKFSNKTDSLKVDYKGRRRILLQNFGVGFGNLAATADNIPPGVEELKLP  688

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            EAAE+ ++AASNCC  VC +CCCMCCIQ CS++NDQCA+ +TQ
Sbjct  689  EAAELIMKAASNCCGRVCGQCCCMCCIQCCSRMNDQCAIALTQ  731



>ref|XP_009624355.1| PREDICTED: uncharacterized protein LOC104115430 [Nicotiana tomentosiformis]
Length=757

 Score =   117 bits (293),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 104/161 (65%), Gaps = 6/161 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K  ++K+IPL K++ KQQ++ILTA+AWFT+NK L +KIA+ S Q+ +VSEY  MA + TE
Sbjct  574  KGIKSKDIPLDKIMVKQQVDILTAQAWFTENKDLAQKIAKMSAQNAVVSEYARMALVSTE  633

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGST-SKPEAA  413
              +     +K    +   K+++ I    I+L  LG+GFG+LTAT EN PPG+  ++ EAA
Sbjct  634  RVRVIKPTTKRKVHSDAEKIEERIVEKAILLHYLGIGFGNLTATIENIPPGAIETEDEAA  693

Query  414  EMFVQAASNcckmvcdkcccmcciqmcsk-INDQCAVVMTQ  533
            E+  +A SNCC  +C  CCC  C       +N QCA+ ++Q
Sbjct  694  EIIAKATSNCCGKLCGICCCCGCCIRTCSKMNHQCAIALSQ  734


 Score = 39.7 bits (91),  Expect(2) = 1e-29, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE L+A+GILADM+NFS+ L+  K +
Sbjct  551  GVFPEMLKAKGILADMSNFSVELKGIKSK  579



>ref|XP_009337232.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Pyrus 
x bretschneideri]
Length=757

 Score =   126 bits (316),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 82/157 (52%), Positives = 112/157 (71%), Gaps = 4/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+IPL K+  K QIE+LTA+AW+  NK+LE+K+A+ S+Q  +VSEYT M  + T 
Sbjct  575  KLQDAKDIPLDKICTKGQIELLTAQAWYGDNKQLEDKVAKLSMQTNVVSEYTRMVILHT-  633

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  422
            E  G+ E SK   +T   +  + +++L  L +GFG+L ATAEN PPGS  +  PEAAE+F
Sbjct  634  ELSGSQEASK-KSRTNITRDSEKLMLLPTLSVGFGNLVATAENIPPGSEEQKLPEAAEIF  692

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            V+AAS+CC  + ++CCCM CIQ CSK+N QCA V TQ
Sbjct  693  VRAASSCCGAIWNRCCCMACIQCCSKVNPQCATVFTQ  729



>ref|XP_008242259.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X1 [Prunus mume]
Length=753

 Score =   126 bits (316),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 80/157 (51%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+IPL +V AK QIE+LTA+AW   NK+LE+K+A+ S+Q  +VSEYT M  +  E
Sbjct  572  KLQDAKDIPLDRVCAKGQIELLTAQAWLADNKQLEDKVAKLSIQSHVVSEYTRMIIVDKE  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAAEMF  422
            ++     P K   K  D + Q+  I+L +L +GFG+L AT+EN PPGS    +PEAAE+F
Sbjct  632  QSGPQEAPKKSRIKMKDSESQRP-ILLPSLSIGFGNLVATSENVPPGSEEPKQPEAAEIF  690

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +AASNCC  +C  CCCM CI+  S+IN QCA V  Q
Sbjct  691  ARAASNCCGSMCTHCCCMGCIKCFSRINPQCANVFAQ  727



>ref|XP_004251694.1| PREDICTED: uncharacterized protein LOC101250962 [Solanum lycopersicum]
Length=753

 Score =   119 bits (297),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 103/160 (64%), Gaps = 5/160 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K  ++K IPL K   KQQIEILTA+AWFT+NK LE+KIA+ S+Q  ++SEYT MA +  E
Sbjct  571  KGFKSKAIPLDKARVKQQIEILTAQAWFTQNKDLEKKIAKMSIQDAVISEYTRMALVEAE  630

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGSTSKPEAAE  416
            + K     +K      D K+++ +    I+L+  G GFG+LTAT EN PPG+  K + AE
Sbjct  631  KVKIIKSTTKRKVHCDDEKIEERLIQKTILLQYPGFGFGNLTATIENIPPGAIDKEDEAE  690

Query  417  MFVQAASNcc-kmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +  +A SNC  K+    CCC CCI  CS +N QCA+ +TQ
Sbjct  691  IIAKATSNCFGKLCGLCCCCSCCITACSNMNHQCAIALTQ  730


 Score = 37.7 bits (86),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE L+A+GIL DM+NFS+ L+  K +
Sbjct  548  GVFPEMLKAKGILTDMSNFSVELKGFKSK  576



>ref|XP_003595328.1| Inter-alpha-trypsin inhibitor heavy chain H3 [Medicago truncatula]
 gb|AES65579.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=751

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 79/159 (50%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK++PL +V A++QIE LTA+AW T NK+LE KIA+ S+Q G +SEYT M+ +  +
Sbjct  570  KIQNAKDMPLERVFAREQIEYLTAQAWLTNNKQLEHKIAKLSLQTGFLSEYTRMSVLEVD  629

Query  249  --ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAE  416
              +T   ++ +K +KK G+    +  ++L  LG+GFG+L ATAENTPPG    S  ++AE
Sbjct  630  HLKTAKQSDGTKASKKKGEKDQGQRTLLLPKLGIGFGNLAATAENTPPGGDEPSLNDSAE  689

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            MFV+AA++CC    + CCCMCCIQ+C+K+N+QCA V +Q
Sbjct  690  MFVKAATHCCGSCLNHCCCMCCIQVCTKMNNQCATVFSQ  728



>ref|XP_007154569.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
 gb|ESW26563.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
Length=753

 Score =   125 bits (314),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 81/162 (50%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK++P+ +V A+ QI  LTA+AWF +NK+LE+K+A+ S+Q G +SEYT M  + T+
Sbjct  569  KIQNAKDMPVQRVSARDQIHHLTAQAWFLENKQLEQKVAKLSLQTGFISEYTRMVLLETD  628

Query  249  ------ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PE  407
                  E+ GT    K N +   P   + +I+L +LG+GFG+LTATAENTPPG  SK PE
Sbjct  629  HIKKVKESAGTKASEKSNGQFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGYESKLPE  688

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              E+F +AA+NCC+ +C  CCCMCCIQ C+++N+QCA  +TQ
Sbjct  689  VPEIF-KAATNCCETLCSYCCCMCCIQCCARLNNQCATALTQ  729



>ref|XP_010654417.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X2 [Vitis vinifera]
Length=746

 Score =   115 bits (289),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 80/157 (51%), Positives = 110/157 (70%), Gaps = 4/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AKEIPL +V A++QI +LT +AW +++K+LEE+IAR S+Q G  SEYT M  + T+
Sbjct  570  KIQKAKEIPLDRVFARRQINLLTVQAWLSESKQLEERIARMSMQTGFPSEYTCMILLVTD  629

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMF  422
            + K  +E S + ++  D   QK II+L  LG+GFGDLTAT+EN P G      PE  ++ 
Sbjct  630  KGKQASE-SVMLQEMVDSIGQK-IILLGTLGIGFGDLTATSENLPSGVEEPKPPEGTDVI  687

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +AA+NCC MV D+ CCMC IQ CSK+N+QCA+  TQ
Sbjct  688  FKAATNCCAMVADRICCMCFIQACSKLNNQCAIAFTQ  724


 Score = 39.7 bits (91),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQRK  90
            GEFP+SL+A G LADM+NF++ L+ +K ++
Sbjct  547  GEFPDSLKASGSLADMSNFTIDLKIQKAKE  576



>gb|KHN17734.1| von Willebrand factor A domain-containing protein [Glycine soja]
Length=754

 Score =   125 bits (313),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 84/163 (52%), Positives = 117/163 (72%), Gaps = 9/163 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK+IP+ K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G +SEYT M  + T+
Sbjct  569  KIQNAKDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFMSEYTRMIILETD  628

Query  249  ------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSK-P  404
                  E+ GT E SK +    +  +Q + +I+L +LG+GFG+LTATAENTPPG  SK P
Sbjct  629  HLKKVKESAGTKEASKKSHPQYEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKFP  688

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E  E+F +AA+NCC+ +C  CCCMCCIQ C++IN+QCA  +TQ
Sbjct  689  EVPEIF-KAATNCCETLCSYCCCMCCIQCCTRINNQCATALTQ  730



>ref|XP_009777936.1| PREDICTED: uncharacterized protein LOC104227395 [Nicotiana sylvestris]
Length=757

 Score =   117 bits (292),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 103/161 (64%), Gaps = 6/161 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K  E+K+IPL K++ KQQ+EILTA+AWFT+NK L +KIA+ S Q+ ++SEY  M  + TE
Sbjct  574  KGIESKDIPLDKIMVKQQVEILTAQAWFTENKDLAQKIAKMSAQNAVISEYARMTLVSTE  633

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGST-SKPEAA  413
              +     +K    +   K+++ I    I+L  LG+GFG++TAT EN PPG+  S+ EAA
Sbjct  634  RVRVVKPTTKRKVHSDAEKIEERIVETTILLLYLGIGFGNITATIENIPPGAIESEDEAA  693

Query  414  EMFVQAASNcckmvcdkcccmcciqmcsk-INDQCAVVMTQ  533
            E+  +A SNCC  +C  CCC  C       +N QCA+ ++Q
Sbjct  694  EIIAKATSNCCGKLCGICCCCGCCIRTCSKMNHQCAIALSQ  734


 Score = 38.1 bits (87),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G FPE ++A+GILADM+NFS+ L+
Sbjct  551  GVFPEMIKAKGILADMSNFSVELK  574



>ref|XP_007154568.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
 gb|ESW26562.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
Length=602

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK++P+ +V A+ QI  LTA+AWF +NK+LE+K+A+ S+Q G +SEYT M  + T+
Sbjct  418  KIQNAKDMPVQRVSARDQIHHLTAQAWFLENKQLEQKVAKLSLQTGFISEYTRMVLLETD  477

Query  249  ------ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PE  407
                  E+ GT    K N +   P   + +I+L +LG+GFG+LTATAENTPPG  SK PE
Sbjct  478  HIKKVKESAGTKASEKSNGQFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGYESKLPE  537

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              E+F +AA+NCC+ +C  CCCMCCIQ C+++N+QCA  +TQ
Sbjct  538  VPEIF-KAATNCCETLCSYCCCMCCIQCCARLNNQCATALTQ  578



>gb|EYU25841.1| hypothetical protein MIMGU_mgv1a001817mg [Erythranthe guttata]
Length=755

 Score =   118 bits (295),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 116/167 (69%), Gaps = 12/167 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K ++A EIP++K++AK QIE LTA+AWF+ N++L++KIA+ SV +GI+SE+T+M  + TE
Sbjct  570  KVEQASEIPIAKIVAKHQIEQLTAQAWFSDNQELQDKIAKMSVLNGIISEHTSMVLLETE  629

Query  249  ETK---GTTEPSKVNKKTGDPKLQKA-------IIMLRNLGLGFGDLTATAENTPPGS-T  395
              K    +T   +V+ K+   +  KA       I +L N+GLGFG+  AT +N PPG   
Sbjct  630  RGKTKVDSTTKQQVSSKSKADQHNKAEDSKPKRISVLHNVGLGFGNPIATGDNIPPGCKD  689

Query  396  SKP-EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +KP +AAE+FV+AAS CC  + + CCCM CIQ CSK+NDQCA+  TQ
Sbjct  690  TKPADAAEVFVKAASVCCGRLLNHCCCMYCIQCCSKMNDQCAIAFTQ  736


 Score = 36.2 bits (82),  Expect(2) = 8e-29, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G FP +L+  GI+ADM+NFSL L+
Sbjct  547  GSFPNTLKVNGIVADMSNFSLELK  570



>gb|KCW71312.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=596

 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 111/162 (69%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K++P+ ++LAK+QI+ LTA+AWF KN +L EK+AR S+Q  + SEYT M  + T 
Sbjct  412  KVQHVKDVPIDRLLAKRQIDDLTAQAWFQKNTQLAEKVARMSIQSRVPSEYTWMILLETV  471

Query  249  ETKGTTE-----PSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PE  407
              K T++     P KVN KK  D K Q+ +I+L NLG GFG+LTAT +N PPG   K  +
Sbjct  472  REKITSDVTLEVPEKVNFKKMLDLKGQR-VILLGNLGKGFGNLTATVKNIPPGVEEKTSD  530

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AA + V+AASNCC  + D+ CCMC IQ CS +ND+CAV ++Q
Sbjct  531  AANVLVKAASNCCGKLMDRICCMCFIQTCSYVNDRCAVALSQ  572



>gb|KHN12291.1| Inter-alpha-trypsin inhibitor heavy chain H1, partial [Glycine 
soja]
Length=640

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 112/163 (69%), Gaps = 8/163 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K QEAK IP+ ++ A+ QIE LTA+AW +K++KLE+ +A+ S+Q G  SEYT+M  +  +
Sbjct  454  KIQEAKGIPVQRICARDQIEYLTAQAWLSKDEKLEQMVAKLSLQTGFTSEYTSMTILEID  513

Query  249  ------ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKP  404
                  E+ G     K N ++G  + ++ +I+L  LG+GFG+LTATAEN  PGS  T  P
Sbjct  514  LRKKAKESDGKKVSKKSNPQSGAKEQEQRVILLPPLGIGFGNLTATAENIQPGSEETKGP  573

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            + AE+FV+AA+NCC   C+ CCCMCCIQ  ++IN+QCA+  TQ
Sbjct  574  DGAEIFVKAATNCCGTCCNYCCCMCCIQAFTRINNQCAIAFTQ  616



>ref|XP_010666845.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Beta 
vulgaris subsp. vulgaris]
Length=758

 Score =   118 bits (296),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 110/165 (67%), Gaps = 11/165 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K  ++K  PL K+LA Q I + T++AW   +K+LEEK+A+ SV  GIVSEYT+MA   TE
Sbjct  571  KVHKSKAFPLGKILAMQHIIMCTSQAWLLDDKQLEEKVAKMSVHSGIVSEYTSMALFVTE  630

Query  249  ETKGTTEPSKVNKKTG--------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--  398
              K   E +   KKT         DPK QK + + +N+G+GFG++ ATAEN  PG T   
Sbjct  631  TLKKEAEVAVKQKKTSSKSGAEKPDPKPQK-LKVSKNIGIGFGNVKATAENIAPGFTEPK  689

Query  399  KPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             PEAAE+ V+AAS+CC  +C  CCCMCCIQ CSKIN+QCA+ +TQ
Sbjct  690  PPEAAEIIVKAASDCCTRMCGYCCCMCCIQACSKINNQCAITLTQ  734


 Score = 35.4 bits (80),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQRKY  93
            G FPE L+ARGI+A M ++ L L+  K + +
Sbjct  548  GNFPEVLKARGIIAGMTSYELELKVHKSKAF  578



>ref|XP_006416537.1| hypothetical protein EUTSA_v10006890mg [Eutrema salsugineum]
 gb|ESQ34890.1| hypothetical protein EUTSA_v10006890mg [Eutrema salsugineum]
Length=755

 Score =   123 bits (308),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 10/161 (6%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            Q AK++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q G+ SEYT M  I  E T
Sbjct  573  QSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTGVPSEYTRM--IQLEHT  630

Query  255  KGTTEPSKVN--KKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEA  410
            +   +PS     KKT       K+    I L+NLG+GFGD TAT EN PPG   +  P+A
Sbjct  631  EEALKPSDTGGKKKTASNGEKQKMISRTIPLQNLGIGFGDRTATTENVPPGFGEQRAPDA  690

Query  411  AEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AE FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  691  AEKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  731


 Score = 30.4 bits (67),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE+++A G+L D+++FS  L
Sbjct  548  GKFPENVKANGLLGDLSSFSADL  570



>ref|XP_010261798.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Nelumbo nucifera]
Length=753

 Score =   123 bits (308),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 78/164 (48%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK+IPL KV AK+ I++LTA+AW ++NK LEEK+A+ S+Q G+ SEYT+M  + T+
Sbjct  568  KVQNAKDIPLDKVFAKRHIDLLTAQAWLSENKTLEEKVAKMSLQTGVPSEYTHMILLQTD  627

Query  249  ETKGTTEPSKVNKKTGDPKLQK-------AIIMLRNLGLGFGDLTATAENTPPGSTS--K  401
            + K T EP K  ++ G+  L K        I  L +LG  FG+LTAT EN PPGS     
Sbjct  628  KVKQTPEPIKTREELGEIDLAKLVDSKGCKIYSLPSLGTSFGNLTATQENIPPGSGEAYS  687

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             E+AE FV+A S CC  +   CCCMC I+ CS++N++C++++TQ
Sbjct  688  LESAETFVKATSGCCGKLVHACCCMCGIRACSRLNNECSIILTQ  731



>ref|XP_010242255.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Nelumbo nucifera]
Length=750

 Score =   122 bits (307),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 81/163 (50%), Positives = 113/163 (69%), Gaps = 8/163 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK IPL KV AKQQI +LTA+AWF+++K LE+K+A+ S+Q GI SEYT M  + TE
Sbjct  568  KVQKAKGIPLDKVFAKQQIGMLTAQAWFSESKPLEDKVAKMSLQTGIPSEYTCMVLLQTE  627

Query  249  ETKGTTEP---SKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTPPGSTS-KP  404
              K T+EP    +V  K    KL  +    I +L + G+GFG+L ATA+N PPGS     
Sbjct  628  RGKHTSEPLGTGEVWYKIDLAKLMASKDCKINLLPSFGIGFGNLAATADNIPPGSAEVSL  687

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E  ++ V+AASNCC ++ + CCC+ CIQ CS++NDQCA++++Q
Sbjct  688  EPVDILVKAASNCCDILSNNCCCLFCIQTCSRLNDQCAIILSQ  730



>ref|XP_003551107.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Glycine max]
Length=754

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 117/163 (72%), Gaps = 9/163 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK+IP+ K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G +SEYT M  + T+
Sbjct  569  KIQNAKDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFMSEYTRMIILETD  628

Query  249  ------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSK-P  404
                  E+ GT E SK +    +  +Q + +I+L +LG+GFG+LTATAENTPPG  SK P
Sbjct  629  HLKKVKESAGTKEASKKSHPQYEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKFP  688

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E  E+F +AA+NCC+ +C  CCCMCCIQ C++IN+QCA  +TQ
Sbjct  689  EVPEIF-KAATNCCETLCSYCCCMCCIQCCTRINNQCATALTQ  730



>ref|NP_173345.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Arabidopsis 
thaliana]
 gb|AAM97055.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15507.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29803.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Arabidopsis 
thaliana]
Length=754

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 113/159 (71%), Gaps = 5/159 (3%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             Q AK++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q G++SEYT M  +   E
Sbjct  572  VQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTGVLSEYTRMIQLENTE  631

Query  252  TKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  416
                +E     K T + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AAE
Sbjct  632  ELKPSETGGKKKTTSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAE  691

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             FV+AAS+CC  +C+KCCCMCC+Q CSK+NDQC +V TQ
Sbjct  692  KFVKAASSCCVSLCNKCCCMCCVQCCSKLNDQCVLVFTQ  730



>gb|AAF79294.1|AC068602_17 F14D16.26 [Arabidopsis thaliana]
Length=736

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 113/159 (71%), Gaps = 5/159 (3%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             Q AK++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q G++SEYT M  +   E
Sbjct  554  VQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTGVLSEYTRMIQLENTE  613

Query  252  TKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  416
                +E     K T + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AAE
Sbjct  614  ELKPSETGGKKKTTSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAE  673

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             FV+AAS+CC  +C+KCCCMCC+Q CSK+NDQC +V TQ
Sbjct  674  KFVKAASSCCVSLCNKCCCMCCVQCCSKLNDQCVLVFTQ  712



>ref|XP_004508009.1| PREDICTED: uncharacterized protein LOC101514299 [Cicer arietinum]
Length=751

 Score =   115 bits (289),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 78/162 (48%), Positives = 109/162 (67%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+ K IP+ +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  +
Sbjct  568  KIQKDKGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILEND  627

Query  249  ------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKPE  407
                  E+ G  E SK      D  ++ + +I+L +LG+GFG+LTATAENTPPG  + PE
Sbjct  628  HLKKVKESPGAKEVSKKKHSKYDVNVKGQRMILLPHLGIGFGNLTATAENTPPGYETVPE  687

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             AE+F +AASNCC  +C  CCCMCCIQ   KIN+QC   + Q
Sbjct  688  MAEIF-KAASNCCSTMCGYCCCMCCIQCFDKINNQCLTALNQ  728


 Score = 35.8 bits (81),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE+ + +GILAD +NF + L+ +K +
Sbjct  545  GSFPETFKVKGILADFSNFEIDLKIQKDK  573



>ref|XP_008388928.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Malus 
domestica]
Length=755

 Score =   120 bits (301),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 82/157 (52%), Positives = 108/157 (69%), Gaps = 4/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK  PL K+  K QIE+LTA+AW+  NKKLE+K+A+ S+Q  +VSEYT M  +  +
Sbjct  573  KLQDAKXJPLDKLCTKGQIELLTAQAWYGDNKKLEDKVAKLSLQTNVVSEYTRMVIL-HK  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  422
            E  G+ E SK    T   K  +  ++L  L +GFG+L ATAEN PPGS  +  PEAAE+F
Sbjct  632  ELSGSQEASK-KSCTNITKDSEKPMLLPTLSVGFGNLVATAENIPPGSEEQKLPEAAEIF  690

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            V+AAS+CC  + ++CCCM CIQ CSK+N QCA V TQ
Sbjct  691  VRAASSCCGAIWNRCCCMACIQCCSKVNPQCATVFTQ  727


 Score = 30.8 bits (68),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FP +L+ +G+L DM+N  ++L+
Sbjct  550  GKFPSTLKVKGLLPDMSNIEINLK  573



>ref|XP_003542365.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Glycine max]
Length=754

 Score =   119 bits (299),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 81/163 (50%), Positives = 110/163 (67%), Gaps = 9/163 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK+IP+ K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G  SEYT M    T+
Sbjct  569  KIQNAKDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFTSEYTRMMIHETD  628

Query  249  ETKGTTE---PSKVNKKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-P  404
              K   E   P + +KK+      P   + +I+L +LG+GFG+LTATAENTPPG  SK P
Sbjct  629  HLKKVKESSGPKEASKKSNPLFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKLP  688

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E  E+F +AA+NC + +C  CCCMCCIQ C++IN QCA  + Q
Sbjct  689  EVPEIF-KAATNCFETLCSYCCCMCCIQCCTRINSQCATALAQ  730


 Score = 32.0 bits (71),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G FP++L+ +GILAD +NF + ++
Sbjct  546  GNFPKTLKVKGILADFSNFVVDMK  569



>gb|KFK44049.1| hypothetical protein AALP_AA1G209400 [Arabis alpina]
Length=761

 Score =   118 bits (295),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 111/162 (69%), Gaps = 10/162 (6%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             Q AK++PL KV AK  IE+LTAEAWF+++K+L EKIA+ S+Q  + SEYT M  I  E 
Sbjct  578  VQSAKDMPLDKVFAKNVIELLTAEAWFSEDKQLIEKIAKLSIQTSVPSEYTRM--IQLEN  635

Query  252  TKGTTEPSKV---NKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSKPE  407
            T+   +PS     NK   + + QK I   I L +LG+GFGD TAT EN PP  G    P+
Sbjct  636  TEEALKPSDTGGKNKPASNGEKQKLISRTIPLLSLGIGFGDKTATRENVPPGFGEPKAPD  695

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AAE FV+AAS+CC  +C+KCCCMCC+Q CSK+NDQC +V TQ
Sbjct  696  AAEKFVKAASSCCVSLCNKCCCMCCVQCCSKLNDQCVLVFTQ  737


