BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF025M03

Length=646
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011099916.1|  PREDICTED: transmembrane 9 superfamily member 3    252   2e-76   
gb|EYU30878.1|  hypothetical protein MIMGU_mgv1a003324mg                252   2e-76   Erythranthe guttata [common monkey flower]
gb|EYU30892.1|  hypothetical protein MIMGU_mgv1a003326mg                251   4e-76   Erythranthe guttata [common monkey flower]
ref|XP_004239834.1|  PREDICTED: putative phagocytic receptor 1b         249   5e-75   Solanum lycopersicum
ref|XP_009602054.1|  PREDICTED: putative phagocytic receptor 1b         248   6e-75   Nicotiana tomentosiformis
ref|XP_004236681.1|  PREDICTED: putative phagocytic receptor 1b         248   9e-75   Solanum lycopersicum
ref|XP_006346764.1|  PREDICTED: putative phagocytic receptor 1b-like    248   1e-74   Solanum tuberosum [potatoes]
ref|XP_006365862.1|  PREDICTED: putative phagocytic receptor 1b-like    247   1e-74   
ref|XP_009775043.1|  PREDICTED: putative phagocytic receptor 1b         246   3e-74   Nicotiana sylvestris
gb|EPS59962.1|  hypothetical protein M569_14842                         244   4e-74   Genlisea aurea
ref|XP_009774478.1|  PREDICTED: putative phagocytic receptor 1b         246   6e-74   Nicotiana sylvestris
ref|XP_009785097.1|  PREDICTED: putative phagocytic receptor 1b         243   5e-73   Nicotiana sylvestris
ref|XP_010276303.1|  PREDICTED: putative phagocytic receptor 1b         243   5e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010244840.1|  PREDICTED: putative phagocytic receptor 1b         243   5e-73   Nelumbo nucifera [Indian lotus]
ref|XP_009616336.1|  PREDICTED: putative phagocytic receptor 1b         243   7e-73   Nicotiana tomentosiformis
ref|XP_004250237.1|  PREDICTED: putative phagocytic receptor 1b         241   6e-72   Solanum lycopersicum
ref|XP_006352389.1|  PREDICTED: putative phagocytic receptor 1b-l...    241   6e-72   Solanum tuberosum [potatoes]
ref|XP_009631354.1|  PREDICTED: putative phagocytic receptor 1b         240   1e-71   Nicotiana tomentosiformis
ref|XP_010069472.1|  PREDICTED: putative phagocytic receptor 1b         239   2e-71   Eucalyptus grandis [rose gum]
ref|XP_010691703.1|  PREDICTED: transmembrane 9 superfamily member 2    239   3e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011011376.1|  PREDICTED: transmembrane 9 superfamily membe...    236   8e-71   Populus euphratica
ref|XP_007031333.1|  Endomembrane protein 70 protein family             236   2e-70   
gb|AAF79216.1|AC006917_1  F10B6.2                                       227   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KHG03505.1|  Putative phagocytic receptor 1b                         236   3e-70   Gossypium arboreum [tree cotton]
ref|XP_011038406.1|  PREDICTED: transmembrane 9 superfamily membe...    236   4e-70   Populus euphratica
ref|XP_002285238.1|  PREDICTED: transmembrane 9 superfamily member 2    235   9e-70   Vitis vinifera
emb|CDP01680.1|  unnamed protein product                                235   9e-70   Coffea canephora [robusta coffee]
ref|XP_002870515.1|  transporter                                        234   1e-69   Arabidopsis lyrata subsp. lyrata
ref|NP_198547.3|  putative endomembrane protein 70                      234   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038404.1|  PREDICTED: transmembrane 9 superfamily member 4    234   2e-69   Populus euphratica
emb|CDY52038.1|  BnaA08g31510D                                          231   2e-69   Brassica napus [oilseed rape]
gb|KJB15311.1|  hypothetical protein B456_002G170500                    232   3e-69   Gossypium raimondii
ref|XP_010691704.1|  PREDICTED: transmembrane 9 superfamily membe...    233   5e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011005915.1|  PREDICTED: transmembrane 9 superfamily membe...    233   5e-69   Populus euphratica
ref|XP_004150159.1|  PREDICTED: putative phagocytic receptor 1b-like    234   6e-69   
ref|XP_010554368.1|  PREDICTED: putative phagocytic receptor 1b         233   6e-69   Tarenaya hassleriana [spider flower]
gb|KJB15313.1|  hypothetical protein B456_002G170500                    232   6e-69   Gossypium raimondii
ref|XP_006372422.1|  endomembrane protein 70                            233   6e-69   Populus trichocarpa [western balsam poplar]
ref|XP_006372420.1|  hypothetical protein POPTR_0017s01480g             231   9e-69   
ref|XP_009110524.1|  PREDICTED: putative phagocytic receptor 1b         232   1e-68   Brassica rapa
emb|CDY52035.1|  BnaA08g31480D                                          231   1e-68   Brassica napus [oilseed rape]
gb|KJB15310.1|  hypothetical protein B456_002G170500                    231   1e-68   Gossypium raimondii
ref|XP_006405901.1|  hypothetical protein EUTSA_v10027693mg             231   1e-68   
ref|XP_010528590.1|  PREDICTED: putative phagocytic receptor 1b         231   2e-68   Tarenaya hassleriana [spider flower]
ref|XP_010527833.1|  PREDICTED: putative phagocytic receptor 1b         231   2e-68   Tarenaya hassleriana [spider flower]
ref|XP_006416990.1|  hypothetical protein EUTSA_v10007150mg             231   2e-68   Eutrema salsugineum [saltwater cress]
ref|XP_006384123.1|  hypothetical protein POPTR_0004s07400g             231   3e-68   
gb|KJB08471.1|  hypothetical protein B456_001G083100                    229   3e-68   Gossypium raimondii
ref|XP_006395825.1|  hypothetical protein EUTSA_v10003877mg             231   3e-68   Eutrema salsugineum [saltwater cress]
gb|KFK43715.1|  hypothetical protein AALP_AA1G163400                    231   3e-68   Arabis alpina [alpine rockcress]
gb|KHG00678.1|  Putative phagocytic receptor 1b                         229   4e-68   Gossypium arboreum [tree cotton]
ref|XP_006372421.1|  hypothetical protein POPTR_0017s01480g             230   4e-68   Populus trichocarpa [western balsam poplar]
gb|KHG04463.1|  Putative phagocytic receptor 1b                         231   5e-68   Gossypium arboreum [tree cotton]
emb|CDX84018.1|  BnaC08g16270D                                          229   8e-68   
ref|XP_011005913.1|  PREDICTED: transmembrane 9 superfamily membe...    229   8e-68   Populus euphratica
emb|CDY62621.1|  BnaC08g46810D                                          229   8e-68   Brassica napus [oilseed rape]
gb|KJB60875.1|  hypothetical protein B456_009G329300                    228   9e-68   Gossypium raimondii
ref|NP_178306.1|  putative endomembrane protein 70                      229   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461818.1|  PREDICTED: putative phagocytic receptor 1b i...    229   1e-67   Cucumis melo [Oriental melon]
gb|AAF63170.1|AC010657_6  T5E21.15                                      228   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011085893.1|  PREDICTED: transmembrane 9 superfamily membe...    229   1e-67   Sesamum indicum [beniseed]
gb|KJB08470.1|  hypothetical protein B456_001G083100                    229   1e-67   Gossypium raimondii
ref|XP_004137376.1|  PREDICTED: putative phagocytic receptor 1b-like    229   2e-67   Cucumis sativus [cucumbers]
gb|KJB08472.1|  hypothetical protein B456_001G083100                    229   2e-67   Gossypium raimondii
emb|CDP01681.1|  unnamed protein product                                229   2e-67   Coffea canephora [robusta coffee]
ref|XP_010440842.1|  PREDICTED: putative phagocytic receptor 1b i...    223   2e-67   
emb|CDY47549.1|  BnaA08g07380D                                          228   2e-67   Brassica napus [oilseed rape]
gb|KJB60874.1|  hypothetical protein B456_009G329300                    228   2e-67   Gossypium raimondii
ref|XP_010105529.1|  Putative phagocytic receptor 1b                    228   3e-67   Morus notabilis
ref|NP_172919.1|  putative endomembrane protein 70                      228   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445554.1|  PREDICTED: putative phagocytic receptor 1b         223   3e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009110529.1|  PREDICTED: putative phagocytic receptor 1b         228   3e-67   Brassica rapa
ref|XP_011463508.1|  PREDICTED: transmembrane 9 superfamily member 2    228   3e-67   Fragaria vesca subsp. vesca
emb|CDY15803.1|  BnaC02g34220D                                          228   4e-67   Brassica napus [oilseed rape]
ref|XP_002876790.1|  hypothetical protein ARALYDRAFT_904415             228   5e-67   Arabidopsis lyrata subsp. lyrata
gb|KHG09925.1|  Putative phagocytic receptor 1b                         228   5e-67   Gossypium arboreum [tree cotton]
ref|XP_002305925.2|  endomembrane protein 70                            227   6e-67   Populus trichocarpa [western balsam poplar]
ref|XP_008462539.1|  PREDICTED: putative phagocytic receptor 1b i...    227   7e-67   Cucumis melo [Oriental melon]
gb|KHN43674.1|  Putative phagocytic receptor 1b                         227   9e-67   Glycine soja [wild soybean]
ref|XP_002521898.1|  transporter, putative                              225   1e-66   
ref|XP_006292411.1|  hypothetical protein CARUB_v10018624mg             227   1e-66   Capsella rubella
ref|XP_009108077.1|  PREDICTED: putative phagocytic receptor 1b         227   1e-66   Brassica rapa
ref|XP_010523531.1|  PREDICTED: putative phagocytic receptor 1b         226   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_010502204.1|  PREDICTED: putative phagocytic receptor 1b         226   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010513951.1|  PREDICTED: putative phagocytic receptor 1b         226   1e-66   Camelina sativa [gold-of-pleasure]
gb|KFK33411.1|  hypothetical protein AALP_AA5G009400                    226   1e-66   Arabis alpina [alpine rockcress]
ref|XP_010523409.1|  PREDICTED: putative phagocytic receptor 1b         226   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_008220963.1|  PREDICTED: putative phagocytic receptor 1b         226   2e-66   Prunus mume [ume]