 Score = 33.1 bits (74),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE+++ARG+L D+++FS  L
Sbjct  554  GKFPENVKARGLLGDLSSFSTDL  576



>emb|CDY26699.1| BnaA06g13230D [Brassica napus]
Length=757

 Score =   119 bits (299),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 111/161 (69%), Gaps = 10/161 (6%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            Q AK+IPL KV AK  I++LTA+AWF+++K+L EKI + S+Q G+ SEYT M  I  E T
Sbjct  574  QSAKDIPLDKVFAKNVIDLLTAKAWFSEDKQLIEKITKLSIQTGVPSEYTRM--IQLENT  631

Query  255  KGTTEPSKVN--KKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEA  410
            +   +PS     K+TG      KL    I L+N G+GFGD TAT EN PPG   +  P+A
Sbjct  632  EEALKPSDTGGKKQTGSNGEKQKLISRTIPLQNFGIGFGDTTATRENVPPGFGEQRAPDA  691

Query  411  AEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AE FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  692  AEKFVKAASSCCASLCNKCCCMCCVQCCTKLNDQCVLVFTQ  732


 Score = 31.6 bits (70),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE ++A G+L DM++FS  L
Sbjct  549  GKFPEKVKANGLLGDMSSFSADL  571



>ref|XP_009149386.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Brassica rapa]
Length=757

 Score =   119 bits (299),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 111/161 (69%), Gaps = 10/161 (6%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            Q AK+IPL KV AK  I++LTA+AWF+++K+L EKI + S+Q G+ SEYT M  I  E T
Sbjct  574  QSAKDIPLDKVFAKNVIDLLTAKAWFSEDKQLIEKITKLSIQTGVPSEYTRM--IQLENT  631

Query  255  KGTTEPSKVN--KKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEA  410
            +   +PS     K+TG      KL    I L+N G+GFGD TAT EN PPG   +  P+A
Sbjct  632  EEALKPSDTGGKKQTGSNGEKQKLISRTIPLQNFGIGFGDTTATRENVPPGFGEQRAPDA  691

Query  411  AEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AE FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  692  AEKFVKAASSCCASLCNKCCCMCCVQCCTKLNDQCVLVFTQ  732


 Score = 31.6 bits (70),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE ++A G+L DM++FS  L
Sbjct  549  GKFPEKVKANGLLGDMSSFSADL  571



>ref|XP_006426697.1| hypothetical protein CICLE_v10024980mg [Citrus clementina]
 gb|ESR39937.1| hypothetical protein CICLE_v10024980mg [Citrus clementina]
Length=742

 Score =   121 bits (303),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 79/157 (50%), Positives = 111/157 (71%), Gaps = 6/157 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KAQ AK+IPL ++LA++QIEILTA+AWF+++K+LEEK+A+ S+Q G+ SEYT M    + 
Sbjct  569  KAQNAKDIPLDRLLARRQIEILTAQAWFSESKELEEKVAKMSIQTGVPSEYTCMILFPSG  628

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEMF  422
                T+EP  + ++  D   QK  I+L +LG+GFG+L ATAEN PPG+  T   +A EM 
Sbjct  629  SK--TSEPVFLKERV-DSTSQKN-ILLGSLGVGFGNLKATAENVPPGTEETKSSDATEML  684

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            V AAS CC  + D+ CC C IQ CS +N+QC++V+ Q
Sbjct  685  VNAASICCGRLLDRICCRCFIQTCSSMNNQCSIVLAQ  721



>ref|XP_009359719.1| PREDICTED: uncharacterized protein LOC103950254 [Pyrus x bretschneideri]
Length=755

 Score =   117 bits (294),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 81/157 (52%), Positives = 107/157 (68%), Gaps = 4/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+IPL +V AK QIE+LTA AW+  NK+LE+K+A+ S+Q  +VSEYT M  +  +
Sbjct  573  KLQDAKDIPLDRVCAKGQIELLTARAWYGDNKELEDKVAKLSMQTNVVSEYTRMVIL-HK  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  422
            +  G  E SK N  T + K  +   +L  L +GFG+L ATAEN PPGS     PEAAE+F
Sbjct  632  DLSGPQETSKKN-HTNETKDSEKPTLLPTLSVGFGNLVATAENIPPGSEEPKLPEAAEIF  690

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            V+AAS+CC  +  +CCCM CI  CSK+N QCA  +TQ
Sbjct  691  VRAASSCCGSIWYRCCCMACIHCCSKVNPQCANGLTQ  727


 Score = 33.1 bits (74),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FP SL+A+G+L DM+N  + L+
Sbjct  550  GKFPSSLKAKGLLPDMSNIEIDLK  573



>ref|XP_007138645.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
 gb|ESW10639.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
Length=600

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 113/165 (68%), Gaps = 10/165 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K QEAK+IP+ ++ A+ QIE LTA+AW +K+++LE+++A+ S+Q G +SEYT+MA++  +
Sbjct  412  KIQEAKDIPIQRICARDQIEYLTAQAWLSKDERLEQQVAKLSLQTGFISEYTSMAYLEND  471

Query  249  ETKGTTEPS-------KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSK  401
              K   E         K ++KTG  +  + + +L +LG+GFG+L ATAEN  PGS     
Sbjct  472  HRKNVKESDGKKEVSKKSHQKTGAKEQGQQMFLLPHLGIGFGNLIATAENIQPGSQEAKG  531

Query  402  PEAAEMFVQAASNcc-kmvcdkcccmcciqmcskINDQCAVVMTQ  533
            P+ A++F++AA+NCC  +    CCCMCCI  C++IN+ CAV +TQ
Sbjct  532  PDGADIFIKAATNCCGSLCNHCCCCMCCIHTCTRINNHCAVTITQ  576



>ref|XP_007138646.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
 gb|ESW10640.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
Length=761

 Score =   120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 74/165 (45%), Positives = 115/165 (70%), Gaps = 10/165 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI---  239
            K QEAK+IP+ ++ A+ QIE LTA+AW +K+++LE+++A+ S+Q G +SEYT+MA++   
Sbjct  573  KIQEAKDIPIQRICARDQIEYLTAQAWLSKDERLEQQVAKLSLQTGFISEYTSMAYLEND  632

Query  240  ---GTEETKGTTEPS-KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--  401
                 +E+ G  E S K ++KTG  +  + + +L +LG+GFG+L ATAEN  PGS     
Sbjct  633  HRKNVKESDGKKEVSKKSHQKTGAKEQGQQMFLLPHLGIGFGNLIATAENIQPGSQEAKG  692

Query  402  PEAAEMFVQAASN-cckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            P+ A++F++AA+N C  +    CCCMCCI  C++IN+ CAV +TQ
Sbjct  693  PDGADIFIKAATNCCGSLCNHCCCCMCCIHTCTRINNHCAVTITQ  737



>emb|CDX83787.1| BnaC08g18580D [Brassica napus]
Length=756

 Score =   117 bits (292),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 112/165 (68%), Gaps = 16/165 (10%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             Q AK++PL KV AK  I++LTAEAWF ++K+L+EK+ + S+Q G+ SEYT M      +
Sbjct  572  VQNAKDMPLDKVFAKNLIDLLTAEAWFLEDKQLKEKVTKLSIQTGVPSEYTRMI-----Q  626

Query  252  TKGTTEPSKVNKKTGDPKL------QKAI---IMLRNLGLGFGDLTATAENTPPGSTSK-  401
             + T E SK +   G+ K+      QK I   I L+N  +GFGD+TAT EN PPG   + 
Sbjct  627  LENTEEASKQSDTGGNKKIASNGEKQKMISRTIPLQNFSIGFGDITATRENVPPGYGEQR  686

Query  402  -PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             P+AAE FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  687  APDAAEKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  731


 Score = 33.1 bits (74),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE+++A G+L DM++FS+ L
Sbjct  548  GKFPENVKANGLLGDMSSFSVEL  570



>emb|CDX81914.1| BnaC08g36870D [Brassica napus]
Length=754

 Score =   117 bits (293),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 112/162 (69%), Gaps = 10/162 (6%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             Q AK++PL KV AK  I++LTAEAWF+++ +L+EKI R S+Q G+ SEYT M  I  E 
Sbjct  572  VQSAKDMPLDKVFAKNVIDLLTAEAWFSEDNQLKEKITRLSIQTGVPSEYTRM--IQLEN  629

Query  252  TKGTTEPSKVN--KKT-GDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSKPE  407
            T+  ++P      KKT  + + QK +   I L+N G+GFGD TAT EN PP  G    P+
Sbjct  630  TEEASKPINTGGKKKTETNGEKQKVVSRTIPLQNFGIGFGDTTATKENVPPGFGEARAPD  689

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AAE FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  690  AAEKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVIVFTQ  731


 Score = 32.7 bits (73),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPES++A G+L D+++FS+ L
Sbjct  548  GKFPESVKANGLLGDLSSFSVDL  570



>ref|XP_008337841.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Malus domestica]
Length=751

 Score =   117 bits (292),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 81/157 (52%), Positives = 106/157 (68%), Gaps = 4/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+IPL +V AK QIE+LTA AW+  NK+L++K+A  S+Q  +VSEYT M  +  +
Sbjct  573  KLQDAKDIPLDRVCAKGQIELLTAWAWYGDNKELQDKVAELSMQTNVVSEYTCMVIL-HK  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  422
            E  G  E SK   +T   K  +   +L  L +GFG+L ATAEN PPGS     PEAAE+F
Sbjct  632  ELSGPQETSK-KSRTNKTKDSEKPTLLPTLSVGFGNLVATAENIPPGSEEPKLPEAAEIF  690

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            V+AAS+CC  + ++CCCM CIQ C K+N QCA V TQ
Sbjct  691  VRAASSCCGSMWNRCCCMACIQCCFKVNPQCANVFTQ  727


 Score = 33.1 bits (74),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FP SL+A+G+L DM+N  + L+
Sbjct  550  GKFPSSLKAKGLLPDMSNIEIDLK  573



>ref|XP_008342579.1| PREDICTED: uncharacterized protein LOC103405374 [Malus domestica]
Length=745

 Score =   113 bits (283),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q +K+IPL +VLA++ I++LTA AW   +K+LEEK+++ S Q G+ SEYT +  + T 
Sbjct  562  KVQRSKDIPLDQVLARRHIDMLTAHAWLLGSKELEEKVSKLSKQTGVPSEYTCLILLLTN  621

Query  249  ETKGTTEP-------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSKP  404
            E K   E        +K+ ++       + +I+L NLG GFG+LTAT +N  PGS   KP
Sbjct  622  EGKKAPESVMIQEVYNKITQRKKPESNNQKVIILGNLGFGFGNLTATVQNKAPGSEEEKP  681

Query  405  -EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A EM V AASNCC  V D+ CCMC I+ CS +N+QCA+V+TQ
Sbjct  682  ADATEMLVNAASNCCSRVLDRVCCMCFIRTCSHMNNQCAIVLTQ  725


 Score = 36.6 bits (83),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP+S++ RG LADM+NF + L+ ++ +
Sbjct  539  GSFPDSIKVRGTLADMSNFVIDLKVQRSK  567



>ref|XP_008337842.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like isoform X2 [Malus domestica]
Length=593

 Score =   116 bits (291),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 106/157 (68%), Gaps = 4/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+IPL +V AK QIE+LTA AW+  NK+L++K+A  S+Q  +VSEYT M  +  +
Sbjct  415  KLQDAKDIPLDRVCAKGQIELLTAWAWYGDNKELQDKVAELSMQTNVVSEYTCMVIL-HK  473

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  422
            E  G  E SK   +T   K  +   +L  L +GFG+L ATAEN PPGS     PEAAE+F
Sbjct  474  ELSGPQETSK-KSRTNKTKDSEKPTLLPTLSVGFGNLVATAENIPPGSEEPKLPEAAEIF  532

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            V+AAS+CC  + ++CCCM CIQ C K+N QCA V TQ
Sbjct  533  VRAASSCCGSMWNRCCCMACIQCCFKVNPQCANVFTQ  569


 Score = 33.1 bits (74),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+FP SL+A+G+L DM+N  + L+ +  +
Sbjct  392  GKFPSSLKAKGLLPDMSNIEIDLKLQDAK  420



>ref|XP_010064019.1| PREDICTED: uncharacterized protein LOC104450974 [Eucalyptus grandis]
 gb|KCW71311.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=751

 Score =   120 bits (301),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 82/162 (51%), Positives = 111/162 (69%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K++P+ ++LAK+QI+ LTA+AWF KN +L EK+AR S+Q  + SEYT M  + T 
Sbjct  567  KVQHVKDVPIDRLLAKRQIDDLTAQAWFQKNTQLAEKVARMSIQSRVPSEYTWMILLETV  626

Query  249  ETKGTTE-----PSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PE  407
              K T++     P KVN KK  D K Q+ +I+L NLG GFG+LTAT +N PPG   K  +
Sbjct  627  REKITSDVTLEVPEKVNFKKMLDLKGQR-VILLGNLGKGFGNLTATVKNIPPGVEEKTSD  685

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AA + V+AASNCC  + D+ CCMC IQ CS +ND+CAV ++Q
Sbjct  686  AANVLVKAASNCCGKLMDRICCMCFIQTCSYVNDRCAVALSQ  727



>emb|CDY41019.1| BnaC05g14770D [Brassica napus]
Length=757

 Score =   117 bits (293),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 110/161 (68%), Gaps = 10/161 (6%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            Q AK+IPL KV AK  I++LTA+AWF+++K+L EKI + S+Q G+ SEYT M  I  E T
Sbjct  574  QSAKDIPLDKVFAKNVIDLLTAKAWFSEDKQLIEKITKLSIQTGVPSEYTRM--IQLENT  631

Query  255  KGTTEPSKVN--KKTG----DPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEA  410
            +   +PS     K+TG      KL    I L+N G+GFGD T T EN PPG   +  P+A
Sbjct  632  EEALKPSDTGGKKQTGRNGEKQKLISRTIPLQNFGIGFGDTTVTRENVPPGFGEQRAPDA  691

Query  411  AEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AE FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  692  AEKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  732


 Score = 32.0 bits (71),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE+++A G+L DM++FS  L
Sbjct  549  GKFPENVKANGLLGDMSSFSADL  571



>gb|KHN07890.1| von Willebrand factor A domain-containing protein [Glycine soja]
Length=669

 Score =   117 bits (292),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 111/163 (68%), Gaps = 9/163 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK+IP+ K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G  SEYT M    T+
Sbjct  484  KIQNAKDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFTSEYTRMMIHETD  543

Query  249  ETKGTTE---PSKVNKKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-P  404
              K   E   P + +KK+      P   + +I+L +LG+GFG+LTATAENTPPG  SK P
Sbjct  544  HLKKVKESSGPKEASKKSNPLFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKLP  603

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E  E+F +AA+NC + +C  CCCMCCIQ C++IN+QCA  + Q
Sbjct  604  EVPEIF-KAATNCFETLCSYCCCMCCIQCCTRINNQCATALAQ  645


 Score = 32.0 bits (71),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G FP++L+ +GILAD +NF + ++
Sbjct  461  GNFPKTLKVKGILADFSNFVVDMK  484



>ref|XP_010273855.1| PREDICTED: uncharacterized protein LOC104609280 isoform X3 [Nelumbo 
nucifera]
Length=663

 Score =   115 bits (287),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 79/164 (48%), Positives = 112/164 (68%), Gaps = 10/164 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q++K+IPL KV AK QI++LT +AWF+++K +EEK+A+ S++ G  SEYT M  + TE
Sbjct  483  KVQKSKDIPLDKVSAKNQIDLLTTQAWFSESKPIEEKVAKMSLRIGFPSEYTRMVLLQTE  542

Query  249  ETKGTTE---PSKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTP--PGSTSK  401
              K  TE     ++  K    KL K+    I +L +LG+GFG+L ATA+NTP  PG  S 
Sbjct  543  IGKKVTESFGSEEILNKIDLAKLVKSKGYDITLLPSLGMGFGNLAATADNTPLEPGEISI  602

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             E  E+FV+AASNCC  + + CCC+CCI+ CSK+N++CA V+ Q
Sbjct  603  -EPVEIFVKAASNCCGKLANDCCCLCCIRACSKVNNECATVLLQ  645


 Score = 33.9 bits (76),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP  ++ RGIL DM++F++ L+ +K +
Sbjct  460  GSFPHPVKVRGILGDMSSFTIDLKVQKSK  488



>gb|KHG04434.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=735

 Score =   118 bits (295),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 74/162 (46%), Positives = 107/162 (66%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK+IPL  VLA++QI++LTA+AWF++NK+ EE++A+ S+Q   +SEYT M  +   
Sbjct  550  KIQRAKDIPLDSVLARRQIDLLTAQAWFSENKRFEEEVAKLSIQTCNISEYTRMTLLEKN  609

Query  249  ETKGTTEPSKVNKKTGDPKL-----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PE  407
            +   T +     KK GDP +        +I+L+ L +GFGDL ATAEN  PGS     PE
Sbjct  610  KMLKTLKHFGAWKKKGDPHIVVESELPEMILLQRLSVGFGDLIATAENIRPGSQEPELPE  669

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             A++F++  SN    +C++CCCM CI+ CSK+N+QCA  +TQ
Sbjct  670  VAKIFIKTTSNYFGGICNRCCCMGCIRCCSKMNNQCATTLTQ  711


 Score = 30.8 bits (68),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP++L+  GIL D+++F++ L+ ++ +
Sbjct  527  GSFPDNLKVTGILGDLSSFTMDLKIQRAK  555



>ref|XP_010459567.1| PREDICTED: uncharacterized protein LOC104740606 [Camelina sativa]
Length=754

 Score =   116 bits (291),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-GTE  248
             Q AK++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q  + SEYT M  +  TE
Sbjct  572  VQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTSVPSEYTRMIQLEHTE  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAA  413
            E K +    K  K + + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AA
Sbjct  632  ELKPSDTAGK-KKTSSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAA  690

Query  414  EMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  691  EKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  730


 Score = 31.6 bits (70),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE++ A+G+L D+++FS++L
Sbjct  548  GKFPENVIAKGLLGDLSSFSVNL  570



>ref|XP_010273853.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Nelumbo nucifera]
Length=753

 Score =   114 bits (285),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 79/164 (48%), Positives = 112/164 (68%), Gaps = 10/164 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q++K+IPL KV AK QI++LT +AWF+++K +EEK+A+ S++ G  SEYT M  + TE
Sbjct  573  KVQKSKDIPLDKVSAKNQIDLLTTQAWFSESKPIEEKVAKMSLRIGFPSEYTRMVLLQTE  632

Query  249  ETKGTTE---PSKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTP--PGSTSK  401
              K  TE     ++  K    KL K+    I +L +LG+GFG+L ATA+NTP  PG  S 
Sbjct  633  IGKKVTESFGSEEILNKIDLAKLVKSKGYDITLLPSLGMGFGNLAATADNTPLEPGEISI  692

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             E  E+FV+AASNCC  + + CCC+CCI+ CSK+N++CA V+ Q
Sbjct  693  -EPVEIFVKAASNCCGKLANDCCCLCCIRACSKVNNECATVLLQ  735


 Score = 33.9 bits (76),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP  ++ RGIL DM++F++ L+ +K +
Sbjct  550  GSFPHPVKVRGILGDMSSFTIDLKVQKSK  578



>ref|XP_004488096.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Cicer arietinum]
Length=600

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 111/158 (70%), Gaps = 5/158 (3%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            Q AK++P+ +V A++QIE LTA+AW +K+K+LE+K+A+ S+Q G +SEYT+MA +  +  
Sbjct  419  QNAKDMPIERVFAREQIEYLTAQAWLSKDKQLEQKVAKISLQTGFLSEYTHMAILENDHL  478

Query  255  KGT--TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMF  422
            K    ++ +KV+K  G     + +I+L  LG+GFG+LTAT+EN PPG   TS  + AE+F
Sbjct  479  KKAKQSDGTKVSKGKGGNVQGQRMILLPKLGIGFGNLTATSENIPPGVEDTSLSDGAEIF  538

Query  423  VQAASNcc-kmvcdkcccmcciqmcskINDQCAVVMTQ  533
            V+ A +CC       CCCMCCIQ C+KIN+QCA+  TQ
Sbjct  539  VKKAVDCCGSFCNHCCCCMCCIQACTKINNQCAIAFTQ  576



>ref|XP_006465891.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Citrus sinensis]
Length=751

 Score =   119 bits (297),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 80/163 (49%), Positives = 112/163 (69%), Gaps = 9/163 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--G  242
            KAQ AK+IPL ++LA++QIEILTA+AWF+++K+LEEK+A+ S+Q G+ SEYT M     G
Sbjct  569  KAQNAKDIPLDRLLARRQIEILTAQAWFSESKELEEKVAKMSIQTGVPSEYTCMILFPSG  628

Query  243  TEETKGTTEPSKVNK----KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKP  404
            ++ ++       +NK    K  D   QK  I+L +LG+GFG+L ATAEN PPG+  T   
Sbjct  629  SKTSEPVFLKELLNKVDLLKRVDSTSQKN-ILLGSLGVGFGNLKATAENVPPGTEETKSS  687

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +A EM V AAS CC  + D+ CC C IQ CS +N+QC++V+ Q
Sbjct  688  DATEMLVNAASICCGRLLDRICCRCFIQTCSSMNNQCSIVLAQ  730



>emb|CDY21682.1| BnaA09g44330D [Brassica napus]
Length=754

 Score =   115 bits (287),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 111/162 (69%), Gaps = 10/162 (6%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             Q AK++PL KV AK  I++LTAEAWF+++ + +EKI R S+Q G+ SEYT M  I  E 
Sbjct  572  VQSAKDMPLDKVFAKNVIDLLTAEAWFSEDNQPKEKITRLSIQTGVPSEYTRM--IQLEN  629

Query  252  TKGTTEPSKVN--KKT-GDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSKPE  407
            T+  ++P      KKT  + + QK I   I L+N G+GFGD TAT EN PP  G    P+
Sbjct  630  TEEASKPINTGGKKKTETNGEKQKVISRTIPLQNFGIGFGDTTATKENVPPGFGEARAPD  689

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AAE FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  690  AAEKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVIVFTQ  731


 Score = 32.7 bits (73),  Expect(2) = 7e-27, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPES++A G+L D+++FS+ L
Sbjct  548  GKFPESVKANGLLGDLSSFSVDL  570



>ref|XP_009117566.1| PREDICTED: uncharacterized protein LOC103842665 [Brassica rapa]
Length=754

 Score =   115 bits (287),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 111/162 (69%), Gaps = 10/162 (6%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             Q AK++PL KV AK  I++LTAEAWF+++ + +EKI R S+Q G+ SEYT M  I  E 
Sbjct  572  VQSAKDMPLDKVFAKNVIDLLTAEAWFSEDNQPKEKITRLSIQTGVPSEYTRM--IQLEN  629

Query  252  TKGTTEPSKVN--KKT-GDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSKPE  407
            T+  ++P      KKT  + + QK I   I L+N G+GFGD TAT EN PP  G    P+
Sbjct  630  TEEASKPINTGGKKKTETNGEKQKVISRTIPLQNFGIGFGDTTATKENVPPGFGEARAPD  689

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AAE FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  690  AAEKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVIVFTQ  731


 Score = 32.7 bits (73),  Expect(2) = 7e-27, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPES++A G+L D+++FS+ L
Sbjct  548  GKFPESVKANGLLGDLSSFSVDL  570



>gb|KDO64972.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
Length=751

 Score =   118 bits (296),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 80/163 (49%), Positives = 112/163 (69%), Gaps = 9/163 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--G  242
            KAQ AK+IPL ++LA++QIEILTA+AWF+++K+LEEK+A+ S+Q G+ SEYT M     G
Sbjct  569  KAQNAKDIPLDRLLARRQIEILTAQAWFSESKELEEKVAKMSIQTGVPSEYTCMILFPSG  628