ref|XP_007225615.1|  hypothetical protein PRUPE_ppa003229mg             226   2e-66   Prunus persica
ref|XP_007045409.1|  Endomembrane protein 70 protein family isofo...    226   2e-66   
ref|XP_007045410.1|  Endomembrane protein 70 protein family isofo...    226   2e-66   
ref|XP_008356702.1|  PREDICTED: transmembrane 9 superfamily membe...    222   2e-66   
emb|CDX81659.1|  BnaC08g39420D                                          226   2e-66   
dbj|BAJ89640.1|  predicted protein                                      226   3e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004170088.1|  PREDICTED: putative phagocytic receptor 1b-like    225   3e-66   
ref|XP_008466877.1|  PREDICTED: putative phagocytic receptor 1b         225   4e-66   Cucumis melo [Oriental melon]
ref|XP_010066537.1|  PREDICTED: putative phagocytic receptor 1b         225   5e-66   Eucalyptus grandis [rose gum]
ref|XP_010458976.1|  PREDICTED: putative phagocytic receptor 1b         225   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010440841.1|  PREDICTED: putative phagocytic receptor 1b i...    225   5e-66   Camelina sativa [gold-of-pleasure]
gb|KDP38191.1|  hypothetical protein JCGZ_04834                         225   5e-66   Jatropha curcas
ref|XP_004985073.1|  PREDICTED: putative phagocytic receptor 1b-like    225   5e-66   Setaria italica
ref|XP_009355975.1|  PREDICTED: putative phagocytic receptor 1b         225   6e-66   Pyrus x bretschneideri [bai li]
ref|XP_006307070.1|  hypothetical protein CARUB_v10008657mg             224   6e-66   Capsella rubella
ref|XP_009380058.1|  PREDICTED: putative phagocytic receptor 1b         224   6e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP38192.1|  hypothetical protein JCGZ_04835                         224   7e-66   Jatropha curcas
ref|XP_010450487.1|  PREDICTED: putative phagocytic receptor 1b         224   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_007152616.1|  hypothetical protein PHAVU_004G145000g             224   8e-66   Phaseolus vulgaris [French bean]
ref|XP_007158822.1|  hypothetical protein PHAVU_002G184900g             224   8e-66   Phaseolus vulgaris [French bean]
ref|XP_008393472.1|  PREDICTED: putative phagocytic receptor 1b         224   1e-65   Malus domestica [apple tree]
ref|XP_010917284.1|  PREDICTED: transmembrane 9 superfamily membe...    224   1e-65   Elaeis guineensis
ref|XP_009387842.1|  PREDICTED: putative phagocytic receptor 1b         224   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006283389.1|  hypothetical protein CARUB_v10004434mg             223   2e-65   Capsella rubella
ref|XP_010496367.1|  PREDICTED: putative phagocytic receptor 1b         223   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_003548324.1|  PREDICTED: putative phagocytic receptor 1b-like    223   2e-65   Glycine max [soybeans]
ref|XP_008789222.1|  PREDICTED: putative phagocytic receptor 1b         223   2e-65   
ref|XP_010476529.1|  PREDICTED: putative phagocytic receptor 1b         223   2e-65   Camelina sativa [gold-of-pleasure]
gb|KHN24548.1|  Putative phagocytic receptor 1b                         223   2e-65   Glycine soja [wild soybean]
gb|AHA84153.1|  phagocytic receptor 1b                                  223   2e-65   Phaseolus vulgaris [French bean]
ref|XP_009351612.1|  PREDICTED: putative phagocytic receptor 1b         223   3e-65   Pyrus x bretschneideri [bai li]
ref|XP_008340538.1|  PREDICTED: putative phagocytic receptor 1b         223   3e-65   Malus domestica [apple tree]
ref|XP_008791844.1|  PREDICTED: putative phagocytic receptor 1b         223   3e-65   Phoenix dactylifera
ref|XP_004515238.1|  PREDICTED: putative phagocytic receptor 1b-like    223   3e-65   Cicer arietinum [garbanzo]
ref|XP_010936838.1|  PREDICTED: transmembrane 9 superfamily membe...    222   5e-65   Elaeis guineensis
ref|XP_010435562.1|  PREDICTED: putative phagocytic receptor 1b         222   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_003524839.1|  PREDICTED: putative phagocytic receptor 1b-like    222   6e-65   Glycine max [soybeans]
ref|XP_007210263.1|  hypothetical protein PRUPE_ppa003204mg             222   7e-65   Prunus persica
ref|XP_004299493.1|  PREDICTED: transmembrane 9 superfamily membe...    222   7e-65   Fragaria vesca subsp. vesca
ref|XP_008798135.1|  PREDICTED: putative phagocytic receptor 1b         221   2e-64   Phoenix dactylifera
ref|XP_006448060.1|  hypothetical protein CICLE_v10014688mg             219   2e-64   
ref|XP_008356712.1|  PREDICTED: putative phagocytic receptor 1b         213   3e-64   
ref|XP_003531127.1|  PREDICTED: putative phagocytic receptor 1b-like    221   3e-64   Glycine max [soybeans]
ref|XP_010932502.1|  PREDICTED: transmembrane 9 superfamily membe...    220   3e-64   Elaeis guineensis
gb|KHN28892.1|  Putative phagocytic receptor 1b                         220   3e-64   Glycine soja [wild soybean]
ref|XP_006431398.1|  hypothetical protein CICLE_v10000657mg             219   3e-64   
ref|XP_010920043.1|  PREDICTED: transmembrane 9 superfamily membe...    218   4e-64   
ref|XP_006448061.1|  hypothetical protein CICLE_v10014688mg             220   4e-64   Citrus clementina [clementine]
ref|XP_010920044.1|  PREDICTED: transmembrane 9 superfamily membe...    218   5e-64   
ref|XP_006854108.1|  hypothetical protein AMTR_s00048p00146310          220   5e-64   
tpg|DAA44289.1|  TPA: hypothetical protein ZEAMMB73_547933              218   6e-64   
ref|XP_008389133.1|  PREDICTED: putative phagocytic receptor 1b         219   6e-64   
ref|XP_006431397.1|  hypothetical protein CICLE_v10000657mg             219   8e-64   Citrus clementina [clementine]
emb|CDY41095.1|  BnaC05g10860D                                          219   9e-64   Brassica napus [oilseed rape]
ref|XP_003558407.1|  PREDICTED: putative phagocytic receptor 1b         218   1e-63   Brachypodium distachyon [annual false brome]
gb|ADQ43185.1|  endomemebrane protein 70                                218   2e-63   Schrenkiella parvula
ref|XP_009389646.1|  PREDICTED: putative phagocytic receptor 1b         218   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004504610.1|  PREDICTED: putative phagocytic receptor 1b-like    218   2e-63   Cicer arietinum [garbanzo]
ref|XP_010920042.1|  PREDICTED: transmembrane 9 superfamily membe...    218   2e-63   
ref|NP_001148980.1|  LOC100282600 precursor                             218   2e-63   Zea mays [maize]
ref|XP_002468203.1|  hypothetical protein SORBIDRAFT_01g041650          218   2e-63   Sorghum bicolor [broomcorn]
ref|XP_006470811.1|  PREDICTED: putative phagocytic receptor 1b-like    218   3e-63   Citrus sinensis [apfelsine]
ref|XP_008787888.1|  PREDICTED: putative phagocytic receptor 1b i...    217   3e-63   Phoenix dactylifera
ref|XP_010920041.1|  PREDICTED: transmembrane 9 superfamily membe...    217   3e-63   
gb|AGT15903.1|  transmembrane 9 superfamily protein                     218   3e-63   Saccharum hybrid cultivar R570
ref|XP_010939968.1|  PREDICTED: transmembrane 9 superfamily membe...    218   4e-63   Elaeis guineensis
ref|XP_002521899.1|  transporter, putative                              217   4e-63   Ricinus communis
ref|XP_003620064.1|  Transmembrane 9 superfamily protein member         217   5e-63   Medicago truncatula
ref|XP_008787887.1|  PREDICTED: putative phagocytic receptor 1b i...    217   5e-63   Phoenix dactylifera
ref|NP_001049492.1|  Os03g0237000                                       217   6e-63   
ref|XP_008375035.1|  PREDICTED: putative phagocytic receptor 1b         217   8e-63   
ref|XP_009404153.1|  PREDICTED: putative phagocytic receptor 1b         216   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001151315.1|  transmembrane 9 superfamily protein member 1...    215   3e-62   Zea mays [maize]
gb|ACG42357.1|  transmembrane 9 superfamily protein member 1 prec...    215   3e-62   Zea mays [maize]
ref|XP_009628015.1|  PREDICTED: putative phagocytic receptor 1b i...    214   5e-62   Nicotiana tomentosiformis
ref|XP_009419338.1|  PREDICTED: putative phagocytic receptor 1b         214   5e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788644.1|  PREDICTED: putative phagocytic receptor 1b         213   1e-61   Phoenix dactylifera
gb|KHG20583.1|  Putative phagocytic receptor 1b                         213   1e-61   Gossypium arboreum [tree cotton]
ref|XP_007141945.1|  hypothetical protein PHAVU_008G239300g             213   1e-61   Phaseolus vulgaris [French bean]
gb|KJB43179.1|  hypothetical protein B456_007G188200                    212   4e-61   Gossypium raimondii
ref|XP_009782678.1|  PREDICTED: putative phagocytic receptor 1b i...    211   8e-61   Nicotiana sylvestris
ref|XP_010036999.1|  PREDICTED: putative phagocytic receptor 1b         210   1e-60   Eucalyptus grandis [rose gum]
ref|XP_010276746.1|  PREDICTED: putative phagocytic receptor 1b         210   2e-60   Nelumbo nucifera [Indian lotus]
emb|CDP05457.1|  unnamed protein product                                210   2e-60   Coffea canephora [robusta coffee]
ref|XP_006849485.1|  hypothetical protein AMTR_s00024p00115620          210   2e-60   
ref|XP_010099693.1|  Putative phagocytic receptor 1b                    211   3e-60   
ref|XP_010910475.1|  PREDICTED: transmembrane 9 superfamily membe...    206   1e-59   
gb|ABK25212.1|  unknown                                                 202   2e-59   Picea sitchensis
gb|KHN41041.1|  Putative phagocytic receptor 1b                         207   2e-59   Glycine soja [wild soybean]
ref|XP_003518365.2|  PREDICTED: putative phagocytic receptor 1b-l...    207   2e-59   Glycine max [soybeans]
gb|KJB10378.1|  hypothetical protein B456_001G198000                    205   3e-59   Gossypium raimondii
ref|XP_010910474.1|  PREDICTED: transmembrane 9 superfamily membe...    206   3e-59   