Query  243  TEETKGTTEPSKVNK----KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKP  404
            ++ ++       +NK    K  D   QK  I+L +LG+GFG+L ATAEN PPG+  T   
Sbjct  629  SKTSEPVFLKELLNKVDLLKRVDSTSQKN-ILLGSLGVGFGNLKATAENVPPGTEETKSS  687

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +A EM V AAS CC  + D+ CC C IQ CS +N+QC++V+ Q
Sbjct  688  DATEMLVNAASICCGRLLDRICCRCFIQTCSSMNNQCSIVLAQ  730



>ref|XP_006369125.1| hypothetical protein POPTR_0001s16700g [Populus trichocarpa]
 gb|ERP65694.1| hypothetical protein POPTR_0001s16700g [Populus trichocarpa]
Length=578

 Score =   114 bits (284),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 111/162 (69%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KAQ+AK++P+ +V+A++QI++LTA AW + +K+LE+K+A+ S+Q G+ SEYT M    T 
Sbjct  396  KAQKAKDLPVDRVVARRQIDLLTANAWLSGSKELEQKVAKMSIQSGVPSEYTLMVLHHTL  455

Query  249  ETKGTTEPSKV----NKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGS--TSKPE  407
              +  +E   +    NK     K+  +  IML NL +GFG+L+ATAEN PPG+  T   +
Sbjct  456  REEKASETILIQNVFNKINPLKKMDLQTKIMLGNLCVGFGNLSATAENIPPGTEETKSSD  515

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            A EM   AASNCC  V ++CCCMC IQ CS +N+QCA+V++Q
Sbjct  516  ATEMLFNAASNCCSRVVERCCCMCFIQTCSYMNNQCAIVLSQ  557


 Score = 33.9 bits (76),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP+S++  GILADM  F++ ++ +K +
Sbjct  373  GNFPDSVKLSGILADMRKFTIDIKAQKAK  401



>ref|XP_010498320.1| PREDICTED: uncharacterized protein LOC104776024 [Camelina sativa]
Length=754

 Score =   116 bits (290),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-GTE  248
             Q AK++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q  + SEYT M  +  TE
Sbjct  572  VQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTSVPSEYTIMIQLEHTE  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAA  413
            E K +    K  K + + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AA
Sbjct  632  ELKPSDTAGK-KKTSNNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAA  690

Query  414  EMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  691  EKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVIVFTQ  730


 Score = 31.6 bits (70),  Expect(2) = 7e-27, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE++ A+G+L D+++FS++L
Sbjct  548  GKFPENVIAKGLLGDLSSFSVNL  570



>ref|XP_004488095.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Cicer arietinum]
Length=752

 Score =   118 bits (296),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 75/158 (47%), Positives = 110/158 (70%), Gaps = 5/158 (3%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            Q AK++P+ +V A++QIE LTA+AW +K+K+LE+K+A+ S+Q G +SEYT+MA +  +  
Sbjct  571  QNAKDMPIERVFAREQIEYLTAQAWLSKDKQLEQKVAKISLQTGFLSEYTHMAILENDHL  630

Query  255  KGT--TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMF  422
            K    ++ +KV+K  G     + +I+L  LG+GFG+LTAT+EN PPG   TS  + AE+F
Sbjct  631  KKAKQSDGTKVSKGKGGNVQGQRMILLPKLGIGFGNLTATSENIPPGVEDTSLSDGAEIF  690

Query  423  VQAASN-cckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            V+ A + C       CCCMCCIQ C+KIN+QCA+  TQ
Sbjct  691  VKKAVDCCGSFCNHCCCCMCCIQACTKINNQCAIAFTQ  728



>ref|XP_002532724.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
 gb|EEF29655.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
Length=752

 Score =   108 bits (271),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 107/166 (64%), Gaps = 13/166 (8%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK++ L KV+A++QI++LTA AW +++K LE+K+A+ S+Q  + SEYT+M  I   
Sbjct  568  KTQKAKDVQLDKVIARRQIDVLTANAWMSESKDLEQKVAKMSIQTRVPSEYTHM--ILHR  625

Query  249  ETKGTTEP---------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-  398
               G  EP         +K+N        +   +ML NLG+GFG+L ATA N PPG+ + 
Sbjct  626  TYTGDKEPETILMQEVLNKINPLKQVKSERDKTVMLGNLGVGFGNLKATAANIPPGTDAI  685

Query  399  -KPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              P+A E  V+AAS CC  + D+ CCMC IQ CS +NDQCA+V++Q
Sbjct  686  KSPDATEKIVKAASGCCSRLLDRFCCMCFIQTCSSMNDQCAIVLSQ  731


 Score = 38.1 bits (87),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+FP+S++  GILADM+NF++ L+ +K +
Sbjct  545  GKFPDSVKISGILADMSNFTIELKTQKAK  573



>gb|AES92187.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=752

 Score =   109 bits (273),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 76/162 (47%), Positives = 107/162 (66%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+ K IP+ +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  +
Sbjct  568  KIQKDKGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILEND  627

Query  249  ------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKPE  407
                  E+ G    SK      +  +Q + +I+L NLG+GFG+L ATAENTPPG  +K E
Sbjct  628  HLKKIKESPGEKTVSKKKHSRYEANVQGQRMILLPNLGVGFGNLKATAENTPPGYEAKIE  687

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             AE+F +AASNC   VC  CCCMCCIQ  S++N+QC   + Q
Sbjct  688  MAEIF-KAASNCFDTVCGYCCCMCCIQCFSRMNNQCLTALNQ  728


 Score = 37.0 bits (84),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE+L+ +GILAD +NF + L+ +K +
Sbjct  545  GNFPETLKVKGILADFSNFEIDLKIQKDK  573



>ref|XP_009344471.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Pyrus x bretschneideri]
 ref|XP_009344474.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Pyrus x bretschneideri]
Length=745

 Score =   111 bits (277),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 78/164 (48%), Positives = 108/164 (66%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q +K+IPL +VLA++ I++LTA AW   +++LE+K+++ S Q G+ SEYT M  + T 
Sbjct  562  KVQRSKDIPLDQVLARRHIDMLTAHAWLLGSRELEDKVSKLSKQTGVPSEYTCMILLLTN  621

Query  249  ETKGTTEPSKV----NKKTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGS-TSKP  404
            E K   E   +    NK T   K +   + +I+L NLG GFG+LTAT +N  PGS   KP
Sbjct  622  EEKKAPESVMIQEVYNKITQWKKPESNSQKVIILGNLGFGFGNLTATVQNKAPGSEEEKP  681

Query  405  -EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A EM V AASNCC  V D+ CCMC I+ CS +N+QCA+V+TQ
Sbjct  682  ADATEMLVNAASNCCSRVLDRVCCMCFIRTCSHMNNQCAIVLTQ  725


 Score = 35.4 bits (80),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP+S++ RG LADM+NF + L+ ++ +
Sbjct  539  GSFPDSVKVRGTLADMSNFVIDLKVQRSK  567



>gb|KJB35005.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=597

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 109/165 (66%), Gaps = 11/165 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK++   ++L ++QI+ILT  AW +K+K+LE+K+A+ S+Q    SEYT +  + T+
Sbjct  413  KVQNAKDMSFDRILTRRQIDILTCHAWLSKSKELEDKVAKISLQTSFPSEYTCLILLQTD  472

Query  249  ETKGTTEPSKV----NK----KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--  398
              K   EP  +    NK    K GD K QK ++ L  LG+GFG+LTATA+N PPG+    
Sbjct  473  SEKKVPEPMLLQEIFNKISLPKKGDSKTQK-LVSLGCLGVGFGNLTATAKNIPPGANEPK  531

Query  399  KPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             PE AE+ V AA+NC  +V D+CCCMCCIQ  S +N+QC +V+TQ
Sbjct  532  SPEGAEILVNAATNCFSLVLDRCCCMCCIQTLSYMNNQCYIVLTQ  576



>gb|KEH32426.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=602

 Score =   109 bits (272),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 107/162 (66%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+ K IP+ +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  +
Sbjct  418  KIQKDKGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILEND  477

Query  249  ------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKPE  407
                  E+ G    SK      +  +Q + +I+L NLG+GFG+L ATAENTPPG  +K E
Sbjct  478  HLKKIKESPGEKTVSKKKHSRYEANVQGQRMILLPNLGVGFGNLKATAENTPPGYEAKIE  537

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             AE+F +AASNC   VC  CCCMCCIQ  S++N+QC   + Q
Sbjct  538  MAEIF-KAASNCFDTVCGYCCCMCCIQCFSRMNNQCLTALNQ  578


 Score = 37.0 bits (84),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE+L+ +GILAD +NF + L+ +K +
Sbjct  395  GNFPETLKVKGILADFSNFEIDLKIQKDK  423



>ref|XP_003608035.1| von Willebrand factor A domain-containing protein 5B1 [Medicago 
truncatula]
Length=639

 Score =   108 bits (271),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 107/162 (66%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+ K IP+ +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  +
Sbjct  455  KIQKDKGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILEND  514

Query  249  ------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKPE  407
                  E+ G    SK      +  +Q + +I+L NLG+GFG+L ATAENTPPG  +K E
Sbjct  515  HLKKIKESPGEKTVSKKKHSRYEANVQGQRMILLPNLGVGFGNLKATAENTPPGYEAKIE  574

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             AE+F +AASNC   VC  CCCMCCIQ  S++N+QC   + Q
Sbjct  575  MAEIF-KAASNCFDTVCGYCCCMCCIQCFSRMNNQCLTALNQ  615


 Score = 37.4 bits (85),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE+L+ +GILAD +NF + L+ +K +
Sbjct  432  GNFPETLKVKGILADFSNFEIDLKIQKDK  460



>ref|XP_008356516.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Malus domestica]
Length=308

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q +K+ PL +VLA++ I++LTA AW + +K+LEEK+++ S Q G+ SEYT M  + T 
Sbjct  125  KVQRSKDFPLDRVLARRHIDMLTAHAWLSGSKELEEKVSKLSKQTGVPSEYTCMILLQTN  184

Query  249  ETKGTTEPSKV----NKKTGDPKLQKA---IIMLRNLGLGFGDLTATAENTPPGSTSK--  401
            E K   E   +    NK T   K Q +   +I L NLG+GFG+LTATA+N   GS  +  
Sbjct  185  EAKKAPESVMIQEVYNKITKWKKTQSSSQKMITLGNLGIGFGNLTATAQNKALGSEEEKA  244

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A E+ V+AASNCC    D+ CCMC I  CS +N+QCA+V+TQ
Sbjct  245  ADATELLVKAASNCCSRALDRVCCMCFITTCSHMNNQCAIVLTQ  288



>gb|KJB82977.1| hypothetical protein B456_013G222900 [Gossypium raimondii]
Length=552

 Score =   113 bits (283),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 15/164 (9%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K + AK+IPL  VLA++QI++LTA+AWF++NK+LEEK+A+ S+Q   +SEYT M  +   
Sbjct  371  KIRRAKDIPLDSVLARRQIDLLTAQAWFSENKRLEEKVAKLSIQSCNISEYTRMTLL---  427

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGSTSK--  401
              K   +     KK GDP  QK +       I+L+ L +GFGD  ATAEN  PGS     
Sbjct  428  -EKNIMKHFGAWKKKGDP--QKIVESEPPEMILLQRLSVGFGDPIATAENIRPGSQEPEL  484

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PE A++F++  SN    +C++CCCM CI+ CSK+N+QCA  +TQ
Sbjct  485  PEVAKIFIKTTSNYFGGICNRCCCMGCIRCCSKMNNQCATTLTQ  528


 Score = 31.6 bits (70),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP++L+  GIL D+++F++ L+ ++ +
Sbjct  348  GSFPDNLKVEGILGDLSSFTMDLKIRRAK  376



>ref|XP_002890318.1| hypothetical protein ARALYDRAFT_472131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66577.1| hypothetical protein ARALYDRAFT_472131 [Arabidopsis lyrata subsp. 
lyrata]
Length=755

 Score =   115 bits (287),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 110/159 (69%), Gaps = 5/159 (3%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             + AK++PL KV AK  I++LTAE W +++K+L+EKIA+ S+Q G+ SEYT M  +   E
Sbjct  573  VRSAKDMPLDKVFAKNVIDLLTAEVWLSEDKQLKEKIAKLSIQTGVPSEYTRMIQLENTE  632

Query  252  TKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  416
                +E     K T + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AAE
Sbjct  633  ELKPSETGVKKKTTSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAE  692

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             FV+AAS+CC  +C+KCCCMCC+Q CSK+NDQC +V TQ
Sbjct  693  KFVKAASSCCVSLCNKCCCMCCVQCCSKLNDQCVLVFTQ  731


 Score = 30.0 bits (66),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE++ A+G+L D+++FS  L
Sbjct  549  GKFPENVIAKGLLGDLSSFSTDL  571



>gb|KJB82978.1| hypothetical protein B456_013G222900 [Gossypium raimondii]
Length=749

 Score =   113 bits (282),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 15/164 (9%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K + AK+IPL  VLA++QI++LTA+AWF++NK+LEEK+A+ S+Q   +SEYT M  +   
Sbjct  568  KIRRAKDIPLDSVLARRQIDLLTAQAWFSENKRLEEKVAKLSIQSCNISEYTRMTLL---  624

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGSTSK--  401
              K   +     KK GDP  QK +       I+L+ L +GFGD  ATAEN  PGS     
Sbjct  625  -EKNIMKHFGAWKKKGDP--QKIVESEPPEMILLQRLSVGFGDPIATAENIRPGSQEPEL  681

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PE A++F++  SN    +C++CCCM CI+ CSK+N+QCA  +TQ
Sbjct  682  PEVAKIFIKTTSNYFGGICNRCCCMGCIRCCSKMNNQCATTLTQ  725


 Score = 31.6 bits (70),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP++L+  GIL D+++F++ L+ ++ +
Sbjct  545  GSFPDNLKVEGILGDLSSFTMDLKIRRAK  573



>ref|XP_009110301.1| PREDICTED: uncharacterized protein LOC103835866 [Brassica rapa]
Length=757

 Score =   114 bits (284),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 109/160 (68%), Gaps = 6/160 (4%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-GTE  248
             Q AK++PL KV AK  I++LTAEAWF+++K+L EK+ + S+Q G+ SEYT M  +  TE
Sbjct  573  VQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLIEKVTKLSIQTGVPSEYTRMIQLENTE  632

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAA  413
            E    ++     K   + + QK I   I L+   +GFGD+TAT EN PPG   +  P+AA
Sbjct  633  EASKQSDTGGKKKTASNGEKQKLISRTIPLQKFSIGFGDITATRENVPPGYGEQRAPDAA  692

Query  414  EMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  693  EKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  732


 Score = 31.2 bits (69),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE+++A G+L D ++FS+ L
Sbjct  549  GKFPENVKANGLLGDFSSFSVEL  571



>ref|XP_010477113.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H4-like 
[Camelina sativa]
Length=755

 Score =   114 bits (286),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 113/160 (71%), Gaps = 7/160 (4%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-GTE  248
             Q AK++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S++  + SEYT M  +  TE
Sbjct  573  VQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIETSVPSEYTRMIQLEHTE  632

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAA  413
            E K +    K  K   + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AA
Sbjct  633  ELKPSDTAGK-KKTASNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQRAPDAA  691

Query  414  EMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  692  EKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  731


 Score = 30.0 bits (66),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FP+++ A+G+L D+++FS++L
Sbjct  549  GKFPDNVIAKGLLGDLSSFSVNL  571



>ref|XP_011035743.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Populus euphratica]
Length=756

 Score =   110 bits (276),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 77/164 (47%), Positives = 113/164 (69%), Gaps = 12/164 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KAQ+AK++P+ +V+A++QI++LTA AW + +K+LE+K+A+ S+Q G+ SEYT M    T 
Sbjct  575  KAQKAKDLPVDRVVARRQIDLLTANAWLSGSKELEQKVAKMSIQTGVPSEYTLMVLHHTL  634

Query  249  ETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSK  401
              +  +E        +K+N  K  D +++   IML N  +GFG+L+ATAEN PPG+ T  
Sbjct  635  REEKASETILIRDVFNKINPLKKMDLQMK---IMLGNQCVGFGNLSATAENIPPGTETRS  691

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A EM   AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  692  SDATEMLFNAASNCCSRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  735


 Score = 33.9 bits (76),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP+S++  GILADM  F++ ++ +K +
Sbjct  552  GNFPDSVKLSGILADMRKFTIDIKAQKAK  580



>ref|XP_006385524.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63321.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=416

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 108/163 (66%), Gaps = 9/163 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT-  245
            KAQ+ K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T 
Sbjct  234  KAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTL  293

Query  246  --EETKGTTEPSKVNKKTGDPK---LQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKP  404
              E+   T     V  K    K   LQK  IML NL +GFG+LTATAEN PPG+  T   
Sbjct  294  QDEKAPETILIQDVFNKINPLKKMDLQKT-IMLGNLCVGFGNLTATAENIPPGTEETKSS  352

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            EA EM  +AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  353  EATEMLFKAASNCCGRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  395



>ref|XP_011072601.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105157816 
[Sesamum indicum]
Length=745

 Score =   115 bits (288),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 79/158 (50%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK IP+ +VLA++QI  LTA AWF+ +K+LEEK  + S+  G+ SEYT M  I T+
Sbjct  569  KVQSAKNIPIDRVLARRQINALTAHAWFSGSKQLEEKATKLSLLTGVPSEYTIMILIETD  628

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            +TK +++     +KT D K QK I+ LR LG+GFG + ATAEN PP   ++P   E +E 
Sbjct  629  KTKLSSKSKTAEEKTPDLKGQK-IVFLRGLGIGFGSVQATAENRPP-EHAEPKLYETSEK  686

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              +AAS+ C  V D CCCMC IQ C+++NDQCAV +TQ
Sbjct  687  IFKAASDFCGRVVDCCCCMCFIQFCNRLNDQCAVALTQ  724



>ref|XP_006385523.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63320.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=446

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 108/163 (66%), Gaps = 9/163 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT-  245
            KAQ+ K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T 
Sbjct  264  KAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTL  323

Query  246  --EETKGTTEPSKVNKKTGDPK---LQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKP  404
              E+   T     V  K    K   LQK  IML NL +GFG+LTATAEN PPG+  T   
Sbjct  324  QDEKAPETILIQDVFNKINPLKKMDLQKT-IMLGNLCVGFGNLTATAENIPPGTEETKSS  382

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            EA EM  +AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  383  EATEMLFKAASNCCGRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  425



>gb|KDP40680.1| hypothetical protein JCGZ_24679 [Jatropha curcas]
Length=750

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 115/165 (70%), Gaps = 11/165 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K+Q+AK++ L +VLA++QI+ILTA AW ++++ LE++IA+ S+Q G+ SEYT+M    T+
Sbjct  566  KSQKAKDVQLDRVLARRQIDILTANAWMSESQDLEQQIAKMSIQTGVPSEYTHMILHQTD  625

Query  249  ETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TS  398
              +  TE        +K+N  +  + ++QK +I L NLG+GFGDL ATA N PPG+    
Sbjct  626  TGEKATEKILMQEVFNKINSLRQVNSEIQK-VIFLGNLGVGFGDLAATASNIPPGTDEIK  684

Query  399  KPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             PEA E+ V AASNCC  + D+ CCMC IQ CS++N+QC++ ++Q
Sbjct  685  SPEATEVLVDAASNCCSKLLDRFCCMCFIQTCSRMNNQCSIALSQ  729



>ref|XP_009625888.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like isoform X4 [Nicotiana tomentosiformis]
Length=628

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+ PL +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  +
Sbjct  451  KVQKAKDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVENK  510

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + + T++    ++KT D  ++K +I LR LG GFG+L AT +N P    ++P   E +EM
Sbjct  511  KERQTSKLEVTDEKTSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSEM  568

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               AASN C  +CD CCCMC IQ CS++ND+CAV + Q
Sbjct  569  VFAAASNFCGKLCDCCCCMCFIQFCSRVNDRCAVTLAQ  606



>ref|XP_009625883.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009625884.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009625885.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009625886.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
Length=632

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+ PL +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  +
Sbjct  455  KVQKAKDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVENK  514

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + + T++    ++KT D  ++K +I LR LG GFG+L AT +N P    ++P   E +EM
Sbjct  515  KERQTSKLEVTDEKTSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSEM  572

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               AASN C  +CD CCCMC IQ CS++ND+CAV + Q
Sbjct  573  VFAAASNFCGKLCDCCCCMCFIQFCSRVNDRCAVTLAQ  610



>ref|XP_009625881.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0285981-like isoform X1 [Nicotiana tomentosiformis]
Length=745

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 73/158 (46%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+ PL +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  +
Sbjct  568  KVQKAKDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVENK  627

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + + T++    ++KT D  ++K +I LR LG GFG+L AT +N P    ++P   E +EM
Sbjct  628  KERQTSKLEVTDEKTSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSEM  685

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               AASN C  +CD CCCMC IQ CS++ND+CAV + Q
Sbjct  686  VFAAASNFCGKLCDCCCCMCFIQFCSRVNDRCAVTLAQ  723



>ref|XP_004235553.1| PREDICTED: uncharacterized protein LOC101253877 isoform X1 [Solanum 
lycopersicum]
Length=744

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 76/158 (48%), Positives = 107/158 (68%), Gaps = 4/158 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK++PL +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +   
Sbjct  566  KVQKAKDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVENL  625

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + K T++   V++K  D    K II LR LG+GFG+L ATA+N P    ++P   E +EM
Sbjct  626  KEKQTSKLETVDEKASDQLNVKKIIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSEM  684

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               AASN C  +CD CCCMC IQ CS+++DQCAV + Q
Sbjct  685  VFAAASNLCGKLCDFCCCMCFIQFCSRVSDQCAVTLAQ  722



>emb|CDO97834.1| unnamed protein product [Coffea canephora]
Length=736

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 107/165 (65%), Gaps = 15/165 (9%)
 Frame = +3

Query  48   EQLLSTPKAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTN  227
            E  +   K Q+AK+ P+ ++ A+ QI+ LTA AW +++K+LEEK+ R S+Q G+ SEYTN
Sbjct  559  ENYVIDAKVQKAKDFPMERMCARSQIDALTANAWLSEDKQLEEKVERMSLQTGVPSEYTN  618

Query  228  MAFIGTEETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP-  404
            +  + T++ K  +E S            K +I+LR +G GFG L ATAEN PP  T++P 
Sbjct  619  LVLLETKKEKQISESSG-----------KKVIVLRRVGAGFGSLKATAENLPP-ETAEPK  666

Query  405  --EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              E +EM  +AA N C  + D CCCMC IQ CS++NDQCAVV+TQ
Sbjct  667  LHETSEMITKAARNLCGRMLDCCCCMCFIQFCSRLNDQCAVVLTQ  711



>ref|XP_006342928.1| PREDICTED: uncharacterized protein LOC102599336 [Solanum tuberosum]
Length=744

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 75/158 (47%), Positives = 107/158 (68%), Gaps = 4/158 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+ PL +V A++QIE +TA AWF++N +LEE +A+ S+Q G+ SEYTN+  +   
Sbjct  566  KVQKAKDFPLERVFARRQIETITANAWFSENNQLEEMVAKLSLQTGVPSEYTNLVLVENL  625

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + K T++   V++K  D    K II LR LG+GFG+L ATA+N P    ++P   E +EM
Sbjct  626  KEKQTSKLETVDEKASDQLNVKKIIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSEM  684

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               AASN C  +CD CCCMC IQ CS+++D+CAV + Q
Sbjct  685  VFSAASNLCGKLCDFCCCMCFIQFCSRVSDRCAVTLAQ  722



>ref|XP_011035744.1| PREDICTED: uncharacterized protein LOC105133437 isoform X2 [Populus 
euphratica]
Length=717

 Score =   109 bits (272),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 77/164 (47%), Positives = 113/164 (69%), Gaps = 12/164 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KAQ+AK++P+ +V+A++QI++LTA AW + +K+LE+K+A+ S+Q G+ SEYT M    T 
Sbjct  536  KAQKAKDLPVDRVVARRQIDLLTANAWLSGSKELEQKVAKMSIQTGVPSEYTLMVLHHTL  595

Query  249  ETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSK  401
              +  +E        +K+N  K  D +++   IML N  +GFG+L+ATAEN PPG+ T  
Sbjct  596  REEKASETILIRDVFNKINPLKKMDLQMK---IMLGNQCVGFGNLSATAENIPPGTETRS  652

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A EM   AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  653  SDATEMLFNAASNCCSRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  696


 Score = 33.1 bits (74),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP+S++  GILADM  F++ ++ +K +
Sbjct  513  GNFPDSVKLSGILADMRKFTIDIKAQKAK  541



>emb|CDX96680.1| BnaA08g22230D [Brassica napus]
Length=768

 Score =   111 bits (278),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 6/160 (4%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-GTE  248
             Q AK++PL KV AK  I++LTAEAW +++K+L EK+ + S+Q G+ SEYT M  +  TE
Sbjct  584  VQSAKDMPLDKVFAKNVIDLLTAEAWLSEDKQLIEKVTKLSIQTGVPSEYTRMIQLENTE  643

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAA  413
            E    ++     K   + + QK I   I L+   +GFGD+TAT EN PPG   +  P+AA
Sbjct  644  EASKQSDTGGKKKTASNSEKQKLISRTIPLQKFSIGFGDITATRENVPPGYGEQRAPDAA  703

Query  414  EMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  704  EKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  743


 Score = 30.8 bits (68),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE+++A G+L D ++FS+ L
Sbjct  560  GKFPENVKANGLLGDFSSFSVKL  582



>gb|KJB07327.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=756

 Score =   109 bits (273),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 111/163 (68%), Gaps = 8/163 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K   AK+IPL +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +   
Sbjct  571  KIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEKN  630

Query  249  ETKGTTEPSKVNK-KTGDPK-----LQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--P  404
            +     E S   K K  DP      L     +L++L +GFGDLTATAEN  PG   +  P
Sbjct  631  KIDKAIESSGAQKVKKTDPHKIKDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEQQKLP  690

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +AAE+F++A S+CC  +C++CCCMCCIQ CSK+NDQCA+V+TQ
Sbjct  691  DAAEVFLKATSDCCGRMCNRCCCMCCIQCCSKMNDQCAIVLTQ  733


 Score = 32.3 bits (72),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G FP++L+A+GIL D+++F + L+
Sbjct  548  GSFPDTLKAKGILGDLSSFVMDLK  571



>ref|XP_007024661.1| Inter-alpha-trypsin inhibitor heavy chain-related, putative [Theobroma 
cacao]
 gb|EOY27283.1| Inter-alpha-trypsin inhibitor heavy chain-related, putative [Theobroma 
cacao]
Length=752

 Score =   113 bits (283),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 74/165 (45%), Positives = 109/165 (66%), Gaps = 11/165 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK++P  ++L ++QI+I+T  AWF+++++LEEK+A+ S+Q    SEYT +  + T+
Sbjct  568  KVQNAKDVPFDRMLTRRQIDIVTCHAWFSESQELEEKVAKISLQTSFPSEYTCLILLQTD  627

Query  249  ETKGTTEPSKVNK--------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STS  398
              K   E  +V +        K GD   QK ++ L  +G+GFG+LTATA+N PPG     
Sbjct  628  SEKKVQESIRVQEIFKKINMPKKGDMNGQK-LVFLGCMGVGFGNLTATAKNIPPGIEEPK  686

Query  399  KPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             PE AE+ V+AASNCC  + D+CCCMC IQ CS +N+QC++V TQ
Sbjct  687  SPEGAEILVRAASNCCSTLLDRCCCMCFIQACSYMNNQCSIVFTQ  731



>gb|KHG29331.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=756

 Score =   112 bits (279),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 113/163 (69%), Gaps = 8/163 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K   AK+IPL +VLA+Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +   
Sbjct  571  KIVRAKDIPLDRVLARQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEKN  630

Query  249  ETKGTTEPSKVNK-KTGDP-KLQKAI----IMLRNLGLGFGDLTATAENTPPG--STSKP  404
            +     E S   K K  DP K++  +     +L++L +GFGDLTATAEN  PG      P
Sbjct  631  KIDKAIESSGAQKVKKTDPHKIEDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEEPKLP  690

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +AAE+F++A SNCC  +C++CCCMCCIQ CSK+NDQCA+V+TQ
Sbjct  691  DAAEIFLKATSNCCGRMCNRCCCMCCIQCCSKMNDQCAIVLTQ  733


 Score = 29.6 bits (65),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G FP++L+A+GIL D+++  + L+
Sbjct  548  GSFPDTLKAKGILGDLSSVVMDLK  571



>ref|XP_010537668.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Tarenaya hassleriana]
Length=752

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 7/159 (4%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             Q AK++ L KVLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M  +  E 
Sbjct  572  VQNAKDMLLDKVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMILL--EN  629

Query  252  TKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  416
             +G         K  D + QK +   I L+ LG+GFGD TAT+EN  PG   +  P+AAE
Sbjct  630  IEGPKPKETARMKKVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQKPPDAAE  689

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            MFV+AAS+CC  +C+KCCC+CCIQ CSK+NDQC +V+TQ
Sbjct  690  MFVKAASSCCSSMCNKCCCVCCIQCCSKLNDQCVIVLTQ  728



>ref|XP_004144038.1| PREDICTED: uncharacterized protein LOC101210279 [Cucumis sativus]
 ref|XP_004170362.1| PREDICTED: uncharacterized protein LOC101231061 [Cucumis sativus]
 gb|KGN66313.1| hypothetical protein Csa_1G597110 [Cucumis sativus]
Length=755

 Score =   109 bits (272),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 76/160 (48%), Positives = 107/160 (67%), Gaps = 10/160 (6%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            QEAK+IP+ K+ AK QIE LTAEAW ++NK+L E + + S + G++SEYT M     +  
Sbjct  574  QEAKDIPIDKLFAKDQIEQLTAEAWCSENKQLVEMVKKMSTKMGVLSEYTQMIIF--QNV  631

Query  255  KGTTEPSKVNKKTG------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSKPEAA  413
                E  KV +K         PK  K +++L   G+GFG+L AT++NTP G+   KPEAA
Sbjct  632  DKVIESIKVQQKKNAYEKMVAPKGDK-MLLLPLFGVGFGNLEATSDNTPLGNGERKPEAA  690

Query  414  EMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E+F +AASNCC  +C  CCC CCI+ CS++N+QCA+++TQ
Sbjct  691  EIFAKAASNCCGKLCSFCCCPCCIEACSRMNNQCAILLTQ  730


 Score = 31.6 bits (70),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+FPE ++ARG+LA+++N  L L  ++ +
Sbjct  549  GKFPEVVKARGLLANLDNIVLDLNVQEAK  577



>gb|KJB35006.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=763

 Score =   112 bits (281),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 11/165 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK++   ++L ++QI+ILT  AW +K+K+LE+K+A+ S+Q    SEYT +  + T+
Sbjct  579  KVQNAKDMSFDRILTRRQIDILTCHAWLSKSKELEDKVAKISLQTSFPSEYTCLILLQTD  638

Query  249  ETKGTTEPSKVNK--------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--  398
              K   EP  + +        K GD K QK ++ L  LG+GFG+LTATA+N PPG+    
Sbjct  639  SEKKVPEPMLLQEIFNKISLPKKGDSKTQK-LVSLGCLGVGFGNLTATAKNIPPGANEPK  697

Query  399  KPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             PE AE+ V AA+NC  +V D+CCCMCCIQ  S +N+QC +V+TQ
Sbjct  698  SPEGAEILVNAATNCFSLVLDRCCCMCCIQTLSYMNNQCYIVLTQ  742



>gb|KJB35007.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=745

 Score =   112 bits (281),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 11/165 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK++   ++L ++QI+ILT  AW +K+K+LE+K+A+ S+Q    SEYT +  + T+
Sbjct  561  KVQNAKDMSFDRILTRRQIDILTCHAWLSKSKELEDKVAKISLQTSFPSEYTCLILLQTD  620

Query  249  ETKGTTEPSKVNK--------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--  398
              K   EP  + +        K GD K QK ++ L  LG+GFG+LTATA+N PPG+    
Sbjct  621  SEKKVPEPMLLQEIFNKISLPKKGDSKTQK-LVSLGCLGVGFGNLTATAKNIPPGANEPK  679

Query  399  KPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             PE AE+ V AA+NC  +V D+CCCMCCIQ  S +N+QC +V+TQ
Sbjct  680  SPEGAEILVNAATNCFSLVLDRCCCMCCIQTLSYMNNQCYIVLTQ  724



>gb|KJB07329.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=467

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 114/163 (70%), Gaps = 8/163 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K   AK+IPL +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +   
Sbjct  282  KIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEKN  341

Query  249  ETKGTTEPSKVNK-KTGDP-KLQKAI----IMLRNLGLGFGDLTATAENTPPGSTSK--P  404
            +     E S   K K  DP K++  +     +L++L +GFGDLTATAEN  PG   +  P
Sbjct  342  KIDKAIESSGAQKVKKTDPHKIKDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEQQKLP  401

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +AAE+F++A S+CC  +C++CCCMCCIQ CSK+NDQCA+V+TQ
Sbjct  402  DAAEVFLKATSDCCGRMCNRCCCMCCIQCCSKMNDQCAIVLTQ  444



>ref|XP_010537666.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Tarenaya hassleriana]
Length=756

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 112/161 (70%), Gaps = 7/161 (4%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             Q AK++ L KVLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M  +   E
Sbjct  572  VQNAKDMLLDKVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMILLENIE  631

Query  252  TKGTTEPSKVNK--KTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEA  410
                 E +++ K  +  D + QK +   I L+ LG+GFGD TAT+EN  PG   +  P+A
Sbjct  632  GPKPKETARMKKGIQQVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQKPPDA  691

Query  411  AEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AEMFV+AAS+CC  +C+KCCC+CCIQ CSK+NDQC +V+TQ
Sbjct  692  AEMFVKAASSCCSSMCNKCCCVCCIQCCSKLNDQCVIVLTQ  732



>ref|XP_004287649.1| PREDICTED: uncharacterized protein LOC101300180 [Fragaria vesca 
subsp. vesca]
Length=752

 Score =   112 bits (279),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 73/157 (46%), Positives = 105/157 (67%), Gaps = 4/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+IPL +V AK++IE+LTA+AW ++NK+LE+K+A+ SV  G VSEYT M     E
Sbjct  572  KFQDAKDIPLHRVCAKEEIELLTAQAWLSENKQLEDKVAKMSVHTGAVSEYTRMVICQKE  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  422
            E           KK     L+  +I+  +L +GFG++TAT++N  PG+     PEAAE+F
Sbjct  632  EVVQKASKKSQGKKKDIETLK--MILPHSLCVGFGNVTATSDNLFPGTEEPKLPEAAEIF  689

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            ++A SNCC  +C+ CCC+  I+ CS +N QCA V+TQ
Sbjct  690  IKATSNCCGSMCNNCCCLAFIKCCSHVNPQCANVLTQ  726



>gb|KJB65321.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=565

 Score =   108 bits (270),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI---  239
            K ++A  I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +   
Sbjct  380  KIEKAMNISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEKG  439

Query  240  GTEETKGTTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGSTSK--  401
              E    TTE  KV KK    KL  +     I+L+ L +GFGDL ATAEN  PGS  +  
Sbjct  440  KIERDTDTTEARKVPKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEIL  499

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PE AEM  +A SNCC  +C  CCC+CCI+ CSK+++QC++++TQ
Sbjct  500  PEVAEMLNKATSNCCGRLCRHCCCLCCIRCCSKMSNQCSILLTQ  543


 Score = 30.8 bits (68),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKK  81
            G FP++L+A+GIL D+++  + L+ +K
Sbjct  357  GSFPDTLKAKGILGDLSHVIIDLKIEK  383



>ref|XP_009764208.1| PREDICTED: uncharacterized protein LOC104215964 isoform X1 [Nicotiana 
sylvestris]
Length=745

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 74/158 (47%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+ PL +V A++QI+ILTA AW + +K+LEEK+ + S+Q G+ SEYTN+  +  +
Sbjct  568  KVQKAKDFPLERVFARRQIKILTANAWCSGSKQLEEKVVKMSLQTGVPSEYTNLILVENK  627

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + + T++    ++KT D  ++K II LR LG GFG+L AT  N P    ++P   E +EM
Sbjct  628  KERQTSKLEVADEKTSDLNVKK-IIYLRALGFGFGNLKATMNNLPV-EAAEPKLHETSEM  685

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               AAS+ C  +CD CCCMC IQ CS++NDQCAV + Q
Sbjct  686  VFAAASSLCGKLCDCCCCMCFIQFCSRVNDQCAVTLAQ  723



>ref|XP_008373868.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Malus domestica]
Length=745

 Score =   110 bits (276),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q +K+ PL +VLA++ I++LTA AW + +K+LEEK+++ S Q G+ SEYT M  + T 
Sbjct  562  KVQRSKDFPLDRVLARRHIDMLTAHAWLSGSKELEEKVSKLSKQTGVPSEYTCMILLQTN  621

Query  249  ETKGTTEPSKV----NKKTGDPKLQKA---IIMLRNLGLGFGDLTATAENTPPGSTSK--  401
            E K   E   +    NK T   K Q +   +I L NLG+GFG+LTATA+N   GS  +  
Sbjct  622  EAKKAPESVMIQEVYNKITKWKKTQSSSQKMITLGNLGIGFGNLTATAQNKALGSEEEKA  681

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A E+ V+AASNCC    D+ CCMC I  CS +N+QCA+V+TQ
Sbjct  682  ADATELLVKAASNCCSRALDRVCCMCFITTCSHMNNQCAIVLTQ  725



>gb|KJB07325.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
 gb|KJB07328.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=585

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 111/163 (68%), Gaps = 8/163 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K   AK+IPL +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +   
Sbjct  400  KIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEKN  459

Query  249  ETKGTTEPSKVNK-KTGDPK-----LQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--P  404
            +     E S   K K  DP      L     +L++L +GFGDLTATAEN  PG   +  P
Sbjct  460  KIDKAIESSGAQKVKKTDPHKIKDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEQQKLP  519

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +AAE+F++A S+CC  +C++CCCMCCIQ CSK+NDQCA+V+TQ
Sbjct  520  DAAEVFLKATSDCCGRMCNRCCCMCCIQCCSKMNDQCAIVLTQ  562



>ref|XP_007012610.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 1 [Theobroma 
cacao]
 gb|EOY30229.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 1 [Theobroma 
cacao]
Length=758

 Score =   110 bits (276),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 11/165 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K + AK+I L +VLA+QQI++LTA+AW ++NK+LEEK+A+ S+Q   +SEYT M  +   
Sbjct  570  KIERAKDILLDRVLARQQIDLLTAQAWLSENKQLEEKVAKLSIQTCNISEYTRMVLLEKN  629

Query  249  ETKGTTEPS---KVNKKTGDPKL-----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK-  401
            +    +E S   KV  K GDP           ++L++L +GFGDL ATAEN  PGS    
Sbjct  630  KIYQASESSGSLKVPYK-GDPHEIGDSGAPKKMLLQSLTVGFGDLIATAENIRPGSQEPK  688

Query  402  -PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             PE AE+ V+A SNCC  +C++CCCM CIQ CSK+N+QCA V+TQ
Sbjct  689  LPEVAEILVKATSNCCGQICNQCCCMLCIQCCSKMNNQCATVLTQ  733



>ref|XP_008450941.1| PREDICTED: uncharacterized protein LOC103492379 [Cucumis melo]
Length=755

 Score =   107 bits (268),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 108/161 (67%), Gaps = 10/161 (6%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
             Q+AK+IPL K+ AK QIE LTAEAW ++N++L E + + S + G++SEYT M     + 
Sbjct  573  VQQAKDIPLDKLFAKNQIEQLTAEAWCSENQQLVETVKKMSTKAGVMSEYTQMVIF--QN  630

Query  252  TKGTTEPSKVNKKTG------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSKPEA  410
                 E  KV +K         PK  K +++L   G+GFG+L AT++NTP G+   KPEA
Sbjct  631  ADKVNESIKVQQKKNAYEKMVPPKGDK-MMLLPFCGVGFGNLEATSDNTPLGTGERKPEA  689

Query  411  AEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            AE+FV+AASNCC  +C  CCC CCI+ CS++N+QCA+++TQ
Sbjct  690  AEIFVKAASNCCGNLCSFCCCPCCIETCSRMNNQCAILLTQ  730


 Score = 30.4 bits (67),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+FPE ++A+G+LA+++N  L L  ++ +
Sbjct  549  GKFPEVVKAKGLLANLDNIVLDLNVQQAK  577



>ref|XP_002304123.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|EEE79102.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=757

 Score =   110 bits (275),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 13/165 (8%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KAQ+ K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T 
Sbjct  575  KAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTL  634

Query  249  ETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TS  398
            + +   E        +K+N  K  D  LQK  IML NL +GFG+LTATAEN PPG+  T 
Sbjct  635  QDEKAPETILIQDVFNKINPLKKMD--LQKT-IMLGNLCVGFGNLTATAENIPPGTEETK  691

Query  399  KPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              EA EM  +AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  692  SSEATEMLFKAASNCCGRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  736



>ref|XP_009625882.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0285981-like isoform X2 [Nicotiana tomentosiformis]
Length=744

 Score =   110 bits (275),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 73/158 (46%), Positives = 109/158 (69%), Gaps = 6/158 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+ PL +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  +
Sbjct  568  KVQKAKDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVENK  627

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + + T++  +V  +T D  ++K +I LR LG GFG+L AT +N P    ++P   E +EM
Sbjct  628  KERQTSK-LEVTDETSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSEM  684

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               AASN C  +CD CCCMC IQ CS++ND+CAV + Q
Sbjct  685  VFAAASNFCGKLCDCCCCMCFIQFCSRVNDRCAVTLAQ  722



>ref|XP_010531895.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Tarenaya hassleriana]
Length=756

 Score =   106 bits (264),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            Q  K++PL K+LAK  I++LT EAW  ++++L+EKIA+ S+Q G+ SEYT M  +   E 
Sbjct  575  QNVKDMPLDKILAKNVIDMLTEEAWLLEDRQLQEKIAKISIQTGVPSEYTQMILLENIEG  634

Query  255  KGTTEPS---KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  419
                E     K ++ +   KL    I L+++G GFGD+ AT++N  PG  ++  P+AAE+
Sbjct  635  PKPKEAGGKKKASRNSEKQKLASRKIPLQSIGTGFGDVAATSDNVSPGFEAQKPPDAAEV  694

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              +AASNCC  VC+KCCCMCCIQ CSK+NDQC +V+TQ
Sbjct  695  LAKAASNCCTSVCNKCCCMCCIQCCSKLNDQCVIVLTQ  732


 Score = 32.0 bits (71),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE+++A+G+L D ++F+L L
Sbjct  550  GKFPENVKAKGLLGDFSSFALDL  572



>gb|KJB65318.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=754

 Score =   108 bits (269),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 78/164 (48%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI---  239
            K ++A  I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +   
Sbjct  569  KIEKAMNISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEKG  628

Query  240  GTEETKGTTEPSKVNKKTGDPKL----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--  401
              E    TTE  KV KK    KL    +   I+L+ L +GFGDL ATAEN  PGS  +  
Sbjct  629  KIERDTDTTEARKVPKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEIL  688

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PE AEM  +A SNCC  +C  CCC+CCI+ CSK+++QC++++TQ
Sbjct  689  PEVAEMLNKATSNCCGRLCRHCCCLCCIRCCSKMSNQCSILLTQ  732


 Score = 30.0 bits (66),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKK  81
            G FP++L+A+GIL D+++  + L+ +K
Sbjct  546  GSFPDTLKAKGILGDLSHVIIDLKIEK  572



>ref|XP_006385521.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63318.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=758

 Score =   110 bits (275),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 13/165 (8%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KAQ+ K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T 
Sbjct  576  KAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTL  635

Query  249  ETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TS  398
            + +   E        +K+N  K  D  LQK  IML NL +GFG+LTATAEN PPG+  T 
Sbjct  636  QDEKAPETILIQDVFNKINPLKKMD--LQKT-IMLGNLCVGFGNLTATAENIPPGTEETK  692

Query  399  KPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              EA EM  +AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  693  SSEATEMLFKAASNCCGRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  737



>ref|XP_011036460.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Populus euphratica]
Length=650

 Score =   109 bits (273),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 79/166 (48%), Positives = 110/166 (66%), Gaps = 15/166 (9%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KAQ+ K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T 
Sbjct  468  KAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTL  527

Query  249  ETKGTTEP-------SKVN--KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--T  395
              +   E        +K+N  KK   PK     I+LRNL +GFG+LTATAEN PPG+  T
Sbjct  528  TDEKAPETILIQDVFNKMNPLKKMDFPK----TIVLRNLCVGFGNLTATAENIPPGTEET  583

Query  396  SKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               EA  M V+AASNCC  V D+CCCMC IQ CS +N+QC++V++Q
Sbjct  584  KSSEATGMLVKAASNCCGRVVDRCCCMCFIQTCSYMNNQCSIVLSQ  629



>gb|KJB65322.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=728

 Score =   107 bits (268),  Expect(2) = 8e-24, Method: Composition-based stats.
 Identities = 78/164 (48%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI---  239
            K ++A  I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +   
Sbjct  543  KIEKAMNISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEKG  602

Query  240  GTEETKGTTEPSKVNKKTGDPKL----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--  401
              E    TTE  KV KK    KL    +   I+L+ L +GFGDL ATAEN  PGS  +  
Sbjct  603  KIERDTDTTEARKVPKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEIL  662

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PE AEM  +A SNCC  +C  CCC+CCI+ CSK+++QC++++TQ
Sbjct  663  PEVAEMLNKATSNCCGRLCRHCCCLCCIRCCSKMSNQCSILLTQ  706


 Score = 30.0 bits (66),  Expect(2) = 8e-24, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKK  81
            G FP++L+A+GIL D+++  + L+ +K
Sbjct  520  GSFPDTLKAKGILGDLSHVIIDLKIEK  546



>ref|XP_011036459.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Populus euphratica]
Length=757

 Score =   109 bits (272),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 79/166 (48%), Positives = 110/166 (66%), Gaps = 15/166 (9%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KAQ+ K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T 
Sbjct  575  KAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTL  634

Query  249  ETKGTTEP-------SKVN--KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--T  395
              +   E        +K+N  KK   PK     I+LRNL +GFG+LTATAEN PPG+  T
Sbjct  635  TDEKAPETILIQDVFNKMNPLKKMDFPK----TIVLRNLCVGFGNLTATAENIPPGTEET  690

Query  396  SKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               EA  M V+AASNCC  V D+CCCMC IQ CS +N+QC++V++Q
Sbjct  691  KSSEATGMLVKAASNCCGRVVDRCCCMCFIQTCSYMNNQCSIVLSQ  736



>ref|XP_011036458.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Populus euphratica]
Length=758

 Score =   109 bits (272),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 79/166 (48%), Positives = 110/166 (66%), Gaps = 15/166 (9%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KAQ+ K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T 
Sbjct  576  KAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTL  635

Query  249  ETKGTTEP-------SKVN--KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--T  395
              +   E        +K+N  KK   PK     I+LRNL +GFG+LTATAEN PPG+  T
Sbjct  636  TDEKAPETILIQDVFNKMNPLKKMDFPK----TIVLRNLCVGFGNLTATAENIPPGTEET  691

Query  396  SKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               EA  M V+AASNCC  V D+CCCMC IQ CS +N+QC++V++Q
Sbjct  692  KSSEATGMLVKAASNCCGRVVDRCCCMCFIQTCSYMNNQCSIVLSQ  737



>ref|XP_010318474.1| PREDICTED: uncharacterized protein LOC101253877 isoform X2 [Solanum 
lycopersicum]
Length=743