ref|XP_008813153.1|  PREDICTED: putative phagocytic receptor 1b         207   4e-59   Phoenix dactylifera
ref|XP_010910473.1|  PREDICTED: transmembrane 9 superfamily membe...    206   5e-59   Elaeis guineensis
ref|XP_004972768.1|  PREDICTED: putative phagocytic receptor 1b-l...    208   5e-59   
ref|XP_003616193.1|  Transmembrane 9 superfamily protein member         207   9e-59   
ref|XP_010037000.1|  PREDICTED: putative phagocytic receptor 1b         206   1e-58   Eucalyptus grandis [rose gum]
ref|XP_003544357.1|  PREDICTED: putative phagocytic receptor 1b-like    206   1e-58   Glycine max [soybeans]
ref|XP_004240860.1|  PREDICTED: putative phagocytic receptor 1b i...    205   2e-58   
gb|EEE68090.1|  hypothetical protein OsJ_26137                          207   3e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...    204   4e-58   Nicotiana sylvestris
ref|XP_004490795.1|  PREDICTED: putative phagocytic receptor 1b-like    204   4e-58   Cicer arietinum [garbanzo]
ref|XP_006358745.1|  PREDICTED: putative phagocytic receptor 1b-like    203   7e-58   
ref|XP_009388099.1|  PREDICTED: putative phagocytic receptor 1b         202   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006575472.1|  PREDICTED: putative phagocytic receptor 1b-l...    202   1e-57   Glycine max [soybeans]
ref|XP_002521900.1|  transporter, putative                              202   2e-57   Ricinus communis
gb|ABK24901.1|  unknown                                                 202   2e-57   Picea sitchensis
gb|AES99151.2|  transmembrane 9 family protein                          201   5e-57   Medicago truncatula
ref|XP_009408099.1|  PREDICTED: putative phagocytic receptor 1b         201   5e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009615617.1|  PREDICTED: putative phagocytic receptor 1b i...    200   1e-56   Nicotiana tomentosiformis
ref|XP_008356706.1|  PREDICTED: transmembrane 9 superfamily membe...    196   1e-56   
ref|NP_001148367.1|  transmembrane 9 superfamily protein member 1...    198   4e-56   Zea mays [maize]
gb|EEC82941.1|  hypothetical protein OsI_27915                          197   2e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_004972769.1|  PREDICTED: putative phagocytic receptor 1b-l...    197   2e-55   Setaria italica
ref|XP_003573450.1|  PREDICTED: putative phagocytic receptor 1b         196   3e-55   Brachypodium distachyon [annual false brome]
gb|EPS73381.1|  hypothetical protein M569_01372                         195   7e-55   Genlisea aurea
gb|ABR16201.1|  unknown                                                 192   8e-54   Picea sitchensis
ref|XP_006659860.1|  PREDICTED: putative phagocytic receptor 1b-like    191   1e-53   Oryza brachyantha
emb|CDP05449.1|  unnamed protein product                                183   7e-53   Coffea canephora [robusta coffee]
gb|KHN39489.1|  Putative phagocytic receptor 1b                         189   9e-53   Glycine soja [wild soybean]
gb|EMT19161.1|  Putative phagocytic receptor 1b                         189   9e-53   
ref|XP_006661606.1|  PREDICTED: putative phagocytic receptor 1b-like    189   1e-52   Oryza brachyantha
ref|NP_001064040.1|  Os10g0112600                                       188   3e-52   
gb|EMS60954.1|  Putative phagocytic receptor 1b                         188   3e-52   Triticum urartu
gb|EEC66468.1|  hypothetical protein OsI_32547                          188   3e-52   Oryza sativa Indica Group [Indian rice]
gb|AAK52585.1|AC079685_16  Putative endosomal protein                   188   4e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001770691.1|  predicted protein                                  185   4e-51   
dbj|BAJ89513.1|  predicted protein                                      184   9e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001775546.1|  predicted protein                                  183   2e-50   
ref|XP_004228944.1|  PREDICTED: putative phagocytic receptor 1b         182   3e-50   Solanum lycopersicum
ref|XP_010521657.1|  PREDICTED: putative phagocytic receptor 1b i...    182   5e-50   Tarenaya hassleriana [spider flower]
ref|XP_011003770.1|  PREDICTED: transmembrane 9 superfamily membe...    181   1e-49   Populus euphratica
emb|CDP05446.1|  unnamed protein product                                181   1e-49   Coffea canephora [robusta coffee]
ref|XP_006849484.1|  hypothetical protein AMTR_s00024p00115000          181   1e-49   Amborella trichopoda
ref|XP_002892454.1|  endomembrane protein 70 family protein             180   2e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_006364083.1|  PREDICTED: putative phagocytic receptor 1b-like    179   5e-49   Solanum tuberosum [potatoes]
ref|XP_006361076.1|  PREDICTED: putative phagocytic receptor 1b-like    179   6e-49   Solanum tuberosum [potatoes]
ref|XP_009592973.1|  PREDICTED: putative phagocytic receptor 1b         178   1e-48   Nicotiana tomentosiformis
ref|XP_010322438.1|  PREDICTED: putative phagocytic receptor 1b i...    177   1e-48   Solanum lycopersicum
emb|CAN67239.1|  hypothetical protein VITISV_004804                     180   1e-48   Vitis vinifera
gb|KDP33127.1|  hypothetical protein JCGZ_13574                         177   2e-48   Jatropha curcas
ref|XP_002317710.2|  hypothetical protein POPTR_0012s03920g             177   2e-48   
ref|XP_005650990.1|  EMP/nonaspanin domain family protein               177   3e-48   Coccomyxa subellipsoidea C-169
ref|XP_004241321.1|  PREDICTED: putative phagocytic receptor 1b i...    177   3e-48   Solanum lycopersicum
ref|XP_007208295.1|  hypothetical protein PRUPE_ppa003325mg             177   3e-48   
ref|XP_002523798.1|  transporter, putative                              176   3e-48   
ref|XP_009779343.1|  PREDICTED: putative phagocytic receptor 1b         177   3e-48   Nicotiana sylvestris
ref|XP_006376703.1|  hypothetical protein POPTR_0012s03920g             177   3e-48   
ref|XP_010045209.1|  PREDICTED: putative phagocytic receptor 1b         176   5e-48   Eucalyptus grandis [rose gum]
gb|EPS73142.1|  hypothetical protein M569_01612                         176   6e-48   Genlisea aurea
ref|XP_001699211.1|  EMP/nonaspanin domain family protein               176   7e-48   Chlamydomonas reinhardtii
ref|XP_003059958.1|  predicted protein                                  176   8e-48   Micromonas pusilla CCMP1545
emb|CDX95066.1|  BnaC05g06050D                                          175   2e-47   
gb|AAF22904.1|AC006932_21  T27G7.5                                      174   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228600.1|  PREDICTED: putative phagocytic receptor 1b         175   2e-47   Prunus mume [ume]
emb|CDP05443.1|  unnamed protein product                                174   2e-47   Coffea canephora [robusta coffee]
ref|NP_001077489.1|  endomembrane protein 70                            174   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007045412.1|  Endomembrane protein 70 protein family isofo...    171   3e-47   
gb|KHG11801.1|  Putative phagocytic receptor 1b                         174   4e-47   Gossypium arboreum [tree cotton]
ref|XP_008382598.1|  PREDICTED: putative phagocytic receptor 1b         174   4e-47   
emb|CDX93569.1|  BnaA06g04790D                                          174   4e-47   
ref|XP_009148094.1|  PREDICTED: putative phagocytic receptor 1b i...    173   6e-47   Brassica rapa
ref|XP_009148093.1|  PREDICTED: putative phagocytic receptor 1b i...    173   6e-47   Brassica rapa
ref|XP_010488740.1|  PREDICTED: putative phagocytic receptor 1b i...    173   6e-47   
gb|KJB55630.1|  hypothetical protein B456_009G086000                    173   8e-47   Gossypium raimondii
gb|KJB55631.1|  hypothetical protein B456_009G086000                    172   9e-47   Gossypium raimondii
ref|XP_002274254.1|  PREDICTED: transmembrane 9 superfamily member 5    173   1e-46   Vitis vinifera
emb|CBI28324.3|  unnamed protein product                                173   1e-46   Vitis vinifera
ref|XP_009350847.1|  PREDICTED: putative phagocytic receptor 1b         172   1e-46   
ref|XP_009343744.1|  PREDICTED: putative phagocytic receptor 1b         172   1e-46   
ref|XP_010089827.1|  Putative phagocytic receptor 1b                    172   2e-46   Morus notabilis
emb|CDP06928.1|  unnamed protein product                                172   2e-46   Coffea canephora [robusta coffee]
ref|XP_006384818.1|  hypothetical protein POPTR_0004s21340g             172   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010475626.1|  PREDICTED: putative phagocytic receptor 1b i...    172   2e-46   
ref|XP_006487943.1|  PREDICTED: putative phagocytic receptor 1b-l...    171   5e-46   Citrus sinensis [apfelsine]
ref|XP_007512838.1|  predicted protein                                  171   5e-46   Bathycoccus prasinos
ref|XP_002974646.1|  hypothetical protein SELMODRAFT_101645             171   7e-46   
ref|XP_002963357.1|  hypothetical protein SELMODRAFT_166118             171   7e-46   
ref|XP_007015826.1|  Endomembrane protein 70 protein family isofo...    170   1e-45   
ref|XP_004293072.1|  PREDICTED: transmembrane 9 superfamily member 5    170   1e-45   Fragaria vesca subsp. vesca
gb|EEC74833.1|  hypothetical protein OsI_10676                          173   2e-45   Oryza sativa Indica Group [Indian rice]
emb|CEG02174.1|  Nonaspanin (TM9SF)                                     169   2e-45   Ostreococcus tauri
ref|XP_006417702.1|  hypothetical protein EUTSA_v10007170mg             169   2e-45   Eutrema salsugineum [saltwater cress]
gb|EYU26707.1|  hypothetical protein MIMGU_mgv1a002565mg                169   3e-45   Erythranthe guttata [common monkey flower]
dbj|BAC57816.1|  putative syntaxin SYP111                               167   7e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011007160.1|  PREDICTED: transmembrane 9 superfamily member 5    167   8e-45   Populus euphratica