 Score =   109 bits (272),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 74/158 (47%), Positives = 108/158 (68%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK++PL +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +   
Sbjct  566  KVQKAKDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVENL  625

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + K T++   V++ +    ++K II LR LG+GFG+L ATA+N P    ++P   E +EM
Sbjct  626  KEKQTSKLETVDEASDQLNVKK-IIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSEM  683

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               AASN C  +CD CCCMC IQ CS+++DQCAV + Q
Sbjct  684  VFAAASNLCGKLCDFCCCMCFIQFCSRVSDQCAVTLAQ  721



>gb|KCW71310.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=694

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 8/151 (5%)
 Frame = +3

Query  102  KVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTE----  269
            ++LAK+QI+ LTA+AWF KN +L EK+AR S+Q  + SEYT M  + T   K T++    
Sbjct  521  ELLAKRQIDDLTAQAWFQKNTQLAEKVARMSIQSRVPSEYTWMILLETVREKITSDVTLE  580

Query  270  -PSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEMFVQAASN  440
             P KVN KK  D K Q+ +I+L NLG GFG+LTAT +N PPG   K  +AA + V+AASN
Sbjct  581  VPEKVNFKKMLDLKGQR-VILLGNLGKGFGNLTATVKNIPPGVEEKTSDAANVLVKAASN  639

Query  441  cckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            CC  + D+ CCMC IQ CS +ND+CAV ++Q
Sbjct  640  CCGKLMDRICCMCFIQTCSYVNDRCAVALSQ  670



>gb|KHG11270.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=754

 Score =   105 bits (263),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 111/164 (68%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI---  239
            K ++A +I L K+ A+QQI++LT++AWF++NK+LEEK+A+ S++   +SEYT M  +   
Sbjct  569  KIEKAMDISLDKISARQQIDLLTSQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEKG  628

Query  240  GTEETKGTTEPSKVNKKTGDPKL----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--  401
              E    TT   KV+KK    KL    +   I+L+ L +GFGDL ATAEN  PGS  +  
Sbjct  629  KIERDTDTTGARKVSKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEIL  688

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PE AEM  +A SNCC  +C  CCC+CCI+ CSK+++QC++++TQ
Sbjct  689  PEVAEMLNKATSNCCGRLCRHCCCLCCIRCCSKMSNQCSILLTQ  732


 Score = 30.0 bits (66),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKK  81
            G FP++L+A+GIL D+++  + L+ +K
Sbjct  546  GSFPDTLKAKGILGDLSSVIIDLKIEK  572



>ref|XP_010537667.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Tarenaya hassleriana]
Length=756

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 109/163 (67%), Gaps = 11/163 (7%)
 Frame = +3

Query  72   AQEAKEIPLSK----VLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI  239
             Q AK++ L K    VLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M  +
Sbjct  572  VQNAKDMLLDKLLKQVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMILL  631

Query  240  GTEETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--P  404
              E  +G         K  D + QK +   I L+ LG+GFGD TAT+EN  PG   +  P
Sbjct  632  --ENIEGPKPKETARMKKVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQKPP  689

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +AAEMFV+AAS+CC  +C+KCCC+CCIQ CSK+NDQC +V+TQ
Sbjct  690  DAAEMFVKAASSCCSSMCNKCCCVCCIQCCSKLNDQCVIVLTQ  732



>ref|XP_009764209.1| PREDICTED: uncharacterized protein LOC104215964 isoform X2 [Nicotiana 
sylvestris]
Length=744

 Score =   107 bits (266),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 74/158 (47%), Positives = 107/158 (68%), Gaps = 6/158 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+ PL +V A++QI+ILTA AW + +K+LEEK+ + S+Q G+ SEYTN+  +  +
Sbjct  568  KVQKAKDFPLERVFARRQIKILTANAWCSGSKQLEEKVVKMSLQTGVPSEYTNLILVENK  627

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + + T++  +V  +T D  ++K II LR LG GFG+L AT  N P    ++P   E +EM
Sbjct  628  KERQTSK-LEVADETSDLNVKK-IIYLRALGFGFGNLKATMNNLPV-EAAEPKLHETSEM  684

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               AAS+ C  +CD CCCMC IQ CS++NDQCAV + Q
Sbjct  685  VFAAASSLCGKLCDCCCCMCFIQFCSRVNDQCAVTLAQ  722



>ref|XP_006306812.1| hypothetical protein CARUB_v10008355mg [Capsella rubella]
 gb|EOA39710.1| hypothetical protein CARUB_v10008355mg [Capsella rubella]
Length=780

 Score =   102 bits (255),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 115/189 (61%), Gaps = 39/189 (21%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEK------------------------  179
             Q AK++PL KV AK  I++LTAEAWF+++K+L+EK                        
Sbjct  572  VQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKVCLHFTHPQLSFSGVAPSFCFTFF  631

Query  180  --IARASVQHGIVSEYTNMAFI-GTEETKGTTEPSKVN---KKTGDPKLQKAI---IMLR  332
              IA+ S+Q  + SEYT M  +  TEE K    PS +    K + + + QK I   I L+
Sbjct  632  SQIAKLSIQTSVPSEYTRMIQLEHTEELK----PSDITGKKKTSSNGEKQKMISRTIPLQ  687

Query  333  NLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAASNcckmvcdkcccmcciqmcskIN  506
            +LG+GFGD TAT EN PPG   +  P+AAE FV+AAS+CC  +C+KCCCMCC+Q C+K+N
Sbjct  688  SLGIGFGDQTATRENVPPGFGEQRLPDAAEKFVKAASSCCVSLCNKCCCMCCVQCCTKLN  747

Query  507  DQCAVVMTQ  533
            DQC +V TQ
Sbjct  748  DQCVIVFTQ  756


 Score = 30.8 bits (68),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHL  69
            G+FPE++ A+G+L D+++FS+ L
Sbjct  548  GKFPENVIAKGLLGDLSSFSVDL  570



>ref|XP_010537665.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Tarenaya hassleriana]
Length=760

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 112/165 (68%), Gaps = 11/165 (7%)
 Frame = +3

Query  72   AQEAKEIPLSK----VLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI  239
             Q AK++ L K    VLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M  +
Sbjct  572  VQNAKDMLLDKLLKQVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMILL  631

Query  240  GTEETKGTTEPSKVNK--KTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK-  401
               E     E +++ K  +  D + QK +   I L+ LG+GFGD TAT+EN  PG   + 
Sbjct  632  ENIEGPKPKETARMKKGIQQVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQK  691

Query  402  -PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             P+AAEMFV+AAS+CC  +C+KCCC+CCIQ CSK+NDQC +V+TQ
Sbjct  692  PPDAAEMFVKAASSCCSSMCNKCCCVCCIQCCSKLNDQCVIVLTQ  736



>ref|XP_004303707.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0286969 [Fragaria vesca subsp. vesca]
Length=756

 Score =   106 bits (265),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 72/164 (44%), Positives = 108/164 (66%), Gaps = 9/164 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q +K+ PL +VLAK+ I++LTA AW   +K L+EK+++ S+Q G+ SEYT+M  + T+
Sbjct  574  KVQRSKDFPLDRVLAKRHIDMLTAHAWLLGSKDLQEKVSKMSIQTGVPSEYTSMTLVRTD  633

Query  249  ETKGTTEPS-------KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-KP  404
            + K   E +       KV ++T     ++  I+L +LG+GFG+L AT EN  P S   KP
Sbjct  634  KGKKALELTRTQEVYIKVIQRTKSESCRQKDIILGSLGVGFGNLVATVENKAPESEEPKP  693

Query  405  -EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             + AE+ V+AAS CC  V D+ CCMC I+ C+ +N+QCA+V+TQ
Sbjct  694  SDVAEVLVKAASTCCCRVLDRICCMCFIRTCTHVNNQCAIVLTQ  737



>dbj|BAJ95100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   103 bits (256),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 102/157 (65%), Gaps = 4/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+ K+IPL KVLAKQQ+++LTA+AW ++NK+LE+ +A+ S+Q+GI SEYT    + T 
Sbjct  573  KVQQIKDIPLDKVLAKQQMDLLTAKAWLSENKQLEQMVAKMSIQNGIPSEYTRTVLLQTI  632

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMF  422
              K   +P++  K+      + + + L+ L LGFG++ AT EN     G T  P+  +MF
Sbjct  633  MEK--IDPAQQGKQKPKKPEEPSAMPLQGLTLGFGNVPATTENLTSGFGDTRAPDKFDMF  690

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A   CC  V D CCCMC I  CSK+NDQCA+VM Q
Sbjct  691  GKAVGGCCGRVADCCCCMCFINCCSKMNDQCAIVMVQ  727


 Score = 30.8 bits (68),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKK  81
            GE PE+L A G L+DM+  S+ L+ ++
Sbjct  550  GELPETLYAEGYLSDMSKISIELKVQQ  576



>ref|XP_010318475.1| PREDICTED: uncharacterized protein LOC101253877 isoform X3 [Solanum 
lycopersicum]
Length=739

 Score =   106 bits (264),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 74/158 (47%), Positives = 105/158 (66%), Gaps = 9/158 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK++PL +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +   
Sbjct  566  KVQKAKDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVENL  625

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + K T++   V++        K II LR LG+GFG+L ATA+N P    ++P   E +EM
Sbjct  626  KEKQTSKLETVDELN-----VKKIIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSEM  679

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               AASN C  +CD CCCMC IQ CS+++DQCAV + Q
Sbjct  680  VFAAASNLCGKLCDFCCCMCFIQFCSRVSDQCAVTLAQ  717



>ref|XP_007012611.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 2 [Theobroma 
cacao]
 gb|EOY30230.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 2 [Theobroma 
cacao]
Length=759

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 81/166 (49%), Positives = 111/166 (67%), Gaps = 12/166 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEK-IARASVQHGIVSEYTNMAFIGT  245
            K + AK+I L +VLA+QQI++LTA+AW ++NK+LEEK +A+ S+Q   +SEYT M  +  
Sbjct  570  KIERAKDILLDRVLARQQIDLLTAQAWLSENKQLEEKVVAKLSIQTCNISEYTRMVLLEK  629

Query  246  EETKGTTEPS---KVNKKTGDPKL-----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK  401
             +    +E S   KV  K GDP           ++L++L +GFGDL ATAEN  PGS   
Sbjct  630  NKIYQASESSGSLKVPYK-GDPHEIGDSGAPKKMLLQSLTVGFGDLIATAENIRPGSQEP  688

Query  402  --PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              PE AE+ V+A SNCC  +C++CCCM CIQ CSK+N+QCA V+TQ
Sbjct  689  KLPEVAEILVKATSNCCGQICNQCCCMLCIQCCSKMNNQCATVLTQ  734



>gb|KJB07323.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=781

 Score =   100 bits (249),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 115/188 (61%), Gaps = 33/188 (18%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K   AK+IPL +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +   
Sbjct  571  KIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEKN  630

Query  249  ETKGTTEPS---------------KVN------------KKTGDPKLQKAI----IMLRN  335
            +     E S                VN            KKT   K++  +     +L++
Sbjct  631  KIDKAIESSGAQKVCLSLIRNSIITVNLNSQKLGFSIQVKKTDPHKIKDPLAPRKTLLQS  690

Query  336  LGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAASNcckmvcdkcccmcciqmcskIND  509
            L +GFGDLTATAEN  PG   +  P+AAE+F++A S+CC  +C++CCCMCCIQ CSK+ND
Sbjct  691  LSVGFGDLTATAENIRPGFEQQKLPDAAEVFLKATSDCCGRMCNRCCCMCCIQCCSKMND  750

Query  510  QCAVVMTQ  533
            QCA+V+TQ
Sbjct  751  QCAIVLTQ  758


 Score = 32.3 bits (72),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G FP++L+A+GIL D+++F + L+
Sbjct  548  GSFPDTLKAKGILGDLSSFVMDLK  571



>ref|XP_010685291.1| PREDICTED: uncharacterized protein LOC104899734 [Beta vulgaris 
subsp. vulgaris]
Length=756

 Score = 99.0 bits (245),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 66/163 (40%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K  +AK+IPL KV A+ +++ LTA+AWFT++K++E+++A  S+Q G+ SEYT M    T+
Sbjct  572  KVSKAKDIPLDKVFAQTRVDTLTAKAWFTRSKEVEKQVADISMQTGVPSEYTRMILFQTD  631

Query  249  ETKG-----TTEPSKVNKKTGDPKLQKA--IIMLRNLGLGFGDLTATAENTPPGSTSK-P  404
                     T +  +   K+   K+ ++  I++L++LG GFGDL  TAEN PPG   K P
Sbjct  632  SWNHGPDAITIQGKEAYDKSSTLKMVRSQKIMVLQSLGFGFGDLIKTAENLPPGVIIKAP  691

Query  405  EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +  ++ V AA+ CC  + D+ CCMC IQ  SK++D+C + ++Q
Sbjct  692  DTTDLLVNAAAGCCGRLLDRFCCMCFIQGISKLSDRCVITLSQ  734


 Score = 33.5 bits (75),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+ PESL+ RG LADM++F   L+  K +
Sbjct  549  GKLPESLKVRGTLADMSSFVTDLKVSKAK  577



>ref|XP_006390650.1| hypothetical protein EUTSA_v10018177mg [Eutrema salsugineum]
 gb|ESQ27936.1| hypothetical protein EUTSA_v10018177mg [Eutrema salsugineum]
Length=756

 Score = 99.8 bits (247),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 70/166 (42%), Positives = 100/166 (60%), Gaps = 17/166 (10%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTN--MAFIGTE  248
            Q+AK+IPL KVLA++QI+ LTA+AWF   K+L+EK+ R S+Q G  SEYT   ++    E
Sbjct  572  QKAKDIPLDKVLARRQIDELTAQAWFEDKKELQEKVTRLSIQTGFPSEYTQIVLSLQQNE  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRN---------LGLGFGDLTATAENTPP--GST  395
            E K    P  + +   +P  Q    M RN          G GFG++TAT +N PP     
Sbjct  632  EEKTMERPVSIKEILRNPSYQIHKQMQRNSEKTSLLGKQGFGFGNVTATLKNVPPWMEEP  691

Query  396  SKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +PE AE+ ++AAS     V D+ CCMCC++  SK++DQC +V++Q
Sbjct  692  KEPEGAEILIRAASG----VVDRVCCMCCLRCVSKVSDQCTIVLSQ  733


 Score = 32.0 bits (71),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+FP+ +E RG LAD++ F++ L  +K +
Sbjct  547  GQFPDEVELRGTLADLSCFTIELTVQKAK  575



>ref|XP_009105911.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Brassica 
rapa]
 emb|CDX96412.1| BnaA07g30230D [Brassica napus]
Length=756

 Score = 97.1 bits (240),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 68/166 (41%), Positives = 99/166 (60%), Gaps = 17/166 (10%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTE  248
            ++AK+IPL KVLA++QI+ LTA+AWF   K+L++K+ R S+Q G  SEYT M  +    +
Sbjct  572  EKAKDIPLDKVLARRQIDELTAQAWFEDKKELQDKVMRLSIQTGFPSEYTQMVLSLKDND  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNL---------GLGFGDLTATAENTPP--GST  395
            E K    P  + +   +P  Q    M RN+         G GFG+L AT +N PP     
Sbjct  632  EEKTIERPVSIKEILRNPSYQIQKQMSRNIERTSLLGKQGFGFGNLAATLKNIPPWMEEP  691

Query  396  SKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +PE AE+ ++AAS     V D+ CCMCC+Q  S+++DQC +V +Q
Sbjct  692  KEPEGAEILIRAASG----VVDRVCCMCCLQCLSRVSDQCTIVFSQ  733


 Score = 33.9 bits (76),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+FP+ +E RG LADM+ F++ L  +K +
Sbjct  547  GQFPDEVELRGTLADMSCFTIELTVEKAK  575



>emb|CDX72920.1| BnaC06g33680D [Brassica napus]
Length=756

 Score = 96.3 bits (238),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 68/166 (41%), Positives = 99/166 (60%), Gaps = 17/166 (10%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTE  248
            ++AK+IPL KVLA++QI+ LTA+AWF   K+L++K+ R S+Q G  SEYT M  +    +
Sbjct  572  EKAKDIPLDKVLARRQIDELTAQAWFEDKKELQDKVTRLSIQTGFPSEYTQMILSLKDND  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNL---------GLGFGDLTATAENTPP--GST  395
            E K    P  + +   +P  Q    M RN+         G GFG+L AT +N PP     
Sbjct  632  EEKTIERPVSIKEILRNPSYQIHKQMSRNIERTSLLGKQGFGFGNLAATLKNLPPWMEEP  691

Query  396  SKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +PE AE+ ++AAS     V D+ CCMCC+Q  S+++DQC +V +Q
Sbjct  692  KEPEGAEILIRAASG----VVDRVCCMCCLQCLSRVSDQCTIVFSQ  733


 Score = 33.5 bits (75),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+FP+ +E RG LADM+ F++ L  +K +
Sbjct  547  GQFPDEVELRGTLADMSCFTIELTVEKAK  575



>ref|XP_004141711.1| PREDICTED: uncharacterized protein LOC101206287 [Cucumis sativus]
 ref|XP_004155911.1| PREDICTED: uncharacterized LOC101206287 [Cucumis sativus]
 gb|KGN45475.1| hypothetical protein Csa_7G448860 [Cucumis sativus]
Length=754

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 70/166 (42%), Positives = 106/166 (64%), Gaps = 13/166 (8%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            +AQ AKE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  +
Sbjct  568  QAQRAKELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFSSEYTRLILVLAK  627

Query  249  ETKGTTEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTS  398
            E  G   PS +++K       T   K++   + II+L N G+GFG+LTATAEN  PG   
Sbjct  628  E--GKKAPSIISQKMRKRFDLTKSKKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKEI  685

Query  399  KP-EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            K  +A ++ V+AA+NC   + D+ CC+C I+ C  +ND+C V  TQ
Sbjct  686  KATQATDLLVKAATNCFGRLIDRFCCLCFIKSCMYMNDRCVVAFTQ  731



>ref|XP_003557739.1| PREDICTED: uncharacterized protein LOC100836064 [Brachypodium 
distachyon]
Length=754

 Score =   100 bits (248),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 72/159 (45%), Positives = 99/159 (62%), Gaps = 5/159 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT-  245
            K Q  K+IPL KVLAKQQ+++LT++AW ++NK+LE+K+A+ S+Q+ I SEYT    + T 
Sbjct  572  KVQHIKDIPLGKVLAKQQVDLLTSKAWLSENKQLEQKVAKLSIQNSIPSEYTRTVLLQTI  631

Query  246  -EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAE  416
             E+     +  +  KK G    + +   L  L LGFG++ AT EN     G T  P+  E
Sbjct  632  LEKVDPAQQGKQKPKKHGSAD-ESSATPLNGLTLGFGNVAATMENLTSGFGDTKAPDKFE  690

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            MF ++   CC  V D CCCMC I  CSK+NDQCA+VM Q
Sbjct  691  MFGKSVGGCCSRVADCCCCMCFINACSKMNDQCAIVMVQ  729


 Score = 28.9 bits (63),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LAD +  S+ L+
Sbjct  549  GKLPETLSAKGYLADKSEISIELK  572



>gb|EYU21307.1| hypothetical protein MIMGU_mgv1a001939mg [Erythranthe guttata]
Length=736

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q AK+IPL K+ A++QI  LT  AWF+ +K+LEEK  + S+  G+ SEYT +  + T 
Sbjct  575  KVQNAKDIPLDKIFARRQINALTTNAWFSGSKELEEKATKLSLLTGVPSEYTTIILVETI  634

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  419
            + K  +    + +KT   K QK +I +R LG+G+G+  AT EN  P + ++P   E+ E+
Sbjct  635  KNKSLSNRKTLQEKT--VKEQKNMIYMRRLGIGYGNTEATVENRAPAN-AEPKLYESTEI  691

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              +AASN C  + D CCCMC IQ C+++NDQCA+ +TQ
Sbjct  692  IFKAASNLCGRLVDCCCCMCFIQFCNRLNDQCAIALTQ  729



>gb|KFK41669.1| hypothetical protein AALP_AA2G157400 [Arabis alpina]
Length=761

 Score = 94.7 bits (234),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 66/166 (40%), Positives = 96/166 (58%), Gaps = 13/166 (8%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE--  248
            Q+AK+IPL KVLA++QI+ LT+ AWF    +L+EK+ R S++ G   EYT +     +  
Sbjct  573  QKAKDIPLDKVLARRQIDELTSRAWFEDKIELQEKVTRLSIETGFPCEYTQLVLSLKDEE  632

Query  249  -ETKGTTEPSKVNKKTGDPKLQKAIIMLRN---------LGLGFGDLTATAENTPPGSTS  398
             E K  T P+ + +   +P  Q    M RN          G GFG++ AT +N PP    
Sbjct  633  GEEKTITRPASIKEILRNPPYQIHKQMTRNSERTSLLGKQGFGFGNVAATLKNIPPWMEE  692

Query  399  K-PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            K PE AE+ ++AAS   + V D+ CCMCC+   S+++DQC VV +Q
Sbjct  693  KEPEGAEILIKAASGVVEGVVDRVCCMCCLSCVSRMSDQCTVVFSQ  738


 Score = 33.5 bits (75),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            GEFP+ +E RG LAD+  F++ L  +K +
Sbjct  548  GEFPDEVELRGTLADLTCFTIELTVQKAK  576



>ref|XP_009414822.1| PREDICTED: uncharacterized protein LOC103995835 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=754

 Score = 92.8 bits (229),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 65/160 (41%), Positives = 97/160 (61%), Gaps = 7/160 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+ PL K  +KQ I++LTA+AWF+++K L+EK+ + S+Q  I SEYT M F+ T+
Sbjct  574  KVQHTKDFPLEKAFSKQHIDLLTAQAWFSESKLLQEKVTKLSIQSSIPSEYTCMVFLQTD  633

Query  249  ETKGTT---EPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAA  413
              K         K ++K  +PK +   +++R   +GFGD+ AT EN P   G   +PE  
Sbjct  634  TGKQEAIKQVKKKDSRKHANPK-ENLSVLVRRTAIGFGDIIATTENHPTGFGGLKEPETF  692

Query  414  EMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +++ +A   CC  +   CCC C I+ CSK+NDQ  +VMTQ
Sbjct  693  DVYNKAVG-CCNGIAYCCCCPCFIKTCSKVNDQLVIVMTQ  731


 Score = 35.0 bits (79),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 13/31 (42%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQRKY  93
            G+FPE+L+A+GILADM++  + L+ +  + +
Sbjct  551  GKFPETLKAKGILADMSDIIIDLKVQHTKDF  581



>ref|XP_010416000.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Camelina sativa]
Length=759

 Score = 93.6 bits (231),  Expect(2) = 8e-21, Method: Composition-based stats.
 Identities = 70/167 (42%), Positives = 96/167 (57%), Gaps = 18/167 (11%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTE  248
            Q+AK+IPL KVLA++QI+ LTA AWF   K+L+EK+ R S+Q G  SEYT M  +    +
Sbjct  574  QKAKDIPLDKVLARRQIDELTARAWFEDKKELQEKVMRLSIQTGAPSEYTQMVLSLQQDD  633

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPGSTS  398
            E K    P  + +   +P  Q    M RN           G GFG++ AT +N PP    
Sbjct  634  EEKTMARPVSIKEILRNPPYQIHKQMQRNNSFRTSLLGKQGYGFGNIVATLKNVPPWMEE  693

Query  399  KPEA--AEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              EA  AE+ ++AAS     V D+ CCMCC+Q  S+++DQC VV +Q
Sbjct  694  PKEADGAELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTVVFSQ  736


 Score = 33.9 bits (76),  Expect(2) = 8e-21, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            GEFP+ +E RG LAD++ F++ L  +K +
Sbjct  549  GEFPDEIELRGTLADLSCFTIELTVQKAK  577



>ref|XP_010471276.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Camelina sativa]
Length=758