ref|XP_001422764.1|  predicted protein                                  167   9e-45   Ostreococcus lucimarinus CCE9901
ref|XP_006424246.1|  hypothetical protein CICLE_v10028069mg             167   1e-44   Citrus clementina [clementine]
ref|XP_006307081.1|  hypothetical protein CARUB_v10008667mg             167   2e-44   Capsella rubella
gb|KCW64445.1|  hypothetical protein EUGRSUZ_G02063                     166   4e-44   Eucalyptus grandis [rose gum]
gb|KHN21147.1|  Putative phagocytic receptor 1b                         165   5e-44   Glycine soja [wild soybean]
ref|XP_007015827.1|  Endomembrane protein 70 protein family isofo...    165   5e-44   
ref|XP_010066531.1|  PREDICTED: putative phagocytic receptor 1b i...    165   5e-44   
ref|XP_010271661.1|  PREDICTED: putative phagocytic receptor 1b         165   6e-44   
ref|XP_010261665.1|  PREDICTED: putative phagocytic receptor 1b         165   7e-44   
emb|CDY03085.1|  BnaC07g21420D                                          163   2e-43   
ref|XP_002973969.1|  hypothetical protein SELMODRAFT_173941             163   3e-43   
ref|XP_002969094.1|  hypothetical protein SELMODRAFT_170330             163   3e-43   
ref|XP_001783681.1|  predicted protein                                  163   4e-43   
ref|XP_003540797.1|  PREDICTED: putative phagocytic receptor 1b-like    162   6e-43   
ref|XP_005850808.1|  hypothetical protein CHLNCDRAFT_29709              160   4e-42   
ref|XP_007132435.1|  hypothetical protein PHAVU_011G094100g             159   6e-42   
ref|XP_010686009.1|  PREDICTED: transmembrane 9 superfamily membe...    159   7e-42   
gb|KGN64924.1|  hypothetical protein Csa_1G162600                       155   7e-42   
ref|XP_004172236.1|  PREDICTED: LOW QUALITY PROTEIN: putative pha...    154   8e-42   
ref|XP_010322125.1|  PREDICTED: putative phagocytic receptor 1b i...    159   9e-42   
ref|XP_011399711.1|  Putative phagocytic receptor 1b                    159   1e-41   
ref|XP_011088887.1|  PREDICTED: transmembrane 9 superfamily membe...    158   2e-41   
ref|XP_002952428.1|  hypothetical protein VOLCADRAFT_75353              157   3e-41   
emb|CDY56297.1|  BnaC09g52300D                                          157   3e-41   
ref|XP_004506179.1|  PREDICTED: putative phagocytic receptor 1b-like    157   5e-41   
ref|XP_005650801.1|  putative endosomal protein                         156   9e-41   
ref|XP_004139482.1|  PREDICTED: putative phagocytic receptor 1b-like    155   1e-40   
ref|XP_009615619.1|  PREDICTED: putative phagocytic receptor 1b i...    155   2e-40   
ref|XP_009784371.1|  PREDICTED: putative phagocytic receptor 1b i...    154   5e-40   
ref|XP_009784372.1|  PREDICTED: putative phagocytic receptor 1b i...    154   6e-40   
ref|XP_008461493.1|  PREDICTED: putative phagocytic receptor 1b i...    154   7e-40   
ref|XP_009615618.1|  PREDICTED: putative phagocytic receptor 1b i...    153   1e-39   
gb|KIY96549.1|  Putative phagocytic receptor 1b                         151   1e-39   
ref|XP_003606114.1|  Transmembrane 9 superfamily member                 152   2e-39   
gb|EMS68537.1|  Putative phagocytic receptor 1b                         152   3e-39   
gb|KJB60873.1|  hypothetical protein B456_009G329300                    151   5e-39   
ref|XP_001689987.1|  EMP/nonaspanin domain family protein               151   6e-39   
ref|XP_002956625.1|  hypothetical protein VOLCADRAFT_110022             150   2e-38   
ref|XP_009628018.1|  PREDICTED: putative phagocytic receptor 1b i...    147   9e-38   
ref|XP_009782694.1|  PREDICTED: putative phagocytic receptor 1b i...    147   1e-37   
ref|XP_006448062.1|  hypothetical protein CICLE_v10014688mg             146   2e-37   
emb|CDP05453.1|  unnamed protein product                                146   4e-37   
ref|XP_008461519.1|  PREDICTED: putative phagocytic receptor 1b i...    144   1e-36   
gb|KDO42648.1|  hypothetical protein CISIN_1g040008mg                   137   5e-36   
gb|KJB43178.1|  hypothetical protein B456_007G188200                    142   6e-36   
ref|XP_010271660.1|  PREDICTED: putative phagocytic receptor 1b         142   8e-36   
ref|XP_004352299.1|  TM9 protein B                                      144   8e-36   
ref|XP_005824782.1|  hypothetical protein GUITHDRAFT_158562             142   1e-35   
ref|XP_010039016.1|  PREDICTED: putative phagocytic receptor 1b         142   1e-35   
ref|XP_004694659.1|  PREDICTED: transmembrane 9 superfamily member 1    143   2e-35   
ref|XP_007255923.1|  PREDICTED: transmembrane 9 superfamily member 1    139   7e-35   
ref|XP_004698552.1|  PREDICTED: transmembrane 9 superfamily member 1    142   7e-35   
emb|CDQ70386.1|  unnamed protein product                                139   1e-34   
ref|XP_003226712.1|  PREDICTED: transmembrane 9 superfamily member 1    139   1e-34   
ref|XP_010994078.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    140   1e-34   
ref|XP_006172880.1|  PREDICTED: charged multivesicular body prote...    140   1e-34   
ref|XP_787683.3|  PREDICTED: transmembrane 9 superfamily member 1...    137   2e-34   
ref|XP_006217338.1|  PREDICTED: charged multivesicular body prote...    140   2e-34   
ref|XP_005109383.1|  PREDICTED: transmembrane 9 superfamily membe...    138   2e-34   
gb|KFO27482.1|  Importin-4                                              141   2e-34   
ref|XP_010884102.1|  PREDICTED: transmembrane 9 superfamily member 1    138   2e-34   
ref|XP_007536361.1|  PREDICTED: transmembrane 9 superfamily membe...    140   2e-34   
ref|XP_001755694.1|  predicted protein                                  138   2e-34   
ref|XP_003457937.2|  PREDICTED: transmembrane 9 superfamily membe...    138   3e-34   
ref|XP_004584775.1|  PREDICTED: transmembrane 9 superfamily member 1    139   3e-34   
gb|EPY89936.1|  importin-4                                              140   3e-34   
ref|XP_009615620.1|  PREDICTED: putative phagocytic receptor 1b i...    137   4e-34   
ref|XP_002939067.1|  PREDICTED: transmembrane 9 superfamily membe...    137   5e-34   
ref|XP_008267651.1|  PREDICTED: transmembrane 9 superfamily membe...    139   5e-34   
dbj|BAH13215.1|  unnamed protein product                                139   5e-34   
ref|XP_008305730.1|  PREDICTED: transmembrane 9 superfamily member 1    137   6e-34   
ref|XP_004575210.1|  PREDICTED: transmembrane 9 superfamily membe...    137   6e-34   
ref|XP_006809561.1|  PREDICTED: transmembrane 9 superfamily membe...    137   6e-34   
ref|XP_003802004.1|  PREDICTED: transmembrane 9 superfamily member 1    139   6e-34   
ref|XP_006883243.1|  PREDICTED: transmembrane 9 superfamily membe...    139   6e-34   
ref|XP_005754693.1|  PREDICTED: transmembrane 9 superfamily membe...    137   6e-34   
ref|XP_006835458.1|  PREDICTED: charged multivesicular body prote...    139   7e-34   
emb|CBN81815.1|  Transmembrane 9 superfamily member 1                   137   7e-34   
ref|XP_010598840.1|  PREDICTED: transmembrane 9 superfamily membe...    138   1e-33   
gb|ELW69279.1|  Importin-4                                              139   1e-33   
ref|XP_004463432.1|  PREDICTED: transmembrane 9 superfamily membe...    138   1e-33   
ref|XP_005803703.1|  PREDICTED: transmembrane 9 superfamily membe...    136   1e-33   
ref|XP_004609499.1|  PREDICTED: transmembrane 9 superfamily membe...    137   2e-33   
ref|XP_003967994.1|  PREDICTED: transmembrane 9 superfamily membe...    136   2e-33   
gb|ELK11218.1|  Importin-4                                              139   2e-33   
ref|XP_008436895.1|  PREDICTED: transmembrane 9 superfamily member 1    135   3e-33   
ref|XP_007548006.1|  PREDICTED: transmembrane 9 superfamily member 1    135   3e-33   
ref|XP_010739917.1|  PREDICTED: transmembrane 9 superfamily membe...    135   3e-33   
gb|KDO58074.1|  hypothetical protein CISIN_1g036992mg                   134   3e-33   
gb|KCW48636.1|  hypothetical protein EUGRSUZ_K02294                     134   4e-33   
ref|XP_005822074.1|  hypothetical protein GUITHDRAFT_166088             135   4e-33   
ref|XP_005005680.1|  PREDICTED: transmembrane 9 superfamily membe...    135   4e-33   
ref|XP_004081008.1|  PREDICTED: transmembrane 9 superfamily member 1    134   4e-33   
ref|XP_008276179.1|  PREDICTED: transmembrane 9 superfamily member 1    134   5e-33   
ref|XP_008067922.1|  PREDICTED: transmembrane 9 superfamily member 1    134   6e-33   
ref|XP_008838041.1|  PREDICTED: transmembrane 9 superfamily member 1    134   6e-33   
ref|NP_001003550.1|  transmembrane 9 superfamily member 1               134   7e-33   
gb|KDD72720.1|  endomembrane protein 70                                 130   8e-33   
ref|XP_006036573.1|  PREDICTED: transmembrane 9 superfamily membe...    134   8e-33   
gb|EMP30576.1|  Transmembrane 9 superfamily member 1                    134   1e-32   
ref|XP_010636002.1|  PREDICTED: transmembrane 9 superfamily member 1    134   1e-32   
ref|XP_004885399.1|  PREDICTED: transmembrane 9 superfamily membe...    133   1e-32   
ref|XP_010953065.1|  PREDICTED: transmembrane 9 superfamily membe...    134   1e-32   
ref|XP_010953066.1|  PREDICTED: transmembrane 9 superfamily membe...    133   1e-32   
ref|XP_006519680.1|  PREDICTED: transmembrane 9 superfamily membe...    132   2e-32   
dbj|BAF84799.1|  unnamed protein product                                133   2e-32   
gb|EFA76586.1|  TM9 protein B                                           132   2e-32   
ref|XP_006259786.1|  PREDICTED: transmembrane 9 superfamily member 1    133   2e-32   
ref|XP_006519679.1|  PREDICTED: transmembrane 9 superfamily membe...    132   2e-32   
ref|XP_011243511.1|  PREDICTED: transmembrane 9 superfamily membe...    132   3e-32   
ref|XP_004010358.1|  PREDICTED: transmembrane 9 superfamily member 1    132   3e-32   
emb|CAD47840.1|  putative phagocytic receptor 1b                        132   3e-32   
gb|KHN45466.1|  Transmembrane 9 superfamily member 3                    132   3e-32   
ref|XP_642756.1|  TM9 protein B                                         132   3e-32   
gb|AAQ95660.1|  Phg1B                                                   132   3e-32   
ref|XP_006835459.1|  PREDICTED: charged multivesicular body prote...    132   3e-32   
ref|XP_006883244.1|  PREDICTED: transmembrane 9 superfamily membe...    132   3e-32   
ref|XP_537385.2|  PREDICTED: transmembrane 9 superfamily member 1...    132   4e-32   
ref|XP_004661882.1|  PREDICTED: transmembrane 9 superfamily member 1    132   4e-32   
ref|XP_005338783.1|  PREDICTED: transmembrane 9 superfamily membe...    132   4e-32   
ref|XP_002718144.1|  PREDICTED: transmembrane 9 superfamily membe...    132   4e-32   
ref|NP_001012155.1|  transmembrane 9 superfamily member 1 precursor     132   4e-32   
ref|NP_001014842.1|  transmembrane 9 superfamily member 1 isoform...    131   4e-32   
ref|XP_005685277.1|  PREDICTED: transmembrane 9 superfamily membe...    132   4e-32   
ref|XP_005985428.1|  PREDICTED: transmembrane 9 superfamily member 1    132   4e-32   
ref|XP_005904977.1|  PREDICTED: transmembrane 9 superfamily member 1    132   4e-32   
ref|XP_006988599.1|  PREDICTED: transmembrane 9 superfamily membe...    132   4e-32   
ref|NP_001077212.1|  transmembrane 9 superfamily member 1 precursor     132   4e-32   
ref|XP_006252052.1|  PREDICTED: transmembrane 9 superfamily membe...    132   5e-32   
ref|XP_005211436.1|  PREDICTED: transmembrane 9 superfamily membe...    132   5e-32   
ref|XP_006043348.1|  PREDICTED: transmembrane 9 superfamily member 1    132   5e-32   
ref|XP_004055037.1|  PREDICTED: transmembrane 9 superfamily membe...    132   5e-32   
gb|ERE89416.1|  transmembrane 9 superfamily member 1 isoform 2          132   5e-32   
ref|XP_004421247.1|  PREDICTED: transmembrane 9 superfamily membe...    132   5e-32   
ref|XP_003421009.1|  PREDICTED: transmembrane 9 superfamily membe...    132   5e-32   
ref|XP_008959494.1|  PREDICTED: transmembrane 9 superfamily membe...    131   5e-32   
ref|NP_001126136.1|  transmembrane 9 superfamily member 1 precursor     132   5e-32   
gb|AAC51782.1|  multispanning membrane protein                          132   6e-32   
ref|XP_003502106.1|  PREDICTED: transmembrane 9 superfamily member 1    132   6e-32   
ref|XP_007130114.1|  PREDICTED: transmembrane 9 superfamily membe...    131   6e-32   
ref|XP_007098088.1|  PREDICTED: transmembrane 9 superfamily membe...    131   6e-32   
ref|XP_011281457.1|  PREDICTED: transmembrane 9 superfamily member 1    131   6e-32   
ref|XP_007984497.1|  PREDICTED: transmembrane 9 superfamily membe...    131   6e-32   
ref|XP_007130113.1|  PREDICTED: transmembrane 9 superfamily membe...    131   6e-32   
ref|XP_007180676.1|  PREDICTED: transmembrane 9 superfamily membe...    131   6e-32   
ref|NP_001253390.1|  transmembrane 9 superfamily member 1 precursor     131   6e-32   
ref|XP_006144613.1|  PREDICTED: transmembrane 9 superfamily membe...    131   6e-32   
gb|EKC28088.1|  Transmembrane 9 superfamily member 1                    131   6e-32   
ref|XP_004283185.1|  PREDICTED: transmembrane 9 superfamily member 1    131   6e-32   
ref|XP_008707016.1|  PREDICTED: transmembrane 9 superfamily member 1    131   6e-32   
ref|NP_006396.2|  transmembrane 9 superfamily member 1 isoform a ...    131   6e-32   
ref|XP_003260724.1|  PREDICTED: transmembrane 9 superfamily member 1    131   6e-32   
ref|XP_010333315.1|  PREDICTED: transmembrane 9 superfamily member 1    131   7e-32   
ref|XP_007130112.1|  PREDICTED: transmembrane 9 superfamily membe...    132   7e-32   
ref|XP_009004051.1|  PREDICTED: transmembrane 9 superfamily member 1    131   7e-32   
gb|AAF98161.1|AF269152_1  transmembrane protein TM9SF1                  131   7e-32   
ref|XP_004402104.1|  PREDICTED: transmembrane 9 superfamily membe...    132   7e-32   
ref|NP_001267415.1|  transmembrane 9 superfamily member 1 precursor     131   7e-32   
ref|XP_008570550.1|  PREDICTED: transmembrane 9 superfamily member 1    131   7e-32   
ref|XP_007447942.1|  PREDICTED: transmembrane 9 superfamily membe...    131   7e-32   
ref|XP_004463434.1|  PREDICTED: transmembrane 9 superfamily membe...    130   7e-32   
ref|NP_083056.2|  transmembrane 9 superfamily member 1 precursor        131   7e-32   
ref|XP_007180675.1|  PREDICTED: transmembrane 9 superfamily membe...    132   7e-32   
ref|XP_004402105.1|  PREDICTED: transmembrane 9 superfamily membe...    131   7e-32   
ref|XP_005377087.1|  PREDICTED: transmembrane 9 superfamily member 1    131   8e-32   
ref|XP_003755940.1|  PREDICTED: transmembrane 9 superfamily member 1    131   8e-32   
ref|XP_004647518.1|  PREDICTED: transmembrane 9 superfamily member 1    131   8e-32   
ref|XP_007447941.1|  PREDICTED: transmembrane 9 superfamily membe...    131   8e-32   
dbj|BAJ87519.1|  predicted protein                                      131   9e-32   
ref|XP_006913615.1|  PREDICTED: transmembrane 9 superfamily member 1    131   9e-32   
ref|XP_004463433.1|  PREDICTED: transmembrane 9 superfamily membe...    131   9e-32   
ref|XP_011420426.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    131   1e-31   
ref|XP_010105528.1|  Putative phagocytic receptor 1b                    132   1e-31   
ref|XP_006739631.1|  PREDICTED: transmembrane 9 superfamily membe...    130   1e-31   
ref|XP_001380199.1|  PREDICTED: transmembrane 9 superfamily membe...    131   1e-31   
ref|XP_002921119.1|  PREDICTED: transmembrane 9 superfamily member 1    131   1e-31   
ref|XP_001490063.1|  PREDICTED: transmembrane 9 superfamily member 1    131   1e-31   
ref|XP_005859645.1|  PREDICTED: transmembrane 9 superfamily membe...    130   1e-31   
ref|XP_008156681.1|  PREDICTED: transmembrane 9 superfamily membe...    130   1e-31   
ref|XP_006102307.1|  PREDICTED: transmembrane 9 superfamily membe...    130   1e-31   
ref|XP_005370493.1|  PREDICTED: transmembrane 9 superfamily membe...    130   1e-31   
ref|XP_003540158.1|  PREDICTED: transmembrane 9 superfamily membe...    130   1e-31   
ref|XP_004390569.1|  PREDICTED: transmembrane 9 superfamily member 1    130   1e-31   
ref|XP_004609500.1|  PREDICTED: transmembrane 9 superfamily membe...    130   2e-31   
ref|XP_006739629.1|  PREDICTED: transmembrane 9 superfamily membe...    130   2e-31   
ref|XP_007947407.1|  PREDICTED: transmembrane 9 superfamily membe...    130   2e-31   
gb|KHN11244.1|  Transmembrane 9 superfamily member 3                    130   2e-31   
gb|ELK32462.1|  Importin-4                                              132   2e-31   
ref|XP_004755298.1|  PREDICTED: transmembrane 9 superfamily membe...    130   2e-31   
gb|KDD75073.1|  endomembrane protein 70                                 129   3e-31   
ref|XP_003532994.1|  PREDICTED: transmembrane 9 superfamily membe...    129   3e-31   
ref|XP_010238659.1|  PREDICTED: transmembrane 9 superfamily membe...    129   4e-31   
ref|XP_004335868.1|  endomembrane protein EMP70 precursor isolog,...    129   5e-31   
ref|XP_002597092.1|  hypothetical protein BRAFLDRAFT_105034             130   5e-31   
ref|XP_003474483.1|  PREDICTED: transmembrane 9 superfamily membe...    129   5e-31   
ref|XP_003294418.1|  hypothetical protein DICPUDRAFT_59030              129   6e-31   
ref|XP_005085662.1|  PREDICTED: transmembrane 9 superfamily member 1    129   7e-31   
ref|XP_010779259.1|  PREDICTED: transmembrane 9 superfamily member 1    128   1e-30   
gb|EWM22128.1|  transmembrane 9 superfamily member 3                    128   1e-30   
ref|XP_009043140.1|  hypothetical protein AURANDRAFT_72882              124   1e-30   
dbj|GAM27660.1|  hypothetical protein SAMD00019534_108360               127   2e-30   
ref|XP_006779604.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    126   3e-30   
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...    127   3e-30   
dbj|BAG99652.1|  unnamed protein product                                123   3e-30   
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...    127   3e-30   
ref|XP_003629959.1|  Transmembrane 9 superfamily protein member         126   5e-30   
ref|XP_003592976.1|  Transmembrane 9 superfamily protein member         125   8e-30   
ref|XP_007148532.1|  hypothetical protein PHAVU_006G216500g             125   1e-29   
tpg|DAA55531.1|  TPA: hypothetical protein ZEAMMB73_446969              125   1e-29   
ref|XP_002442907.1|  hypothetical protein SORBIDRAFT_08g004730          124   2e-29   
ref|XP_002167759.2|  PREDICTED: transmembrane 9 superfamily membe...    124   2e-29   
dbj|BAJ96423.1|  predicted protein                                      124   2e-29   
dbj|BAJ86318.1|  predicted protein                                      124   3e-29   
gb|AGE46034.1|  putative transmembrane 9 superfamily member 3 pro...    124   3e-29   
ref|XP_001785045.1|  predicted protein                                  124   3e-29   
ref|XP_008662281.1|  PREDICTED: uncharacterized protein LOC100501...    124   4e-29   
ref|XP_010910845.1|  PREDICTED: transmembrane 9 superfamily membe...    124   4e-29   
ref|XP_008807671.1|  PREDICTED: transmembrane 9 superfamily membe...    124   4e-29   
ref|XP_011407645.1|  PREDICTED: transmembrane 9 superfamily membe...    122   4e-29   
ref|XP_002401275.1|  endosomal membrane protein EMP70, putative         123   5e-29   
ref|XP_002449107.1|  hypothetical protein SORBIDRAFT_05g005240          123   5e-29   
ref|NP_001066292.1|  Os12g0175700                                       123   6e-29   
ref|XP_010665394.1|  PREDICTED: transmembrane 9 superfamily member 1    124   6e-29   
ref|NP_001065897.1|  Os11g0181100                                       123   7e-29   
ref|XP_009390763.1|  PREDICTED: transmembrane 9 superfamily membe...    122   9e-29   
emb|CDO97576.1|  unnamed protein product                                122   1e-28   