 Score = 93.2 bits (230),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 70/167 (42%), Positives = 96/167 (57%), Gaps = 18/167 (11%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTE  248
            Q+AK+IPL KVLA++QI+ LTA AWF   K+L+EK+ R S+Q G  SEYT M  +    +
Sbjct  573  QKAKDIPLDKVLARRQIDELTARAWFEDKKELQEKVMRLSIQTGAPSEYTQMVLSLQQDD  632

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPGSTS  398
            E K    P  + +   +P  Q    M RN           G GFG++ AT +N PP    
Sbjct  633  EEKTMARPVSIKEILRNPPYQIHKQMQRNNSFRTSLLGKQGYGFGNIVATLKNVPPWMEE  692

Query  399  KPEA--AEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              EA  AE+ ++AAS     V D+ CCMCC+Q  S+++DQC VV +Q
Sbjct  693  PKEADGAELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTVVFSQ  735


 Score = 33.9 bits (76),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            GEFP+ +E RG LAD++ F++ L  +K +
Sbjct  548  GEFPDEIELRGTLADLSCFTIELTVQKAK  576



>ref|NP_177394.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE35331.1| uncharacterized protein AT1G72500 [Arabidopsis thaliana]
Length=756

 Score = 92.0 bits (227),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 68/167 (41%), Positives = 98/167 (59%), Gaps = 18/167 (11%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--GTE  248
            Q+AK+IPL KVLA++QI  LTA AWF   K+L+EK+ R S+Q G  SEYT M       E
Sbjct  572  QKAKDIPLDKVLARRQINELTARAWFEDKKELQEKVMRLSIQTGFPSEYTQMVLSVKHDE  631

Query  249  ETKGTTEPSKVNKKTGDP------KLQKAIIMLRNL----GLGFGDLTATAENTPP--GS  392
            E K    P  + +   +P      ++Q++  M R+L    G GFG++ AT +N PP    
Sbjct  632  EEKTMARPVSIKEILRNPPYQIHKQMQRSNSMRRSLLGKQGYGFGNVAATLKNVPPWMEE  691

Query  393  TSKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              + E  E+ ++AAS     V D+ CCMCC+Q  S+++DQC +V +Q
Sbjct  692  PKEVEGTELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTIVFSQ  734


 Score = 35.0 bits (79),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            GEFP+ +E RG LADM+ F++ L  +K +
Sbjct  547  GEFPDEVELRGTLADMSCFTIELTVQKAK  575



>gb|AAG52586.1|AC016529_17 hypothetical protein; 14673-17893 [Arabidopsis thaliana]
Length=758

 Score = 92.0 bits (227),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 68/167 (41%), Positives = 98/167 (59%), Gaps = 18/167 (11%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--GTE  248
            Q+AK+IPL KVLA++QI  LTA AWF   K+L+EK+ R S+Q G  SEYT M       E
Sbjct  574  QKAKDIPLDKVLARRQINELTARAWFEDKKELQEKVMRLSIQTGFPSEYTQMVLSVKHDE  633

Query  249  ETKGTTEPSKVNKKTGDP------KLQKAIIMLRNL----GLGFGDLTATAENTPP--GS  392
            E K    P  + +   +P      ++Q++  M R+L    G GFG++ AT +N PP    
Sbjct  634  EEKTMARPVSIKEILRNPPYQIHKQMQRSNSMRRSLLGKQGYGFGNVAATLKNVPPWMEE  693

Query  393  TSKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              + E  E+ ++AAS     V D+ CCMCC+Q  S+++DQC +V +Q
Sbjct  694  PKEVEGTELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTIVFSQ  736


 Score = 35.0 bits (79),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            GEFP+ +E RG LADM+ F++ L  +K +
Sbjct  549  GEFPDEVELRGTLADMSCFTIELTVQKAK  577



>ref|XP_010428136.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X1 [Camelina sativa]
 ref|XP_010428137.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Camelina sativa]
Length=758

 Score = 93.2 bits (230),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 70/167 (42%), Positives = 96/167 (57%), Gaps = 18/167 (11%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTE  248
            Q+AK+IPL KVLA++QI+ LTA AWF   K+L+EK+ R S+Q G  SEYT M  +    +
Sbjct  573  QKAKDIPLDKVLARRQIDELTARAWFEDKKELQEKVMRLSIQTGAPSEYTQMVLSLQQDD  632

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPGSTS  398
            E K    P  + +   +P  Q    M RN           G GFG++ AT +N PP    
Sbjct  633  EEKTMARPVSIKEILRNPPYQIHKQMQRNNSFRTSLLGKQGYGFGNVVATLKNVPPWMEE  692

Query  399  KPEA--AEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              EA  AE+ ++AAS     V D+ CCMCC+Q  S+++DQC VV +Q
Sbjct  693  PKEADGAELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTVVFSQ  735


 Score = 33.9 bits (76),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            GEFP+ +E RG LAD++ F++ L  +K +
Sbjct  548  GEFPDEIELRGTLADLSCFTIELTVQKAK  576



>ref|XP_010111991.1| von Willebrand factor A domain-containing protein [Morus notabilis]
 gb|EXC32302.1| von Willebrand factor A domain-containing protein [Morus notabilis]
Length=745

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 105/166 (63%), Gaps = 13/166 (8%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK+ PL++VLA++QI++LT+ AW T +K+LEEK+A+ S Q G+ SEYT M  + ++
Sbjct  563  KVQKAKDFPLNRVLARRQIDMLTSHAWLTGSKELEEKVAKMSKQTGVPSEYTLMILVNSD  622

Query  249  ETKGTTEPSKVNKKTGDPKL---------QKAIIMLRNLGLGFGDLTATAEN--TPPGST  395
              KG   P  V  +  D KL         ++ I+ L +LG+GFGDL ATA N  +     
Sbjct  623  --KGKILPDSVPAQEADNKLKLWKKSESSKEKILFLGSLGMGFGDLAATAANKLSIIEEL  680

Query  396  SKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               E A   V+AASNCC  + ++ CCMC IQ CS +ND+CA+++ Q
Sbjct  681  KASEPANFLVKAASNCCSHLLNRFCCMCFIQTCSYMNDRCAILLAQ  726



>ref|XP_004984065.1| PREDICTED: uncharacterized protein LOC101774989 isoform X2 [Setaria 
italica]
Length=632

 Score = 97.1 bits (240),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 96/159 (60%), Gaps = 6/159 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+IPL KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T 
Sbjct  453  KVQHVKDIPLDKVLAKQQMDLLTAKAWLLENKELERKVVKLSIQNSLPSEYTRMVLLQTN  512

Query  249  ETKGTTEPSKVNK--KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAE  416
              K        NK  K   P  +++ + LR L LGFGD+ AT EN     G     E  E
Sbjct  513  LDKIDPAQQAKNKPTKQSSPD-ERSAMPLRGLTLGFGDVVATRENLTAGFGDIEVHERFE  571

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +F +A   CC  + D  CCMC I+ CSK+NDQCA+VM Q
Sbjct  572  IFDKAV-GCCSRMADCFCCMCFIKACSKMNDQCAIVMAQ  609


 Score = 29.6 bits (65),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LADM+  S+ L+
Sbjct  430  GKLPETLIAKGHLADMSEISIELK  453



>ref|XP_002888881.1| hypothetical protein ARALYDRAFT_476383 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65140.1| hypothetical protein ARALYDRAFT_476383 [Arabidopsis lyrata subsp. 
lyrata]
Length=757

 Score = 91.3 bits (225),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 68/167 (41%), Positives = 95/167 (57%), Gaps = 18/167 (11%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTE  248
            Q+AK+IPL KVLA++QI  LTA AWF   K+L+EK+ R S+Q G  SEYT M  +    E
Sbjct  572  QKAKDIPLDKVLARRQINELTARAWFEDKKELQEKVMRLSIQTGFPSEYTQMVLSLKHDE  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPP--GS  392
            E K    P  + +   +P  Q    M R+           G GFG++TAT +N PP    
Sbjct  632  EEKTMARPVSIKEILRNPPYQIHKQMQRSNSVRTSLLGKQGYGFGNVTATLKNVPPWIEE  691

Query  393  TSKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              + E  E+ ++AAS     V D+ CCMCC+Q  S+++DQC +V +Q
Sbjct  692  PKETEGTELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTIVFSQ  734


 Score = 35.0 bits (79),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            GEFP+ +E RG LADM+ F++ L  +K +
Sbjct  547  GEFPDEVELRGTLADMSCFTIELTVQKAK  575



>ref|XP_008228173.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Prunus 
mume]
Length=749

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 74/167 (44%), Positives = 105/167 (63%), Gaps = 12/167 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q +KE PL +VLA++ I++LTA AW   +K+LEEK+++ S Q G+ SEY+ M  + + 
Sbjct  563  KVQRSKEFPLDRVLARRHIDMLTAHAWLLGSKELEEKVSKMSKQTGVPSEYSCMILVQSL  622

Query  249  ET-KGTTEPSKV------NKKTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTS  398
            +T  G   P  V      NK T   K +   + +I+L NLG+GFG+L AT EN  P S  
Sbjct  623  QTDNGKRVPESVTIQGVYNKFTQLNKTESNRQKVIVLGNLGVGFGNLKATVENKAPASEE  682

Query  399  -KP-EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             KP +  E+   AASNCC  V D+ CCMC I+ CS +N+QCA+++TQ
Sbjct  683  VKPADPTELLFNAASNCCSQVLDRVCCMCFIRTCSHMNNQCAILLTQ  729



>gb|KHN01425.1| Inter-alpha-trypsin inhibitor heavy chain H3 [Glycine soja]
Length=753

 Score = 93.2 bits (230),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 65/162 (40%), Positives = 93/162 (57%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K +  K++ LS VL+K+ I+ +TA+AW  K+K+LEEK+ + S+Q+ + SEYT M  +  +
Sbjct  568  KVKREKDMQLSNVLSKRHIDQVTAQAWLLKSKELEEKVTKMSIQNKVPSEYTCMNIVLVQ  627

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRN-------LGLGFGDLTATAENTPPGSTSKPE  407
              +G   P +   +    KL    + L N       L LGFGDL ATAEN PP       
Sbjct  628  SDEGKKAPEQFLLQKAYNKLSFQKLELNNQNLFLGGLNLGFGDLKATAENLPPAIKEAKP  687

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               +  +AASNCC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  688  PEGLLGKAASNCCGRLADTCCGMCLLQTCTFVNDQCTIVCTQ  729


 Score = 33.1 bits (74),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LADM NF + L+ K+++
Sbjct  545  GTFPELVKVTGTLADMTNFVVDLKVKREK  573



>ref|XP_008462288.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H1 isoform 
X3 [Cucumis melo]
Length=609

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 105/164 (64%), Gaps = 12/164 (7%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET  254
            Q AKE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  +E 
Sbjct  424  QRAKELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFPSEYTRLILVLAKEG  483

Query  255  KGTTEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTSKP  404
            K    PS ++++       T   K++   + II+L N G+GFG+LTATAEN  PG   K 
Sbjct  484  K-KAPPSIISQEMRKRFDLTKSNKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKEIKA  542

Query  405  -EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A ++ V+AA+NCC  + D+ CC+C I+ C  +ND+C V  TQ
Sbjct  543  TQATDLLVKAATNCCSRLIDRFCCLCFIKSCMYMNDRCVVAFTQ  586



>ref|XP_003528576.1| PREDICTED: uncharacterized protein LOC100807956 isoform X1 [Glycine 
max]
Length=756

 Score = 93.2 bits (230),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 65/162 (40%), Positives = 93/162 (57%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K +  K++ LS VL+K+ I+ +TA+AW  K+K+LEEK+ + S+Q+ + SEYT M  +  +
Sbjct  571  KVKREKDMQLSNVLSKRHIDQVTAQAWLLKSKELEEKVTKMSIQNKVPSEYTCMNIVLVQ  630

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRN-------LGLGFGDLTATAENTPPGSTSKPE  407
              +G   P +   +    KL    + L N       L LGFGDL ATAEN PP       
Sbjct  631  SDEGKKAPEQFLLQKAYNKLSFQKLELNNQNLFLGGLNLGFGDLKATAENLPPAIKEAKP  690

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               +  +AASNCC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  691  PEGLLGKAASNCCGRLADTCCGMCLLQTCTFVNDQCTIVCTQ  732


 Score = 33.1 bits (74),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LADM NF + L+ K+++
Sbjct  548  GTFPELVKVTGTLADMTNFVVDLKVKREK  576



>ref|XP_008667805.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=756

 Score = 95.5 bits (236),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 101/162 (62%), Gaps = 11/162 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+IPL KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T 
Sbjct  576  KVQHIKDIPLDKVLAKQQMDLLTAKAWLMENKELERKVVKLSIQNSLPSEYTRMVLLQTS  635

Query  249  ETKGTTEPS-----KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAA  413
              K   +P+     K  K++  P    A + L  L +GFGD+ AT EN   G     +AA
Sbjct  636  LDK--IDPAQQAKNKPTKQSSSPDELPA-MPLGGLAVGFGDVAATTENLTTGFGDM-KAA  691

Query  414  EMFV--QAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E FV  + A+ CC  + D CCCMC I+ CSK+NDQCA+VM Q
Sbjct  692  EKFVMLEKAAGCCSRMADCCCCMCFIKACSKMNDQCAIVMAQ  733


 Score = 29.6 bits (65),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LADM+  S+ L+
Sbjct  553  GKLPETLIAKGHLADMSEISIELK  576



>ref|NP_001141509.1| hypothetical protein [Zea mays]
 gb|ACF86519.1| unknown [Zea mays]
 tpg|DAA45736.1| TPA: hypothetical protein ZEAMMB73_410449 [Zea mays]
Length=357

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 101/162 (62%), Gaps = 11/162 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+IPL KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T 
Sbjct  177  KVQHIKDIPLDKVLAKQQMDLLTAKAWLMENKELERKVVKLSIQNSLPSEYTRMVLLQTS  236

Query  249  ETKGTTEPS-----KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAA  413
              K   +P+     K  K++  P    A+  L  L +GFGD+ AT EN   G     +AA
Sbjct  237  LDK--IDPAQQAKNKPTKQSSSPDELPAMP-LGGLAVGFGDVAATTENLTTG-FGDMKAA  292

Query  414  EMFV--QAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            E FV  + A+ CC  + D CCCMC I+ CSK+NDQCA+VM Q
Sbjct  293  EKFVMLEKAAGCCSRMADCCCCMCFIKACSKMNDQCAIVMAQ  334



>ref|XP_004984064.1| PREDICTED: uncharacterized protein LOC101774989 isoform X1 [Setaria 
italica]
Length=760

 Score = 95.1 bits (235),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 72/159 (45%), Positives = 96/159 (60%), Gaps = 6/159 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+IPL KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T 
Sbjct  581  KVQHVKDIPLDKVLAKQQMDLLTAKAWLLENKELERKVVKLSIQNSLPSEYTRMVLLQTN  640

Query  249  ETKGTTEPSKVNK--KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAE  416
              K        NK  K   P  +++ + LR L LGFGD+ AT EN     G     E  E
Sbjct  641  LDKIDPAQQAKNKPTKQSSPD-ERSAMPLRGLTLGFGDVVATRENLTAGFGDIEVHERFE  699

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +F +A   CC  + D  CCMC I+ CSK+NDQCA+VM Q
Sbjct  700  IFDKAVG-CCSRMADCFCCMCFIKACSKMNDQCAIVMAQ  737


 Score = 29.6 bits (65),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LADM+  S+ L+
Sbjct  558  GKLPETLIAKGHLADMSEISIELK  581



>gb|ABF96528.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=477

 Score = 91.7 bits (226),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            + Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +   
Sbjct  302  RVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQNF  361

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMF  422
              K   E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EMF
Sbjct  362  VEK--IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMF  419

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A   CC  + D CCCMC I  CSK+ND+CA+VM Q
Sbjct  420  DKAVG-CCSRLTDCCCCMCFINTCSKMNDRCAIVMVQ  455


 Score = 33.1 bits (74),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LADM+  S+ LR
Sbjct  279  GKLPETLTAKGYLADMSEISIELR  302



>ref|XP_010273854.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Nelumbo nucifera]
Length=696

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 72/153 (47%), Positives = 103/153 (67%), Gaps = 10/153 (7%)
 Frame = +3

Query  102  KVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTE---P  272
            +V AK QI++LT +AWF+++K +EEK+A+ S++ G  SEYT M  + TE  K  TE    
Sbjct  527  EVSAKNQIDLLTTQAWFSESKPIEEKVAKMSLRIGFPSEYTRMVLLQTEIGKKVTESFGS  586

Query  273  SKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTP--PGSTSKPEAAEMFVQAA  434
             ++  K    KL K+    I +L +LG+GFG+L ATA+NTP  PG  S  E  E+FV+AA
Sbjct  587  EEILNKIDLAKLVKSKGYDITLLPSLGMGFGNLAATADNTPLEPGEISI-EPVEIFVKAA  645

Query  435  SNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            SNCC  + + CCC+CCI+ CSK+N++CA V+ Q
Sbjct  646  SNCCGKLANDCCCLCCIRACSKVNNECATVLLQ  678



>ref|NP_001050335.2| Os03g0407000 [Oryza sativa Japonica Group]
 dbj|BAF12249.2| Os03g0407000, partial [Oryza sativa Japonica Group]
Length=360

 Score = 91.7 bits (226),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            + Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +   
Sbjct  185  RVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQNF  244

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMF  422
              K   E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EMF
Sbjct  245  VEK--IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMF  302

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A   CC  + D CCCMC I  CSK+ND+CA+VM Q
Sbjct  303  DKAVG-CCSRLTDCCCCMCFINTCSKMNDRCAIVMVQ  338


 Score = 33.1 bits (74),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LADM+  S+ LR
Sbjct  162  GKLPETLTAKGYLADMSEISIELR  185



>ref|XP_008462286.1| PREDICTED: uncharacterized protein LOC103500681 isoform X2 [Cucumis 
melo]
Length=755

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 69/166 (42%), Positives = 106/166 (64%), Gaps = 12/166 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            + Q AKE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  +
Sbjct  568  QPQRAKELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFPSEYTRLILVLAK  627

Query  249  ETKGTTEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTS  398
            E K    PS ++++       T   K++   + II+L N G+GFG+LTATAEN  PG   
Sbjct  628  EGK-KAPPSIISQEMRKRFDLTKSNKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKEI  686

Query  399  KP-EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            K  +A ++ V+AA+NCC  + D+ CC+C I+ C  +ND+C V  TQ
Sbjct  687  KATQATDLLVKAATNCCSRLIDRFCCLCFIKSCMYMNDRCVVAFTQ  732



>ref|XP_008462285.1| PREDICTED: uncharacterized protein LOC103500681 isoform X1 [Cucumis 
melo]
Length=758

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 69/166 (42%), Positives = 106/166 (64%), Gaps = 12/166 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            + Q AKE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  +
Sbjct  571  QPQRAKELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFPSEYTRLILVLAK  630

Query  249  ETKGTTEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTS  398
            E K    PS ++++       T   K++   + II+L N G+GFG+LTATAEN  PG   
Sbjct  631  EGK-KAPPSIISQEMRKRFDLTKSNKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKEI  689

Query  399  KP-EAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            K  +A ++ V+AA+NCC  + D+ CC+C I+ C  +ND+C V  TQ
Sbjct  690  KATQATDLLVKAATNCCSRLIDRFCCLCFIKSCMYMNDRCVVAFTQ  735



>ref|XP_004958289.1| PREDICTED: uncharacterized protein LOC101756562 [Setaria italica]
Length=751

 Score = 94.4 bits (233),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 69/156 (44%), Positives = 90/156 (58%), Gaps = 1/156 (1%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  KEIPL KVLA QQI +LT++AW + +K+LE K+ + S+Q+ I SEYT M  + T 
Sbjct  572  KVQHLKEIPLDKVLATQQISLLTSKAWLSADKQLERKVIKLSIQNSIPSEYTEMVLLQTN  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFV  425
              K         K  G     +  I L  L LGFGD  AT EN   G    +P    + +
Sbjct  632  LDKVDATQKVKQKLKGQKGPDEIRIPLDGLKLGFGDKGATRENLITGYGDVRPPEKSVIM  691

Query  426  QAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            Q AS CC  + D  CCMCCI+ C+++NDQCA+VM Q
Sbjct  692  QKASGCCSRLADCICCMCCIKACNRMNDQCAIVMAQ  727


 Score = 30.0 bits (66),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FP+++ A+G LADM   S+ L+
Sbjct  549  GKFPDTVIAKGYLADMKEISIELK  572



>dbj|BAC80088.1| unknown protein [Oryza sativa Japonica Group]
Length=342

 Score = 94.0 bits (232),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 92/156 (59%), Gaps = 1/156 (1%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+IPL KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T 
Sbjct  164  KVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQTL  223

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFV  425
            E     +  K   K      +   I L+ L LGFGD  AT EN   G    KP      +
Sbjct  224  EKVDAAQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTGFGDVKPLETFEIL  283

Query  426  QAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              A+ CC  + D  CCMCCI+ C+K+NDQCA+VMTQ
Sbjct  284  NKAAGCCSRLADCLCCMCCIKACNKMNDQCAIVMTQ  319


 Score = 30.0 bits (66),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FP+ + A+G LADM   S+ L+
Sbjct  141  GKFPDMVTAKGYLADMREISIELK  164



>ref|NP_001060262.2| Os07g0614300 [Oryza sativa Japonica Group]
 dbj|BAF22176.2| Os07g0614300, partial [Oryza sativa Japonica Group]
Length=352

 Score = 93.6 bits (231),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 92/156 (59%), Gaps = 1/156 (1%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+IPL KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T 
Sbjct  174  KVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQTL  233

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFV  425
            E     +  K   K      +   I L+ L LGFGD  AT EN   G    KP      +
Sbjct  234  EKVDAAQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTGFGDVKPLETFEIL  293

Query  426  QAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              A+ CC  + D  CCMCCI+ C+K+NDQCA+VMTQ
Sbjct  294  NKAAGCCSRLADCLCCMCCIKACNKMNDQCAIVMTQ  329


 Score = 29.6 bits (65),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FP+ + A+G LADM   S+ L+
Sbjct  151  GKFPDMVTAKGYLADMREISIELK  174



>gb|KHN39616.1| Inter-alpha-trypsin inhibitor heavy chain H5 [Glycine soja]
Length=742

 Score = 95.1 bits (235),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 67/162 (41%), Positives = 95/162 (59%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIG  242
            K +  K++ LS VL+K+ I+ +TA+AW  K+++LEEK+ + S+Q+ + SEYT  NM  + 
Sbjct  557  KVKREKDMQLSNVLSKRHIDQVTAQAWLLKSEELEEKVTKMSIQNKVPSEYTCMNMVLVQ  616

Query  243  TEETKGTTEPSKVNKKTGDPKLQK-----AIIMLRNLGLGFGDLTATAENTPPGSTSKPE  407
            ++E K T E   + K       QK       + L  L LGFGDL ATAEN PP       
Sbjct  617  SDEGKKTPEQFLLQKAYNKLSFQKLELNNQNLFLGGLSLGFGDLKATAENLPPAIKEAKP  676

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               +  +AASNCC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  677  PEGLLGRAASNCCGRLADTCCGMCLLQTCTFVNDQCTIVCTQ  718


 Score = 27.7 bits (60),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LA+  NF + L+ K+++
Sbjct  534  GTFPELVKVTGTLANKTNFVVGLKVKREK  562



>ref|XP_006598837.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H1-like 
[Glycine max]
Length=665

 Score = 94.7 bits (234),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 67/162 (41%), Positives = 95/162 (59%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIG  242
            K +  K++ LS VL+K+ I+ +TA+AW  K+++LEEK+ + S+Q+ + SEYT  NM  + 
Sbjct  480  KVKREKDMQLSNVLSKRHIDQVTAQAWLLKSEELEEKVTKMSIQNKVPSEYTCMNMVLVQ  539