>ref|XP_011099916.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099917.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099918.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099919.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
Length=592

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDH+YK GD V LYANKVGPFHNPSETY Y DLPFCSP +V+ KSEALGEVLNGDR
Sbjct  23   RSDASDHKYKIGDAVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKDKSEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DKESEV+CKKKLS  +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLDFLVDKESEVICKKKLSVKEVAEFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHLHFEIFY
Sbjct  143  EGKTDPSEYKYYLFKHLHFEIFY  165



>gb|EYU30878.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
 gb|EYU30879.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
Length=592

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD V LYANKVGPFHNPSETY Y DLPFCSP +V+ KSEALGEVLNGDR
Sbjct  23   RSDGSDHKYKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKDKSEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFLAD+ESEV+CKK+LSK +V  FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLDFLADRESEVICKKQLSKEEVAVFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHLHFEIFY
Sbjct  143  EGKADPSEYKYYLFKHLHFEIFY  165



>gb|EYU30892.1| hypothetical protein MIMGU_mgv1a003326mg [Erythranthe guttata]
Length=592

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDH++K GD V LYANKVGPFHNPSETY Y DLPFCSP NV+ KSEALGEVLNGDR
Sbjct  23   RSDASDHKFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGNVKDKSEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFLADKESEV+CKK LSK +V  FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLDFLADKESEVICKKHLSKEEVAVFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+LFKHLHFEIFY
Sbjct  143  EGKADPSEYKYHLFKHLHFEIFY  165



>ref|XP_004239834.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=597

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD+V +YANKVGPFHNPSETY + DLPFC+PA+V +K EALGEVLNGDR
Sbjct  28   RSDGSDHKYKAGDQVTMYANKVGPFHNPSETYRFFDLPFCAPAHVTEKKEALGEVLNGDR  87

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DK+SE+VCKKKLSK +V  FR+AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  88   LVSAPYKLDFMYDKDSEIVCKKKLSKEEVSLFRNAVAKDYYFQMYYDDLPIWGFLGKVDK  147

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHLHFEIFY
Sbjct  148  EGKTDPSEYKYYLFKHLHFEIFY  170



>ref|XP_009602054.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=594

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD V LYANKVGPFHNPSETY + DLPFC+PA+V++K EALGEVLNGDR
Sbjct  25   RSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCAPAHVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  85   LVSAPYKLDFMYDKDSEIVCKKKLSKEEVAQFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGKSDPSEYKYYLFKHLHFEIFY
Sbjct  145  EGKSDPSEYKYYLFKHLHFEIFY  167



>ref|XP_004236681.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=598

 Score =   248 bits (633),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD+V LYANKVGPFHNPSETY + DLPFC+P +V++K EALGEVLNGDR
Sbjct  29   RSDGSDHKYKSGDQVPLYANKVGPFHNPSETYRFFDLPFCTPDHVKEKKEALGEVLNGDR  88

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  89   LVSAPYKLDFLYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  148

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGKSDPSEYKYYLFKHLHFEIFY
Sbjct  149  EGKSDPSEYKYYLFKHLHFEIFY  171



>ref|XP_006346764.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=598

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD+V LYANKVGPFHNPSETY + DLPFC+P +V++K EALGEVLNGDR
Sbjct  29   RSDGSDHKYKSGDQVPLYANKVGPFHNPSETYRFFDLPFCTPDHVKEKKEALGEVLNGDR  88

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  89   LVSAPYKLDFLYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  148

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGKSDPSEYKYYLFKHLHFEIFY
Sbjct  149  EGKSDPSEYKYYLFKHLHFEIFY  171



>ref|XP_006365862.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=588

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD+V +YANKVGPFHNPSETY + DLPFC+PA+V +K EALGEVLNGDR
Sbjct  19   RSDGSDHKYKAGDQVTMYANKVGPFHNPSETYRFFDLPFCAPAHVTEKKEALGEVLNGDR  78

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  79   LVSAPYKLDFMYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  138

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPS+YKYYLFKHLHFEIFY
Sbjct  139  EGKTDPSKYKYYLFKHLHFEIFY  161



>ref|XP_009775043.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  138  MDRRRAMRHYavvlavlllgtatevvRSDASDHRYKQGDEVHLYANKVGPFHNPSETYMY  317
            M+++R M  Y VVL ++   +     RSD SDH+YK GD V LYANKVGPFHNPSETY +
Sbjct  1    MEKKRTMAWYVVVLLIVSCASPV---RSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRF  57

Query  318  HDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRH  497
             DLPFC+P +V++K EALGEVLNGDRLV + YKLDF+ DK+SE+VCKKKLSK +V +FR 
Sbjct  58   FDLPFCAPDHVKEKKEALGEVLNGDRLVSAPYKLDFMYDKDSEIVCKKKLSKEEVAQFRS  117

Query  498  AVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFY  644
            AVA+DYYFQMYYDDLP+WG++GKVDKEGKSDPSEYKYYLFKHLHFEIFY
Sbjct  118  AVAKDYYFQMYYDDLPIWGFLGKVDKEGKSDPSEYKYYLFKHLHFEIFY  166



>gb|EPS59962.1| hypothetical protein M569_14842, partial [Genlisea aurea]
Length=510

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRY QGD V LYANKVGPFHNPSETY Y DLPFCSP +V+ KSEALGEVLNGDR
Sbjct  13   RSDASNHRYNQGDTVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKDKSEALGEVLNGDR  72

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL D+ESEV+CKKKLSK++V  FR+AVA+DYYFQMYYDDLP+WG++GKV K
Sbjct  73   LVSAPYKLDFLVDRESEVICKKKLSKTEVTVFRNAVAKDYYFQMYYDDLPIWGFLGKVYK  132

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E K+DPS+YKYYLFKHLHFEI Y
Sbjct  133  EDKTDPSDYKYYLFKHLHFEISY  155



>ref|XP_009774478.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD V LYANKVGPFHNPSETY + DLPFC+PA+ ++K EALGEVLNGDR
Sbjct  24   RSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCAPAHAKEKKEALGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  84   LVSAPYKLDFMYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +GKSDPSEYKYYLFKHLHFEIFY
Sbjct  144  DGKSDPSEYKYYLFKHLHFEIFY  166



>ref|XP_009785097.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=596

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DLPFCSP +V+ K+EALGEVLNGDR
Sbjct  27   RSDSSDHKYKNGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGDR  86

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL+D+E+EVVCKK LSK +V +FR AVA+DYYFQM+YDDLP+WG+IGKVDK
Sbjct  87   LVTAPYKLDFLSDRETEVVCKKSLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVDK  146

Query  576  EGKSDPSEYKYYLFKHLHFEI  638
            EGKSDP+EYKYYLFKHLHF+I
Sbjct  147  EGKSDPNEYKYYLFKHLHFDI  167



>ref|XP_010276303.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP +V +K EALGEVLNGDR
Sbjct  23   RSDASDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGHVTEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL+DK+SE+VC+KKL+K +V +FR AV++DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLDFLSDKDSELVCRKKLTKEEVAQFRKAVSKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+HF+I Y
Sbjct  143  EGKADPSEYKYFLYKHIHFDILY  165



>ref|XP_010244840.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
 ref|XP_010244916.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSPA+V +K EALGEVLNGDR
Sbjct  23   RSDASDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCSPAHVTEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL++K+SE+VCKKKLS  +V +FR AV  DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLDFLSEKDSELVCKKKLSTGEVAQFRKAVINDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+HF+I Y
Sbjct  143  EGKTDPSEYKYFLYKHIHFDILY  165



>ref|XP_009616336.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=593

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD V LYANKVGPFHNPSETY + DLPFC+PA+V++K EALGEVLNGDR
Sbjct  24   RSDGSDHKYKAGDSVPLYANKVGPFHNPSETYRFFDLPFCAPAHVKEKKEALGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKV K
Sbjct  84   LVSAPYKLDFMYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKVGK  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +GKSDP EYKYYLFKHLHFEIFY
Sbjct  144  DGKSDPIEYKYYLFKHLHFEIFY  166



>ref|XP_004250237.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
 ref|XP_010312729.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=596

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DLPFCSP +V+ K+EALGEVLNGDR
Sbjct  27   RSDSSDHKYKSGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGDR  86