Query  243  TEETKGTTEPSKVNKKTGDPKLQK-----AIIMLRNLGLGFGDLTATAENTPPGSTSKPE  407
            ++E K T E   + K       QK       + L  L LGFGDL ATAEN PP       
Sbjct  540  SDEGKKTPEQFLLQKAYNKLSFQKLELNNQNLFLGGLSLGFGDLKATAENLPPAIKEAKP  599

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               +  +AASNCC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  600  PEGLLGRAASNCCGRLADTCCGMCLLQTCTFVNDQCTIVCTQ  641


 Score = 27.7 bits (60),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LA+  NF + L+ K+++
Sbjct  457  GTFPELVKVTGTLANKTNFVVGLKVKREK  485



>gb|ABF96527.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|EEC75447.1| hypothetical protein OsI_11983 [Oryza sativa Indica Group]
Length=751

 Score = 89.0 bits (219),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 70/157 (45%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            + Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +   
Sbjct  576  RVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQNF  635

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMF  422
              K   E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EMF
Sbjct  636  VEK--IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMF  693

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A   CC  + D CCCMC I  CSK+ND+CA+VM Q
Sbjct  694  DKAVG-CCSRLTDCCCCMCFINTCSKMNDRCAIVMVQ  729


 Score = 32.7 bits (73),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LADM+  S+ LR
Sbjct  553  GKLPETLTAKGYLADMSEISIELR  576



>gb|EEE67586.1| hypothetical protein OsJ_25118 [Oryza sativa Japonica Group]
Length=755

 Score = 92.4 bits (228),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 70/156 (45%), Positives = 92/156 (59%), Gaps = 1/156 (1%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+IPL KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T 
Sbjct  577  KVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQTL  636

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFV  425
            E     +  K   K      +   I L+ L LGFGD  AT EN   G    KP      +
Sbjct  637  EKVDAAQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTGFGDVKPLETFEIL  696

Query  426  QAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              A+ CC  + D  CCMCCI+ C+K+NDQCA+VMTQ
Sbjct  697  NKAAGCCSRLADCLCCMCCIKACNKMNDQCAIVMTQ  732


 Score = 29.6 bits (65),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FP+ + A+G LADM   S+ L+
Sbjct  554  GKFPDMVTAKGYLADMREISIELK  577



>gb|EEC82439.1| hypothetical protein OsI_26857 [Oryza sativa Indica Group]
Length=863

 Score = 92.0 bits (227),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 70/156 (45%), Positives = 92/156 (59%), Gaps = 1/156 (1%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+IPL KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T 
Sbjct  685  KVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQTL  744

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFV  425
            E     +  K   K      +   I L+ L LGFGD  AT EN   G    KP      +
Sbjct  745  EKVDAAQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTGFGDVKPLETFEIL  804

Query  426  QAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              A+ CC  + D  CCMCCI+ C+K+NDQCA+VMTQ
Sbjct  805  NKAAGCCSRLADCLCCMCCIKACNKMNDQCAIVMTQ  840


 Score = 29.6 bits (65),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FP+ + A+G LADM   S+ L+
Sbjct  662  GKFPDMVTAKGYLADMREISIELK  685



>gb|EEE59232.1| hypothetical protein OsJ_11214 [Oryza sativa Japonica Group]
Length=718

 Score = 88.6 bits (218),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 70/157 (45%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            + Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +   
Sbjct  543  RVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQNF  602

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMF  422
              K   E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EMF
Sbjct  603  VEK--IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMF  660

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +A   CC  + D CCCMC I  CSK+ND+CA+VM Q
Sbjct  661  DKAVG-CCSRLTDCCCCMCFINTCSKMNDRCAIVMVQ  696


 Score = 32.7 bits (73),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LADM+  S+ LR
Sbjct  520  GKLPETLTAKGYLADMSEISIELR  543



>ref|XP_007135423.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
 gb|ESW07417.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
Length=752

 Score = 86.7 bits (213),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 62/162 (38%), Positives = 93/162 (57%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIG  242
            K +  K+I LS VLAK+ I+++TA+AW  K++++EEK+ + S+Q+ ++SEYT  NM  + 
Sbjct  568  KVKREKDIQLSNVLAKRHIDMVTAQAWLLKSEEVEEKVTKMSIQNKVLSEYTCMNMVLVQ  627

Query  243  TEETKGTTEPSKVNKKTGDPKLQK-----AIIMLRNLGLGFGDLTATAENTPPGSTSKPE  407
            ++E K   E   + K       Q+       + L  L +GFGD  ATAEN  P       
Sbjct  628  SDEGKKPPEQFLLKKAYNKLSFQQLEFDMKKLFLGGLSVGFGDSKATAENLAPSIKEAKP  687

Query  408  AAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               +  +AAS CC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  688  PEGLLGKAASTCCGRLADSCCGMCLLQACTLVNDQCTIVCTQ  729


 Score = 34.3 bits (77),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LADM NF++ L+ K+++
Sbjct  545  GTFPELVKVTGTLADMTNFAVDLKVKREK  573



>ref|XP_006650182.1| PREDICTED: uncharacterized protein LOC102717967 [Oryza brachyantha]
Length=750

 Score = 92.4 bits (228),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 71/159 (45%), Positives = 96/159 (60%), Gaps = 6/159 (4%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT-  245
            + Q  K+IPL KVLAKQQ+++LTA+AW  +N +L+ K+A+ S+Q+ I SEYT+   + T 
Sbjct  572  RVQHIKDIPLDKVLAKQQMDLLTAKAWLYENDQLKRKVAKLSIQNSIPSEYTHTVLLQTI  631

Query  246  -EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAE  416
             E+     +  +  KK   P  Q A   L  L LGFGD+ AT EN     G T  PE  E
Sbjct  632  LEKIDQAQQGKQKPKKNTSPNEQLA-TSLNGLSLGFGDVAATRENLSAGFGDTKPPERFE  690

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            MF + A  CC  + D CCCMC I  CSK+ND+CA+ + Q
Sbjct  691  MF-EKAVGCCSRLADCCCCMCFINACSKMNDRCAIALAQ  728


 Score = 27.7 bits (60),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE L A+G LAD +  S+ LR
Sbjct  549  GKLPEVLIAKGYLADRSEISIELR  572



>ref|XP_006658810.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like, 
partial [Oryza brachyantha]
Length=703

 Score = 88.6 bits (218),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 66/157 (42%), Positives = 89/157 (57%), Gaps = 5/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+IPL KVLA QQI +LTA+AW + +K LE ++ + S+Q+ I SEYT+M  + T 
Sbjct  526  KVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKHLEREVVKLSIQNSIPSEYTSMVLLQTL  585

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEAAEMF  422
            E        K+    G  + Q+  I L  L LGFG+  AT +N  T       PE  E+ 
Sbjct  586  EKVVEQVKQKLKGHKGADEPQR--IPLHGLKLGFGNKAATRDNLITAFDDVKPPETFEIL  643

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             +AA           CCMCCI+ C+K+NDQCA+VM Q
Sbjct  644  NKAAG-RLPRPPPCLCCMCCIKACNKMNDQCAIVMAQ  679


 Score = 30.8 bits (68),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FPE + A+G LADM   S+ L+
Sbjct  503  GKFPEMVTAKGYLADMREISIELK  526



>ref|XP_006301970.1| hypothetical protein CARUB_v10022450mg [Capsella rubella]
 gb|EOA34868.1| hypothetical protein CARUB_v10022450mg [Capsella rubella]
Length=757

 Score = 85.5 bits (210),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 73/167 (44%), Positives = 97/167 (58%), Gaps = 18/167 (11%)
 Frame = +3

Query  75   QEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTE  248
            Q+AK+IPL KVLA++QI  LTA AWF + K+LEEK+ R S+Q G  SEYT M  +    E
Sbjct  572  QKAKDIPLDKVLARRQINELTARAWFEEKKELEEKVMRLSIQTGFPSEYTQMVLSLKQDE  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPGSTS  398
            E K  T P  + +   +P  Q    M RN           G GFG++ AT +N PP    
Sbjct  632  EEKTITRPVSIKEILRNPPYQIHKQMQRNNSMRTSLLGKQGYGFGNVVATLKNVPPWMEE  691

Query  399  KPEA--AEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
              EA  AE+ ++AAS     V D+ CCMCC+Q  S+++DQC VV +Q
Sbjct  692  PKEAEGAELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTVVFSQ  734


 Score = 33.9 bits (76),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            GEFP+ +E RG LAD++ F++ L  +K +
Sbjct  547  GEFPDEIELRGTLADLSCFTIELAVQKAK  575



>ref|XP_008653341.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Zea mays]
Length=521

 Score = 87.4 bits (215),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 96/159 (60%), Gaps = 9/159 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT-  245
            K Q+ KEIPL KVL  QQI+ +T++AW + +K++E K+ + S Q+G+ SEYT+M F+ T 
Sbjct  344  KVQQLKEIPLDKVLVIQQIDFMTSKAWMSADKQVERKVIKLSTQNGVPSEYTDMIFLQTN  403

Query  246  -EETKGTTE-PSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAE  416
             ++ +GT +   K+    G  + Q     +  L LGFG+  AT EN   G     P    
Sbjct  404  LDKVEGTQKVKQKLKGHKGRDEQQ-----IYGLKLGFGNKDATRENLITGFGDMNPAEKS  458

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            + +Q  S CC  V D  CCMCCI+ C+++NDQCAV+M Q
Sbjct  459  VMLQKGSGCCSRVADCLCCMCCIKACNRMNDQCAVLMAQ  497


 Score = 32.0 bits (71),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQRK  90
            G+FP++++A+G LADM   S+ L+ ++ ++
Sbjct  321  GKFPDTIKAKGYLADMKEISVELKVQQLKE  350



>ref|XP_008782726.1| PREDICTED: LOW QUALITY PROTEIN: inter alpha-trypsin inhibitor, 
heavy chain 4-like [Phoenix dactylifera]
Length=746

 Score = 88.2 bits (217),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 50/127 (39%), Positives = 76/127 (60%), Gaps = 8/127 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            + +  K+IPL KV AKQ I++LTAEAWF+++K+LEEKI + S++  + SEYT M  + T+
Sbjct  570  EVKNTKDIPLEKVFAKQHIDLLTAEAWFSESKQLEEKIIKLSMRSSVPSEYTYMILLQTD  629

Query  249  ETKGTTEPSKVNKKTGDPK----LQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEA  410
              K   +  K  KK G  K      +  I++  L +GFG++ AT+EN P   G    PE 
Sbjct  630  TEK--QDAVKQAKKHGSQKHAGPKNRLSILVHGLTIGFGNIVATSENLPTGFGEPKLPET  687

Query  411  AEMFVQA  431
             ++  +A
Sbjct  688  NDVLEKA  694


 Score = 31.2 bits (69),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+ P+SL+A+GILADM+   + L  K  +
Sbjct  547  GKIPDSLKAKGILADMSEVVIDLEVKNTK  575



>gb|KEH18484.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=596

 Score = 88.6 bits (218),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 94/167 (56%), Gaps = 17/167 (10%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIG  242
            K +  K++ L+ V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT   M  + 
Sbjct  410  KVKREKDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILVN  469

Query  243  TEETKGTTEPSKVNKKTGD----------PKLQKAIIMLRNLGLGFGDLTATAENTPPGS  392
              + K   EP  + K  G           PKL      L  L  GFGDL ATAENTPP +
Sbjct  470  KNDVKKEPEPFLLQKAYGTLSFKGLEVEIPKL-----FLGGLSHGFGDLKATAENTPPAT  524

Query  393  TSKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
                 +  +  +AAS CC  V D CC MC ++ CS +NDQC +V TQ
Sbjct  525  KEAKPSEGLLGKAASTCCGRVADTCCGMCLLKTCSFVNDQCTIVCTQ  571


 Score = 30.4 bits (67),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LAD  +F++ L+ K+++
Sbjct  387  GTFPELVKVTGTLADRTSFAVDLKVKREK  415



>ref|XP_002461009.1| hypothetical protein SORBIDRAFT_02g039160 [Sorghum bicolor]
 gb|EER97530.1| hypothetical protein SORBIDRAFT_02g039160 [Sorghum bicolor]
Length=751

 Score = 86.7 bits (213),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 62/156 (40%), Positives = 90/156 (58%), Gaps = 1/156 (1%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+ KEIPL KVL  +QI+++TA+AW + +K+LE K+ + S+Q+G+ SEYT M  + T 
Sbjct  572  KVQQLKEIPLDKVLVTKQIDLMTAKAWLSADKQLERKVIKLSIQNGVPSEYTEMTLLQTN  631

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEMFV  425
              K         K  G     +  I++  L LGFG+  AT EN   G   + P    + +
Sbjct  632  LDKVDGTQKVKQKLKGQKGRDEQRILMHGLKLGFGNKDATRENLITGFGDRNPAEKLVML  691

Query  426  QAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
                 CC  V D  CCMCCI+ C+++NDQCA++M Q
Sbjct  692  HKGKGCCSSVADCLCCMCCIKACNRMNDQCAILMAQ  727


 Score = 32.0 bits (71),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 11/30 (37%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQRK  90
            G+FP++++A+G LADM   S+ L+ ++ ++
Sbjct  549  GKFPDTVKAKGYLADMKEISIELKVQQLKE  578



>gb|AET01809.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=753

 Score = 88.6 bits (218),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 64/167 (38%), Positives = 94/167 (56%), Gaps = 17/167 (10%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIG  242
            K +  K++ L+ V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT   M  + 
Sbjct  567  KVKREKDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILVN  626

Query  243  TEETKGTTEPSKVNKKTGD----------PKLQKAIIMLRNLGLGFGDLTATAENTPPGS  392
              + K   EP  + K  G           PKL      L  L  GFGDL ATAENTPP +
Sbjct  627  KNDVKKEPEPFLLQKAYGTLSFKGLEVEIPKL-----FLGGLSHGFGDLKATAENTPPAT  681

Query  393  TSKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
                 +  +  +AAS CC  V D CC MC ++ CS +NDQC +V TQ
Sbjct  682  KEAKPSEGLLGKAASTCCGRVADTCCGMCLLKTCSFVNDQCTIVCTQ  728


 Score = 29.3 bits (64),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LAD  +F++ L+ K+++
Sbjct  544  GTFPELVKVTGTLADRTSFAVDLKVKREK  572



>tpg|DAA63586.1| TPA: hypothetical protein ZEAMMB73_270893 [Zea mays]
Length=750

 Score = 85.9 bits (211),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 66/159 (42%), Positives = 96/159 (60%), Gaps = 9/159 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT-  245
            K Q+ KEIPL KVL  QQI+ +T++AW + +K++E K+ + S Q+G+ SEYT+M F+ T 
Sbjct  573  KVQQLKEIPLDKVLVIQQIDFMTSKAWMSADKQVERKVIKLSTQNGVPSEYTDMIFLQTN  632

Query  246  -EETKGTTE-PSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAE  416
             ++ +GT +   K+    G  + Q     +  L LGFG+  AT EN   G     P    
Sbjct  633  LDKVEGTQKVKQKLKGHKGRDEQQ-----IYGLKLGFGNKDATRENLITGFGDMNPAEKS  687

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            + +Q  S CC  V D  CCMCCI+ C+++NDQCAV+M Q
Sbjct  688  VMLQKGSGCCSRVADCLCCMCCIKACNRMNDQCAVLMAQ  726


 Score = 32.0 bits (71),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 11/30 (37%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQRK  90
            G+FP++++A+G LADM   S+ L+ ++ ++
Sbjct  550  GKFPDTIKAKGYLADMKEISVELKVQQLKE  579



>ref|XP_002465153.1| hypothetical protein SORBIDRAFT_01g032840 [Sorghum bicolor]
 gb|EER92151.1| hypothetical protein SORBIDRAFT_01g032840 [Sorghum bicolor]
Length=756

 Score = 90.5 bits (223),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 72/156 (46%), Positives = 93/156 (60%), Gaps = 4/156 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+IPL KVLAKQQ+++LTA++W  +NK+LE K+ + S+Q+ + SEYT M  + T 
Sbjct  577  KVQHIKDIPLDKVLAKQQMDLLTAKSWLMENKELERKVVKLSIQNSLPSEYTRMVLLQTS  636

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIM-LRNLGLGFGDLTATAEN--TPPGSTSKPEAAEM  419
              K        NK T      +   M L  L LGFGD+ AT EN  T  G    PE   +
Sbjct  637  LDKIDPAQQAKNKPTKQSSPDELPAMPLGGLALGFGDVAATRENLTTGFGDMKAPEKFVI  696

Query  420  FVQAASNcckmvcdkcccmcciqmcskINDQCAVVM  527
            F + A  CC  V D CCCMC I+ CSK+NDQCA+VM
Sbjct  697  F-EKAVGCCSRVADCCCCMCFIKACSKMNDQCAIVM  731


 Score = 27.3 bits (59),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LAD +  S+ L+
Sbjct  554  GKLPETLIAKGHLADTSEISIELK  577



>ref|XP_010235662.1| PREDICTED: uncharacterized protein LOC100843408 [Brachypodium 
distachyon]
Length=746

 Score = 85.5 bits (210),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 66/157 (42%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K+ PL +VLA QQI +LTA+AWF+ +K+LE K+   S+Q+ ++SEYT M  + T 
Sbjct  569  KVQHIKDTPLDEVLAAQQIALLTAKAWFSADKQLERKVMDLSIQNSVLSEYTRMVVLQT-  627

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEAAEMF  422
               G  +  K   K      +   I L  L LGFGD  AT +N  T  G    PE  ++F
Sbjct  628  -NLGAAQKGKQKTKGHKGSNEPLRIPLHGLKLGFGDKAATRDNLLTGFGEEKPPETLKIF  686

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             + A  CC  + D  CCMCCI+ C+++NDQCA++M Q
Sbjct  687  -KKAGGCCGRLADCLCCMCCIKACNRMNDQCAIMMAQ  722


 Score = 31.6 bits (70),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FPE++ A+G LADM   S+ L+
Sbjct  546  GKFPETVVAKGYLADMTEISIELK  569



>ref|XP_003627335.1| hypothetical protein MTR_8g021260 [Medicago truncatula]
Length=260

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 94/167 (56%), Gaps = 17/167 (10%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIG  242
            K +  K++ L+ V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT   M  + 
Sbjct  74   KVKREKDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILVN  133

Query  243  TEETKGTTEPSKVNKKTGD----------PKLQKAIIMLRNLGLGFGDLTATAENTPPGS  392
              + K   EP  + K  G           PKL      L  L  GFGDL ATAENTPP +
Sbjct  134  KNDVKKEPEPFLLQKAYGTLSFKGLEVEIPKL-----FLGGLSHGFGDLKATAENTPPAT  188

Query  393  TSKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
                 +  +  +AAS CC  V D CC MC ++ CS +NDQC +V TQ
Sbjct  189  KEAKPSEGLLGKAASTCCGRVADTCCGMCLLKTCSFVNDQCTIVCTQ  235



>ref|XP_009404352.1| PREDICTED: uncharacterized protein LOC103987694 [Musa acuminata 
subsp. malaccensis]
Length=750

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 62/159 (39%), Positives = 94/159 (59%), Gaps = 5/159 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIG--  242
            K Q  K+ PL K    Q I++LTA+AWF+++K+L+EK+ + S+Q  I SEYT M F+   
Sbjct  571  KVQNTKDFPLEKAFVNQHIDLLTAQAWFSESKQLKEKVTKLSIQSSIPSEYTCMVFLQKE  630

Query  243  TEETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAE  416
            TE+ +   +  K + +         +I++R++ +GFGD+TAT EN P   G   +P A  
Sbjct  631  TEKDESLKKVKKRDSRKHAGSKDNLLILVRDMAIGFGDITATIENHPTVLGEPKEP-ATS  689

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            +    A  CC  +   CCC C I+ CS++NDQ  +VMTQ
Sbjct  690  LVYNKAIGCCNRIAYCCCCPCFIKTCSRLNDQLVIVMTQ  728



>ref|XP_010937323.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Elaeis 
guineensis]
Length=747

 Score = 79.7 bits (195),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 6/111 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            + +  K+IPL KV AKQ I++LTAEAWF+++K+L+EK  + S++  + SEYT M  + T+
Sbjct  570  EVKNTKDIPLEKVFAKQHIDLLTAEAWFSESKQLKEKAIKISMRSSVPSEYTYMILLQTD  629

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLR----NLGLGFGDLTATAENTPPG  389
              K   +  K  KK G  K       LR     L +GFG++ AT EN P G
Sbjct  630  TEK--QDAVKQVKKHGSQKDAGPKNCLRIRVHGLAIGFGNVNATLENLPTG  678


 Score = 33.9 bits (76),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+FP+SL+A+GILADM+   + L  K  +
Sbjct  547  GKFPDSLKAKGILADMSEIVIDLEVKNTK  575



>dbj|BAK07105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score = 82.0 bits (201),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 92/159 (58%), Gaps = 9/159 (6%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT-  245
            K Q  K++PL  V A QQI +LTA+AW + +K+LE K+ + S+++ ++SEYT+M  + T 
Sbjct  233  KVQHIKDMPLDNVFAPQQIALLTAKAWLSADKQLERKVIKLSIENSVLSEYTSMVVLQTN  292

Query  246  -EETKGTTEPSKVNKKTGDP-KLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAE  416
             +  +   +  K +K   +P + Q     L  L LGFGD  AT EN   G    KP    
Sbjct  293  LDAAQKVKQKPKGHKGANEPLRFQ-----LHGLKLGFGDKAATKENLLTGFGEEKPLETL  347

Query  417  MFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
               + A  CC  V D  CCMCCI+ C+++NDQCA++M Q
Sbjct  348  KIFKKAGGCCSRVADCLCCMCCIKACNRMNDQCAIMMAQ  386


 Score = 31.6 bits (70),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FPE++ A G LADM   S+ L+
Sbjct  210  GKFPETVVATGYLADMTEISIELK  233



>ref|XP_009389548.1| PREDICTED: uncharacterized protein LOC103976087 [Musa acuminata 
subsp. malaccensis]
Length=747

 Score = 79.7 bits (195),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 69/112 (62%), Gaps = 8/112 (7%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+ K++ L K LAKQ I++LT++AWF+++K+LEEK+ + S+Q  I SEYT M  + TE
Sbjct  571  KVQDTKDLSLEKALAKQHIDLLTSQAWFSESKQLEEKVIKLSIQSSIPSEYTCMVLLQTE  630

Query  249  ----ETKGTTEPSKVNKKTG-DPKLQKAIIMLRNLGLGFGDLTATAENTPPG  389
                E     +  +  K +G D  L    I +R++  GFG++ AT EN P G
Sbjct  631  TEKQEAVKKVKKRESRKHSGPDDNLS---ISVRSMVNGFGNVIATKENRPTG  679


 Score = 32.7 bits (73),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FPE+L+A+GILADM+   + L+
Sbjct  548  GKFPETLKAKGILADMSYADIDLK  571



>gb|KJB83726.1| hypothetical protein B456_013G261400 [Gossypium raimondii]
Length=644

 Score = 79.0 bits (193),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 91/164 (55%), Gaps = 21/164 (13%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K + AK+IPL  VLA++QI+          N  L   +A+ S+Q   +SEYT M  +   
Sbjct  492  KIRRAKDIPLDSVLARRQIDA-------ANNSGL---VAKLSIQTCNISEYTRMTLLEKN  541

Query  249  ETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGSTSK--  401
            +     +     KK GDP  QK +       I+L+ L +GFGDL ATAEN  PGS     
Sbjct  542  KMLKALKHFGAWKKKGDP--QKIVESEPPEMILLQRLSVGFGDLIATAENIRPGSQEPEL  599

Query  402  PEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            PE A++F++  SN    + ++ CCM CI+ CSK+N+QCA  +TQ
Sbjct  600  PEVAKIFIKTTSNYFGGIRNRWCCMGCIRCCSKMNNQCATTLTQ  643


 Score = 32.3 bits (72),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP++L+ +GIL D+++F++ L+ ++ +
Sbjct  469  GSFPDNLKVKGILGDLSSFTMDLKIRRAK  497



>ref|XP_006583165.1| PREDICTED: uncharacterized protein LOC100807956 isoform X2 [Glycine 
max]
Length=699

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 61/151 (40%), Positives = 87/151 (58%), Gaps = 7/151 (5%)
 Frame = +3

Query  102  KVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTEPSKV  281
            +VL+K+ I+ +TA+AW  K+K+LEEK+ + S+Q+ + SEYT M  +  +  +G   P + 
Sbjct  525  EVLSKRHIDQVTAQAWLLKSKELEEKVTKMSIQNKVPSEYTCMNIVLVQSDEGKKAPEQF  584

Query  282  NKKTGDPKLQKAIIMLRN-------LGLGFGDLTATAENTPPGSTSKPEAAEMFVQAASN  440
              +    KL    + L N       L LGFGDL ATAEN PP          +  +AASN
Sbjct  585  LLQKAYNKLSFQKLELNNQNLFLGGLNLGFGDLKATAENLPPAIKEAKPPEGLLGKAASN  644

Query  441  cckmvcdkcccmcciqmcskINDQCAVVMTQ  533
            CC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  645  CCGRLADTCCGMCLLQTCTFVNDQCTIVCTQ  675



>gb|EMT10977.1| hypothetical protein F775_14225 [Aegilops tauschii]
Length=584

 Score = 77.4 bits (189),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 90/157 (57%), Gaps = 5/157 (3%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q   ++PL  + A QQI +LTA+AW + +K+LE K+ + S+++ ++SEYT+M  + T 
Sbjct  407  KVQHITDMPLDNIFAAQQIALLTAKAWLSADKQLERKVIKLSIENSVLSEYTSMVVLQTN  466

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEAAEMF  422
                     K   +TG  +  +    L  L LGFGD  AT EN  T  G     E  ++F
Sbjct  467  LDAAQKVKQKPKGRTGANEPLR--FQLHGLKLGFGDKAATRENLLTAFGDEKPLEMLKIF  524

Query  423  VQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             + A  CC  V D  CCMCCI+ C+++NDQCA+++ Q
Sbjct  525  -KKAGGCCSRVADCLCCMCCIKACNRMNDQCAILLAQ  560


 Score = 31.2 bits (69),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FPE++ A G LADM   S+ L+
Sbjct  384  GKFPETVVATGYLADMTEISIELK  407



>ref|XP_010537629.1| PREDICTED: uncharacterized protein LOC104812256 [Tarenaya hassleriana]
Length=763

 Score = 72.4 bits (176),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 41/115 (36%), Positives = 66/115 (57%), Gaps = 13/115 (11%)
 Frame = +3

Query  75   QEAKEI--PLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            Q+AK++  PL KVLA++QI+ LTA AWF   K+++EK+ + S++ G   EYT M     E
Sbjct  579  QKAKDMIMPLDKVLARRQIDELTARAWFEDRKEIQEKVKKLSIETGFPCEYTPMVLFKQE  638

Query  249  ETKGTTEPSKVNKKTGDP----------KLQKAIIMLRNLGLGFGDLTATAENTP  383
            + K  ++P  + +   +P          K +K+++M      GFG+  ATA+N P
Sbjct  639  DEKIISKPLSIKEILRNPPYEIQKHMQKKSEKSMVM-GTQSRGFGNADATAKNVP  692


 Score = 34.7 bits (78),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G+FP+S+E RG LAD N F + L  +K +
Sbjct  554  GQFPDSVEVRGTLADTNCFVMELTVQKAK  582



>ref|XP_004510514.1| PREDICTED: uncharacterized protein LOC101499440 [Cicer arietinum]
Length=757

 Score = 73.9 bits (180),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 61/173 (35%), Positives = 98/173 (57%), Gaps = 25/173 (14%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  K++ L+ V +K+ ++++TA+AW  ++++LEEK+++ S+Q+ + SEYT M  +  +
Sbjct  567  KVQREKDMQLTNVFSKRHVDLVTAQAWLLESEELEEKVSKMSIQNNVPSEYTCMEMVLVK  626

Query  249  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGL-----------------GFGDLTATAEN  377
            +  G        K +G+  L+KA   +  L L                 GFGDL AT+EN
Sbjct  627  KDDG-------KKASGEFMLKKAYSQVSKLSLQGLEIERPKLFLGGLRHGFGDLKATSEN  679

Query  378  TPPGST-SKPEAAEMFVQAASNcckmvcdkcccmcciqmcskINDQCAVVMTQ  533
             PP +  +KP    +  +AAS CC MV + CC MC ++ CS +ND C +V TQ
Sbjct  680  IPPATKEAKPSDPGLLEKAASTCCGMVANTCCGMCLLKTCSLVNDSCTIVCTQ  732


 Score = 30.0 bits (66),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LADM +F + L+ ++++
Sbjct  544  GTFPEVVKVTGTLADMTSFVVDLKVQREK  572



>ref|XP_003609990.1| von Willebrand factor A domain-containing protein [Medicago truncatula]
Length=844

 Score = 65.5 bits (158),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+ K IP+ +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  +
Sbjct  593  KIQKDKGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILEND  652

Query  249  ETKGTTE  269
              K   E
Sbjct  653  HLKKIKE  659


 Score = 37.4 bits (85),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE+L+ +GILAD +NF + L+ +K +
Sbjct  570  GNFPETLKVKGILADFSNFEIDLKIQKDK  598


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  318  IIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMFVQAASNcckmvcdkcccmcciqmcs  497
            +I+L NLG+GFG+L ATAENTPPG  +K E AE+F +AASNC   VC  CCCMCCIQ  S
Sbjct  750  MILLPNLGVGFGNLKATAENTPPGYEAKIEMAEIF-KAASNCFDTVCGYCCCMCCIQCFS  808

Query  498  kINDQCAVVMTQ  533
            ++N+QC   + Q
Sbjct  809  RMNNQCLTALNQ  820



>ref|XP_006836596.1| hypothetical protein AMTR_s00131p00098870 [Amborella trichopoda]
 gb|ERM99449.1| hypothetical protein AMTR_s00131p00098870 [Amborella trichopoda]
Length=761

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 43/124 (35%), Positives = 66/124 (53%), Gaps = 6/124 (5%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q  + IP  K+LAKQ I++LTA+AWF ++K LEE++ + S+  GI SE+T+M    TE
Sbjct  573  KVQRLENIPFVKMLAKQHIDLLTAQAWFHEDKHLEEQVVKMSMHTGIPSEFTHMVLFQTE  632

Query  249  ETKGTT------EPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPEA  410
              K ++        +KV+           I  +  L +GFG + AT  N P  S+    +
Sbjct  633  REKHSSLVHELKLGNKVDFSEYTTSKASKITFVHGLTVGFGSIEATENNIPIESSELNVS  692

Query  411  AEMF  422
              +F
Sbjct  693  KSIF  696



>gb|KJB65319.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=646

 Score = 68.6 bits (166),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K ++A  I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +   
Sbjct  569  KIEKAMNISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEKG  628

Query  249  ETKGTTEPSKVNKKTG  296
            + +  T+ ++  KK G
Sbjct  629  KIERDTDTTEARKKLG  644


 Score = 30.8 bits (68),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKK  81
            G FP++L+A+GIL D+++  + L+ +K
Sbjct  546  GSFPDTLKAKGILGDLSHVIIDLKIEK  572



>gb|AAU89244.1| von Willebrand factor type A domain containing protein [Oryza 
sativa Japonica Group]
Length=801

 Score = 66.2 bits (160),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 73/205 (36%), Positives = 95/205 (46%), Gaps = 51/205 (25%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEK-----------------------  179
            + Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K                       
Sbjct  576  RVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKSGMRFTTVHCIMSYKVMLNLHYE  635

Query  180  IARASVQHGIVSEYTN----MAFIGTEETKGTTEPS------KVNKKTGDPKL-------  308
            + + S+Q+ I SEYT       F+   E    TE            +T D  L       
Sbjct  636  VVKLSIQNSIPSEYTRTILLQNFVEKIEQVFVTEGGVLYMFFSYGNRTLDETLKLKGKQK  695

Query  309  --------QKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQAASNcckmvc  458
                    +++   L  L LGFGD  AT EN     G T  PE  EMF +A   CC  + 
Sbjct  696  PKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMFDKAVG-CCSRLT  754

Query  459  dkcccmcciqmcskINDQCAVVMTQ  533
            D CCCMC I  CSK+ND+CA+VM Q
Sbjct  755  DCCCCMCFINTCSKMNDRCAIVMVQ  779


 Score = 32.7 bits (73),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LADM+  S+ LR
Sbjct  553  GKLPETLTAKGYLADMSEISIELR  576



>ref|XP_007135424.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
 gb|ESW07418.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
Length=650

 Score = 63.2 bits (152),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 27/70 (39%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K +  K+I LS VLAK+ I+++TA+AW  K++++EEK+ + S+Q+ ++SEYT M  +  +
Sbjct  568  KVKREKDIQLSNVLAKRHIDMVTAQAWLLKSEEVEEKVTKMSIQNKVLSEYTCMNMVLVQ  627

Query  249  ETKGTTEPSK  278
              +G   P +
Sbjct  628  SDEGKKPPEQ  637


 Score = 34.3 bits (77),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LADM NF++ L+ K+++
Sbjct  545  GTFPELVKVTGTLADMTNFAVDLKVKREK  573



>gb|ABF96529.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=680

 Score = 62.4 bits (150),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT  224
            + Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT
Sbjct  576  RVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYT  627


 Score = 32.3 bits (72),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LADM+  S+ LR
Sbjct  553  GKLPETLTAKGYLADMSEISIELR  576



>ref|XP_010318476.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028 isoform X4 [Solanum lycopersicum]
Length=641

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K Q+AK++PL +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +   
Sbjct  566  KVQKAKDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVENL  625

Query  249  ETKGTTEPSKVNK  287
            + K T++   V++
Sbjct  626  KEKQTSKLETVDE  638



>gb|KDO73865.1| hypothetical protein CISIN_1g004349mg [Citrus sinensis]
Length=613

 Score = 58.2 bits (139),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASV  197
            K Q AK+IPL ++ AKQQI++LTA+AWF+++K+LEEK+  +++
Sbjct  571  KLQLAKDIPLDRICAKQQIDLLTAQAWFSEDKRLEEKVRCSAI  613


 Score = 32.7 bits (73),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FP++L+A+G L D++NF + L+
Sbjct  548  GKFPDTLKAKGFLGDLSNFVVELK  571



>ref|XP_006452826.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
 gb|ESR66066.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
Length=613

 Score = 57.0 bits (136),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASV  197
            K Q AK++PL ++ AKQQI++LTA+AWF+++K+LEEK+  +++
Sbjct  571  KLQLAKDLPLDRICAKQQIDLLTAQAWFSEDKRLEEKVRCSAI  613


 Score = 32.7 bits (73),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+FP++L+A+G L D++NF + L+
Sbjct  548  GKFPDTLKAKGFLGDLSNFVVELK  571



>gb|KHN06057.1| hypothetical protein glysoja_035963 [Glycine soja]
Length=178

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSE  218
            K Q+AK+IP+ ++ A+ QIE LTA+AW +K++KLE+K+A+ S+Q+  +SE
Sbjct  129  KIQDAKDIPVQRICARDQIEYLTAQAWLSKDEKLEQKVAKLSLQNDFISE  178



>gb|KEH18485.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=648

 Score = 55.8 bits (133),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K +  K++ L+ V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT M  I   
Sbjct  567  KVKREKDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILVN  626

Query  249  ETKGTTEP  272
            +     EP
Sbjct  627  KNDVKKEP  634


 Score = 30.0 bits (66),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LAD  +F++ L+ K+++
Sbjct  544  GTFPELVKVTGTLADRTSFAVDLKVKREK  572



>ref|XP_006385522.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63319.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=690

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            KAQ+ K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T 
Sbjct  576  KAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTL  635

Query  249  ETKGTTE  269
            + +   E
Sbjct  636  QDEKAPE  642



>tpg|DAA41433.1| TPA: hypothetical protein ZEAMMB73_769800 [Zea mays]
Length=1295

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 36/103 (35%), Positives = 61/103 (59%), Gaps = 8/103 (8%)
 Frame = +3

Query  48   EQLLSTPKAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIA----RASVQHGIVS  215
            +++L   K Q+ KE+ L KVL  Q I+++TA+AW +  K+LE K+     + S+Q+G+ S
Sbjct  567  KEVLIELKVQQLKEVTLDKVLVTQHIDLMTAKAWLSAAKQLERKVGYLVIKLSIQNGVPS  626

Query  216  EYTNMAFIGT--EETKGTTEPSKVNKKTG--DPKLQKAIIMLR  332
            EYT+M  + T  + T    + ++ N  TG  D    + I+ML+
Sbjct  627  EYTDMVLLQTNLDNTGTQKDATRENLVTGFWDVNSAEKIVMLQ  669



>ref|XP_007216978.1| hypothetical protein PRUPE_ppa002885mg [Prunus persica]
 gb|EMJ18177.1| hypothetical protein PRUPE_ppa002885mg [Prunus persica]
Length=624

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT  224
            K Q +KE PL +VLA++ I++LTA AW   +K+LEEK+++ S Q G+ SEYT
Sbjct  563  KVQRSKEFPLDRVLARRHIDMLTAHAWLLGSKELEEKVSKMSKQTGVPSEYT  614



>gb|KEH18487.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=491

 Score = 54.3 bits (129),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  248
            K +  K++ L+ V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT M  I   
Sbjct  410  KVKREKDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILVN  469

Query  249  ETKGTTEP  272
            +     EP
Sbjct  470  KNDVKKEP  477


 Score = 30.4 bits (67),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FPE ++  G LAD  +F++ L+ K+++
Sbjct  387  GTFPELVKVTGTLADRTSFAVDLKVKREK  415



>ref|XP_010477112.1| PREDICTED: uncharacterized protein LOC104756252 [Camelina sativa]
Length=131

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = +3

Query  303  KLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAASNcckmvcdkcccm  476
            K+    I L++LG+GFGD TAT EN PPG   +  P+AAE FV+AAS+CC  +C+KCCCM
Sbjct  29   KMISRTIPLQSLGIGFGDKTATRENVPPGFGEQRAPDAAEKFVKAASSCCVSLCNKCCCM  88

Query  477  cciqmcskINDQCAVVMTQ  533
            CC+Q C+K+NDQC +V TQ
Sbjct  89   CCVQCCTKLNDQCVLVFTQ  107



>tpg|DAA41434.1| TPA: hypothetical protein ZEAMMB73_769800 [Zea mays]
Length=758

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 36/103 (35%), Positives = 61/103 (59%), Gaps = 8/103 (8%)
 Frame = +3

Query  48   EQLLSTPKAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIA----RASVQHGIVS  215
            +++L   K Q+ KE+ L KVL  Q I+++TA+AW +  K+LE K+     + S+Q+G+ S
Sbjct  567  KEVLIELKVQQLKEVTLDKVLVTQHIDLMTAKAWLSAAKQLERKVGYLVIKLSIQNGVPS  626

Query  216  EYTNMAFIGT--EETKGTTEPSKVNKKTG--DPKLQKAIIMLR  332
            EYT+M  + T  + T    + ++ N  TG  D    + I+ML+
Sbjct  627  EYTDMVLLQTNLDNTGTQKDATRENLVTGFWDVNSAEKIVMLQ  669



>ref|XP_011035745.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Populus euphratica]
Length=643

 Score = 50.4 bits (119),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIA  185
            KAQ+AK++P+ +V+A++QI++LTA AW + +K+LE+K+ 
Sbjct  575  KAQKAKDLPVDRVVARRQIDLLTANAWLSGSKELEQKVG  613


 Score = 33.5 bits (75),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP+S++  GILADM  F++ ++ +K +
Sbjct  552  GNFPDSVKLSGILADMRKFTIDIKAQKAK  580



>gb|EMT04548.1| hypothetical protein F775_32683 [Aegilops tauschii]
Length=628

 Score = 52.8 bits (125),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEE  176
            K Q  K+IPL KVLAKQQ+++LTA+AW ++NK+LE+
Sbjct  476  KVQHIKDIPLDKVLAKQQMDLLTAKAWLSENKQLEQ  511


 Score = 30.4 bits (67),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            GE PE+L A G L+DM+  S+ L+
Sbjct  453  GELPETLYAEGYLSDMSKISIELK  476



>gb|ABF96530.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=614

 Score = 50.4 bits (119),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKI  182
            + Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+
Sbjct  576  RVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKV  613


 Score = 32.7 bits (73),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+ PE+L A+G LADM+  S+ LR
Sbjct  553  GKLPETLTAKGYLADMSEISIELR  576



>ref|XP_011035746.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Populus euphratica]
Length=641

 Score = 49.3 bits (116),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEK  179
            KAQ+AK++P+ +V+A++QI++LTA AW + +K+LE+K
Sbjct  575  KAQKAKDLPVDRVVARRQIDLLTANAWLSGSKELEQK  611


 Score = 33.5 bits (75),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQR  87
            G FP+S++  GILADM  F++ ++ +K +
Sbjct  552  GNFPDSVKLSGILADMRKFTIDIKAQKAK  580



>gb|KCW71308.1| hypothetical protein EUGRSUZ_F04395 [Eucalyptus grandis]
Length=105

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = +3

Query  297  DPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPE-AAEMFVQAASNcckmvcdkccc  473
            D K Q+ +I+L +LG GFG+LTAT +N PPG   K   AA++ V+AASNCC  + D+ CC
Sbjct  3    DLKGQR-VILLGSLGKGFGNLTATVKNIPPGLEEKTSYAADVLVKAASNCCGKLMDRICC  61

Query  474  mcciqmcskINDQCAVVMTQ  533
            MC IQ CS +ND+CAV +TQ
Sbjct  62   MCFIQTCSYVNDRCAVALTQ  81



>gb|EPS65940.1| hypothetical protein M569_08838, partial [Genlisea aurea]
Length=637

 Score = 55.8 bits (133),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTK--NKKLEEKIARASVQHGIVSEYTNMAFIGT  245
                 +I + ++ AK +IE+LT++AW++   N +L+ K+A  S+Q+G+VSEYTNM  I T
Sbjct  575  VDHGSDIVIPQITAKLRIELLTSQAWYSSSGNGELKHKVANLSIQNGVVSEYTNMVLIET  634


 Score = 24.6 bits (52),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLR  72
            G+F E+L  +GI AD ++F + L+
Sbjct  550  GKFSETLRLKGIHADGSDFCVDLK  573



>gb|ETO27230.1| hypothetical protein RFI_09901, partial [Reticulomyxa filosa]
Length=191

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  78   EAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETK  257
            E   +P+ K+L KQ+I++LTA+AWF+++K +  K+ ++S++H + S YT++    T + K
Sbjct  102  ETPHLPVDKILIKQKIDLLTAQAWFSQDKAVIRKVVQSSIEHCVPSHYTSLIAFETRKEK  161



>gb|ETO32114.1| hypothetical protein RFI_05003 [Reticulomyxa filosa]
Length=278

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  78   EAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM  230
            E   +P+ K+  K++I++LTA+AWF+ +KK+E ++ + SV H I S+YT++
Sbjct  99   ETPHLPVDKIFVKEKIDLLTAQAWFSDDKKIENQVIQESVTHSIPSQYTSL  149



>ref|XP_001762340.1| predicted protein [Physcomitrella patens]
 gb|EDQ72807.1| predicted protein [Physcomitrella patens]
Length=621

 Score = 51.2 bits (121),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
            ++ + ++PL++V AKQQ+++ T +AW   NK  E++    S+  G+  +YT M  IG E 
Sbjct  547  SRNSSKLPLNRVFAKQQLDLFTGQAWLCGNKSREQEAVNLSLSTGLPCQYTRM--IGFET  604

Query  252  TK  257
            T+
Sbjct  605  TR  606


 Score = 24.6 bits (52),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 8/30 (27%), Positives = 17/30 (57%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    GEFPESLEARGILADMNNFSLHLRRKKQRK  90
            G+FP+SL   G++ D + + + +  +   K
Sbjct  523  GKFPDSLIVMGLMPDQSTWQIEVPSRNSSK  552



>gb|KJB07324.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
 gb|KJB07326.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=614

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  69   KAQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIA  185
            K   AK+IPL +VL++Q+I++LTA+AW ++NK+LE+K+ 
Sbjct  571  KIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVC  609



>ref|XP_002503574.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64832.1| predicted protein [Micromonas sp. RCC299]
Length=753

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 9/105 (9%)
 Frame = +3

Query  90   IPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTE  269
            IPL KV  K++I++LTA AW T NK  E  +   S+++G+   +T +     +  K + E
Sbjct  560  IPLDKVFIKERIDMLTANAWLTNNKSAEADVTALSLEYGVPCPHTKLCAFEVDPKK-SAE  618

Query  270  PSKVNKKTGDPKLQK-------AIIMLRNL-GLGFGDLTATAENT  380
                 KK G  K+ K        +++L  L G  FG++ A+  N 
Sbjct  619  VEAAKKKGGAMKIAKYAVGGAAGVMVLGALAGADFGNVGASLANV  663



>ref|XP_001768544.1| predicted protein [Physcomitrella patens]
 gb|EDQ66695.1| predicted protein [Physcomitrella patens]
Length=778

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +3

Query  72   AQEAKEIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
            +++  ++PLSKV AKQQ+++LT +AW   +K+ +++    S+  G+  EYT M  IG E 
Sbjct  589  SRKTSKVPLSKVFAKQQLDLLTGQAWLYGDKRRQQEAVNLSLATGMPCEYTRM--IGFET  646

Query  252  T  254
            T
Sbjct  647  T  647



>ref|XP_010462785.1| PREDICTED: uncharacterized protein LOC104743395 [Camelina sativa]
Length=273

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +3

Query  303  KLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQAASN  440
            K+    I L++LG+GFGD TAT EN PP  G    P+AAE FV+AAS+
Sbjct  29   KMVSRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAEKFVKAASS  76



>gb|ETO24316.1| hypothetical protein RFI_12842 [Reticulomyxa filosa]
Length=343

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 68/131 (52%), Gaps = 24/131 (18%)
 Frame = +3

Query  87   EIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM-AFIGTEET---  254
            ++P+ K+  K+++++L+A+AWF++++++E ++ + SV+H + + +T++ AF   +E    
Sbjct  105  KLPVDKIFIKEKLDLLSAQAWFSEDQQVERQVVQTSVEHSLPTPFTSLIAFEARQEDLEK  164

Query  255  KG-TTEPSKVNKKTGDPKLQKAIIMLRN-------LGLG------------FGDLTATAE  374
            KG   + ++ N         K    +RN       L +G            FGD+ AT E
Sbjct  165  KGLLVDENQTNDGFDSIVKSKTWATVRNNKGTVSALAIGGTAIALAATAATFGDIQATFE  224

Query  375  NTPPGSTSKPE  407
            N P   +  P+
Sbjct  225  NIPVLDSGLPD  235



>gb|ETO23352.1| hypothetical protein RFI_13832 [Reticulomyxa filosa]
Length=304

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  90   IPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE  251
            IP+ K+ AK+++++LTA+AW  +++K EE + + S+ H I S+YT++    T +
Sbjct  103  IPVDKIFAKERLDLLTAQAWLLEDEKSEELVVQESIAHCIPSQYTSIVAFETRQ  156



>ref|XP_003055556.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60808.1| predicted protein [Micromonas pusilla CCMP1545]
Length=802

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  90   IPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM  230
            +PL KV  KQ+I++L A+AW   +KKLE++I   SV+H +   YT +
Sbjct  559  VPLEKVFVKQRIDLLVAKAWLYDDKKLEKEIIDISVEHDVACPYTKL  605



>gb|ETO29250.1| hypothetical protein RFI_07873 [Reticulomyxa filosa]
Length=561

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  87   EIPLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM  230
            ++P+ K+L KQ++++LTA+ W + ++K+++++ + S++H I S YT++
Sbjct  102  QLPVEKILIKQKLDLLTAQGWLSDDEKVQQRVIQTSIEHSIPSPYTSL  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625