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  D+E+EVVCKK LSK +V +FR AVA+DYYFQM+YDDLP+WG+IGKVDK
Sbjct  87   LVTAPYKLDFTNDRETEVVCKKTLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVDK  146

Query  576  EGKSDPSEYKYYLFKHLHFEI  638
            EGK+DPSEYKYYLFKHLHF+I
Sbjct  147  EGKADPSEYKYYLFKHLHFDI  167



>ref|XP_006352389.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006352390.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Solanum 
tuberosum]
Length=596

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DLPFCSP +V+ K+EALGEVLNGDR
Sbjct  27   RSDSSDHKYKSGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGDR  86

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  D+E+EVVCKK LSK +V +FR AVA+DYYFQM+YDDLP+WG+IGKVDK
Sbjct  87   LVTAPYKLDFTNDRETEVVCKKTLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVDK  146

Query  576  EGKSDPSEYKYYLFKHLHFEI  638
            EGK+DPSEYKYYLFKHLHF+I
Sbjct  147  EGKADPSEYKYYLFKHLHFDI  167



>ref|XP_009631354.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
 ref|XP_009631355.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=596

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DLPFCSP +V+ K+EALGEVLNGDR
Sbjct  27   RSDSSDHKYKNGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGDR  86

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL+D+E+EVVCKK LSK +V +FR AVA+DYYFQM+YDDLP+WG+IGKVDK
Sbjct  87   LVTAPYKLDFLSDRETEVVCKKSLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVDK  146

Query  576  EGKSDPSEYKYYLFKHLHFEI  638
            E KSDP+EYKYYLFKHLHF+I
Sbjct  147  ERKSDPNEYKYYLFKHLHFDI  167



>ref|XP_010069472.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW57835.1| hypothetical protein EUGRSUZ_H00588 [Eucalyptus grandis]
Length=590

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK GD V LYANKVGPFHNPSETY Y DLPFC PA++++K EALGEVLNGDR
Sbjct  22   RSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCIPAHLKEKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DKESEV+CKKKLSK +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYKLDFMKDKESEVICKKKLSKEEVAQFRSAVIKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPSEYKY+L+KH+HF+IFY
Sbjct  142  EGK-DPSEYKYFLYKHIHFDIFY  163



>ref|XP_010691703.1| PREDICTED: transmembrane 9 superfamily member 2 [Beta vulgaris 
subsp. vulgaris]
Length=592

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G+ V LYANKVGPFHNPSETY Y DLPFC+P +V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCAPDHVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE++CKKK+SK +V KFR AV++DYYFQMYYDDLP+WG++GK DK
Sbjct  83   LVSAPYKLDFLVDKDSELICKKKMSKEEVVKFRDAVSKDYYFQMYYDDLPIWGFLGKADK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPSEYK+YL+KH+HF+IFY
Sbjct  143  EGKLDPSEYKFYLYKHIHFDIFY  165



>ref|XP_011011376.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=542

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD+V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SEV CK  L+K  V +FR AV++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEVACKNTLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHLHF IFY
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFY  165



>ref|XP_007031333.1| Endomembrane protein 70 protein family [Theobroma cacao]
 gb|EOY02259.1| Endomembrane protein 70 protein family [Theobroma cacao]
Length=561

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK G EV LYANKVGPFHNPSETY Y D PFCS   V++K+EALGEVLNGDR
Sbjct  23   RSSASDHRYKAGAEVPLYANKVGPFHNPSETYRYFDFPFCSSTPVKEKNEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DKE+E+ CKKKL+K +V KFR AV++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLDFLNDKEAEIACKKKLTKEEVAKFRSAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPSEYKYYLFKHL FEI Y
Sbjct  143  EGKVDPSEYKYYLFKHLIFEILY  165



>gb|AAF79216.1|AC006917_1 F10B6.2 [Arabidopsis thaliana]
Length=260

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C KKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILY  165



>gb|KHG03505.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRY  GDEV LYANKVGPFHNPSETY + D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSSASDHRYTAGDEVPLYANKVGPFHNPSETYRFFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+LDFL +KE+EV CK+KL+K +V KFR AV++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYRLDFLGNKEAEVACKRKLTKEEVAKFRTAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHL FEI Y
Sbjct  143  EGKADPSEYKYYLFKHLIFEILY  165



>ref|XP_011038406.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=592

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD+V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SEV CK  L+K  V +FR AV++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEVACKNTLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHLHF IFY
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFY  165



>ref|XP_002285238.1| PREDICTED: transmembrane 9 superfamily member 2 [Vitis vinifera]
 emb|CBI26762.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS HRYK G+ V LYANKVGPFHNPSETY Y DLPFC PA++++K EALGEVLNGDR
Sbjct  22   RSDASSHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCVPAHLKEKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL +K+SEVVCKKKL K +V +FR AVA+DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYKLDFLREKDSEVVCKKKLKKEEVAQFRAAVAKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ F+I Y
Sbjct  142  EGKADPSEYKYFLYKHIQFDIRY  164



>emb|CDP01680.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDH+YK  D+V LYANKVGPFHNPSETY Y DLPFC PA V++K EALGEVLNGDR
Sbjct  25   RSDASDHKYKVSDQVPLYANKVGPFHNPSETYRYFDLPFCLPAQVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y L+FL DKESEVVCKKKLSK +V +FR+AV++DYYF+MYYDDLP+WG++GKV+K
Sbjct  85   LVVAPYNLEFLHDKESEVVCKKKLSKEEVAQFRNAVSKDYYFEMYYDDLPLWGFLGKVEK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
             GK+DPSEYKYYLFK++HFEI Y
Sbjct  145  TGKTDPSEYKYYLFKNIHFEILY  167



>ref|XP_002870515.1| transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46774.1| transporter [Arabidopsis lyrata subsp. lyrata]
Length=593

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  25   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL +K SEV C+K+LS+ DV KFR  +A+DYYFQMYYDDLP+WG++GKV KE
Sbjct  85   VSAPYKLEFLGEKNSEVACRKRLSREDVAKFRDVIAKDYYFQMYYDDLPIWGFLGKVFKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+DPSEYKYYLF HL FEIFY
Sbjct  145  GKTDPSEYKYYLFNHLQFEIFY  166



>ref|NP_198547.3| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9FHT4.1|TMN4_ARATH RecName: Full=Transmembrane 9 superfamily member 4; AltName: 
Full=Endomembrane protein 10; AltName: Full=Transmembrane nine 
protein 4; Short=AtTMN4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09103.1| endosomal protein-like [Arabidopsis thaliana]
 dbj|BAE99006.1| multispanning membrane protein - like [Arabidopsis thaliana]
 gb|AED94164.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=593

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  25   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL +K SEV C+K+LS+ DV KFR  +A+DYYFQMYYDDLP+WG++GKV KE
Sbjct  85   VSAPYKLEFLGEKNSEVACRKRLSREDVAKFRDVIAKDYYFQMYYDDLPIWGFLGKVVKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+DPSEYKYYLF HL FEIFY
Sbjct  145  GKTDPSEYKYYLFNHLQFEIFY  166



>ref|XP_011038404.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
 ref|XP_011038405.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
Length=592

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G++V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ C+K+L+K  V +FR  V++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEIACRKRLTKEQVAQFREVVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHLHF IFY
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFY  165



>emb|CDY52038.1| BnaA08g31510D [Brassica napus]
Length=480

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSEYKY+L+KH+ FEI Y
Sbjct  140  EIKSDPSEYKYFLYKHIEFEILY  162



>gb|KJB15311.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=540

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFREEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYL+KH+ F++ Y
Sbjct  145  EGKADPSEYKYYLYKHIQFDVLY  167



>ref|XP_010691704.1| PREDICTED: transmembrane 9 superfamily member 3-like [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G+ V LYANKVGPFHNPSETY Y DLPFC P +V++K EALGEVLNGDR
Sbjct  24   RSDASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCIPDHVKEKREALGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE +CKK L K +  KFR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  84   LVSAPYKLDFLVDKDSEAICKKTLKKEEAAKFRDAVAKDYYFQMYYDDLPIWGFLGKVDK  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPS+YKYYL+KH+HF+++Y
Sbjct  144  EGKLDPSDYKYYLYKHIHFDVYY  166



>ref|XP_011005915.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005916.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   233 bits (593),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRYK GD V LY NKVGPFHNPSETY Y DLPFCS    + K EALGE+LNGDR
Sbjct  23   RSDASNHRYKVGDGVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ CK KL+K  V +FR AV++DYYFQMYYDDLP+WG+IGKV+K
Sbjct  83   LVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFIGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHLHF IFY
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFY  165



>ref|XP_004150159.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
Length=654

 Score =   234 bits (596),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 102/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            DAS+HRY +GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDRLV
Sbjct  87   DASNHRYSEGDSVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKEKKEALGEVLNGDRLV  146

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  +K++EV CK KLSK +V +FR AV +DYYFQMYYDDLP+WG+IGKVD+EG
Sbjct  147  SAPYKLDFKREKDTEVACKSKLSKKEVAQFRAAVKKDYYFQMYYDDLPIWGFIGKVDREG  206

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
            + DPSEYKY+LFKH+ F+I Y
Sbjct  207  RDDPSEYKYFLFKHIQFDISY  227



>ref|XP_010554368.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=592

 Score =   233 bits (593),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C+KKLSK DV++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFGEEKDSEVYCRKKLSKDDVKQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSE+KY+L+KH+ FEI Y
Sbjct  143  EGKADPSEFKYFLYKHIQFEILY  165



>gb|KJB15313.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=560

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFREEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYL+KH+ F++ Y
Sbjct  145  EGKADPSEYKYYLYKHIQFDVLY  167



>ref|XP_006372422.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP50219.1| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   233 bits (593),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD+V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SEV CK  L+K  V +FR AV++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEVACKNTLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E K+DPSEYKYYLFKHLHF IFY
Sbjct  143  ERKNDPSEYKYYLFKHLHFTIFY  165



>ref|XP_006372420.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50217.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=526

 Score =   231 bits (588),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G++V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ C+K+L+K  V +FR  V++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEIACRKRLTKEQVAQFREVVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E K+DPSEYKYYLFKHLHF IFY
Sbjct  143  ERKNDPSEYKYYLFKHLHFTIFY  165



>ref|XP_009110524.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSEYKY+L+KH+ FEI Y
Sbjct  140  EIKSDPSEYKYFLYKHIEFEILY  162



>emb|CDY52035.1| BnaA08g31480D [Brassica napus]
Length=589

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSEYKY+L+KH+ FEI Y
Sbjct  140  EIKSDPSEYKYFLYKHIEFEILY  162



>gb|KJB15310.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
 gb|KJB15312.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=594

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFREEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYL+KH+ F++ Y
Sbjct  145  EGKADPSEYKYYLYKHIQFDVLY  167



>ref|XP_006405901.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 ref|XP_006405902.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47354.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47355.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
Length=595

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  27   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  86

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL +K SEV C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  87   VSAPYKLEFLGEKNSEVACRKRLSREDVAKFRDVITKDYYFQMYYDDLPIWGFLGKVVKD  146

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GKSDPSEYKYYLF HL FEIFY
Sbjct  147  GKSDPSEYKYYLFNHLQFEIFY  168



>ref|XP_010528590.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=595

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRY+ GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDR
Sbjct  26   RSDGSDHRYRAGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDR  85

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL DK+SEV CKK+L++ +V +FR A+++DYYFQMYYDDLP+WG++GKVD+
Sbjct  86   LVSAPYKLEFLGDKDSEVACKKRLNREEVSQFREAISKDYYFQMYYDDLPIWGFLGKVDR  145

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E K++PSEY+YYLF HL FEIFY
Sbjct  146  ERKTNPSEYRYYLFNHLQFEIFY  168



>ref|XP_010527833.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=593

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  24   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C KKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  84   LVSAPYKLNFREEKDSEVYCSKKLSKDEVKQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSE+KY+L+KH+ FEI Y
Sbjct  144  EGKADPSEFKYFLYKHIQFEILY  166



>ref|XP_006416990.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
 gb|ESQ35343.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
Length=592

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV CKKKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCKKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + KSDPSEYKY+L+KH+ FEI Y
Sbjct  143  DIKSDPSEYKYFLYKHIQFEILY  165



>ref|XP_006384123.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
 gb|ERP61920.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
Length=592

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS +RYK GD+V LY NKVGPFHNPSETY Y DLPFCS    + K EALGE+LNGDR
Sbjct  23   RSDASTNRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ CK KL+K  V +FR AV++DYYFQMYYDDLP+WG+IGKV+K
Sbjct  83   LVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFIGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHLHF IFY
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFY  165



>gb|KJB08471.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=531

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL +KE+E+ CK+KL+K +V KFR AV++DYYFQMYYDDLP+WG++GKV+K
Sbjct  83   LVSAPYKLEFLTEKEAEIACKRKLTKEEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEI  638
            EGK+DP++YKYYLFKHL FEI
Sbjct  143  EGKTDPADYKYYLFKHLVFEI  163



>ref|XP_006395825.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
 gb|ACQ90591.1| putative transmembrane transporter [Eutrema halophilum]
 gb|ESQ33111.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
Length=592

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SE+ CKKKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEIYCKKKLSREEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILY  165



>gb|KFK43715.1| hypothetical protein AALP_AA1G163400 [Arabis alpina]
Length=592

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEADNVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C+KKLSK DV++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCRKKLSKEDVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSEYKY+L+KH+ FEI Y
Sbjct  143  EIKSDPSEYKYFLYKHIQFEILY  165



>gb|KHG00678.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=528

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP +V +K EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCSPDHVTEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKK+LSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFKEEKDSSVVCKKQLSKDEVAFFRKAVDKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+LFKH+ F++ Y
Sbjct  145  EGKTDPSEYKYFLFKHIQFDVLY  167



>ref|XP_006372421.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50218.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=592

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G++V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ C+K+L+K  V +FR  V++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEIACRKRLTKEQVAQFREVVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E K+DPSEYKYYLFKHLHF IFY
Sbjct  143  ERKNDPSEYKYYLFKHLHFTIFY  165



>gb|KHG04463.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=629

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDR
Sbjct  60   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGDR  119

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  120  LVSAPYKLNFKEEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  179

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYL+KH+ F++ Y
Sbjct  180  EGKADPSEYKYYLYKHIQFDVLY  202



>emb|CDX84018.1| BnaC08g16270D [Brassica napus]
Length=589

 Score =   229 bits (585),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EA GEVLNGDR
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEAFGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V+KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFRDEKDSEVYCKKKLSKEEVKKFRQAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSEYKY+L+KH+ FEI Y
Sbjct  140  EIKSDPSEYKYFLYKHIEFEILY  162



>ref|XP_011005913.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005914.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   229 bits (585),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASD+RYK G++V LY NKVGPFHNPSETY Y DLPFCS    + K EALGE+LNGDR
Sbjct  23   RSDASDNRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ CK KL+K  V +FR A+++D+YFQMYYDDLP+WG+IGKV+K
Sbjct  83   LVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAISKDFYFQMYYDDLPIWGFIGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHLHF IFY
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFY  165



>emb|CDY62621.1| BnaC08g46810D [Brassica napus]
Length=592

 Score =   229 bits (585),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  24   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL +K S+V C+K+LS+ DV +FR  +++DYYFQMYYDDLP+WG++GKV K+
Sbjct  84   VTAPYKLEFLGEKNSQVACRKRLSREDVAQFRDVISKDYYFQMYYDDLPIWGFLGKVVKD  143

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GKSDPSEYKYYLF HL FEIFY
Sbjct  144  GKSDPSEYKYYLFNHLQFEIFY  165



>gb|KJB60875.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=549

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP +V +K EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCSPDHVTEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKL K +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFKEEKDSSVVCKKKLLKDEVAFFRKAVDKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+LFKH+ F++ Y
Sbjct  145  EGKTDPSEYKYFLFKHIQFDVLY  167



>ref|NP_178306.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9ZPS7.1|TMN3_ARATH RecName: Full=Transmembrane 9 superfamily member 3; AltName: 
Full=Endomembrane protein 9; AltName: Full=Transmembrane nine 
protein 3; Short=AtTMN3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD20090.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AAL24256.1| At2g01970/F14H20.4 [Arabidopsis thaliana]
 dbj|BAE98629.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AEC05528.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLS+ +VE FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCKKKLSREEVEHFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_008461818.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Cucumis 
melo]
Length=591

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P +V++K EALGEVLNGDR
Sbjct  23   RSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL +K+S  VC+KKLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLDFLQEKDSSSVCQKKLSKEDVARFRAAVDKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPS++KYYL+KH+HF+IFY
Sbjct  143  EGK-DPSDFKYYLYKHIHFDIFY  164



>gb|AAF63170.1|AC010657_6 T5E21.15 [Arabidopsis thaliana]
Length=546

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C KKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_011085893.1| PREDICTED: transmembrane 9 superfamily member 2-like [Sesamum 
indicum]
Length=587

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            SDH +K GD V LYANKVGPFHNPSETY Y DLPFC PA++++K EALGEVLNGDRLV +
Sbjct  22   SDHTFKAGDPVPLYANKVGPFHNPSETYRYFDLPFCFPAHMKEKKEALGEVLNGDRLVSA  81

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
             Y LDFL DK SEVVC KKL K++V +FR AVA+DYYFQMY+DDLP+WG++GKV+KE KS
Sbjct  82   PYTLDFLQDKSSEVVCNKKLDKNEVAQFRSAVAKDYYFQMYFDDLPIWGFLGKVEKEEKS  141

Query  588  DPSEYKYYLFKHLHFEIFY  644
            DPSEYKYYLFKHLHFEIFY
Sbjct  142  DPSEYKYYLFKHLHFEIFY  160



>gb|KJB08470.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL +KE+E+ CK+KL+K +V KFR AV++DYYFQMYYDDLP+WG++GKV+K
Sbjct  83   LVSAPYKLEFLTEKEAEIACKRKLTKEEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEI  638
            EGK+DP++YKYYLFKHL FEI
Sbjct  143  EGKTDPADYKYYLFKHLVFEI  163



>ref|XP_004137376.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 ref|XP_004171887.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 gb|KGN63933.1| hypothetical protein Csa_1G029600 [Cucumis sativus]
Length=591

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P +V++K EALGEVLNGDR
Sbjct  23   RSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVKEKREALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL +K+S  VC+KKLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLDFLQEKDSSSVCQKKLSKEDVGRFRAAVDKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPS++KYYL+KH+HF+IFY
Sbjct  143  EGK-DPSDFKYYLYKHIHFDIFY  164



>gb|KJB08472.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL +KE+E+ CK+KL+K +V KFR AV++DYYFQMYYDDLP+WG++GKV+K
Sbjct  83   LVSAPYKLEFLTEKEAEIACKRKLTKEEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEI  638
            EGK+DP++YKYYLFKHL FEI
Sbjct  143  EGKTDPADYKYYLFKHLVFEI  163



>emb|CDP01681.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDASDH YK  D+V LYANKVGPF NPSETY + DLPFCSPA+V++K EALGEVLNGDR
Sbjct  23   KSDASDHTYKPKDQVPLYANKVGPFQNPSETYRFFDLPFCSPAHVKEKREALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL DK+SE+VCKK+L+K DV +FR AVA+DYYF+MYYDDLPVWG++G+V+K
Sbjct  83   LVSAPYKLEFLVDKDSELVCKKQLTKDDVAQFRKAVAKDYYFEMYYDDLPVWGFLGRVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +GKSDP E+KYYLFKHLHF+I Y
Sbjct  143  DGKSDPGEHKYYLFKHLHFDISY  165



>ref|XP_010440842.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Camelina 
sativa]
Length=386

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  19   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  78

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  79   VSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  138

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+DPSEYKYYLF HL FEIFY
Sbjct  139  GKTDPSEYKYYLFNHLQFEIFY  160



>emb|CDY47549.1| BnaA08g07380D [Brassica napus]
Length=592

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDR
Sbjct  23   KSDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL +K S V C+K+LS+ DV +FR  ++ DYYFQMYYDDLP+WG++GKV K
Sbjct  83   LVTAPYKLEFLGEKNSHVACRKRLSREDVAQFRDVISRDYYFQMYYDDLPIWGFLGKVVK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +GKSDPSEYKYYLF HL FEIFY
Sbjct  143  DGKSDPSEYKYYLFNHLQFEIFY  165



>gb|KJB60874.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=594

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP +V +K EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCSPDHVTEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKL K +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFKEEKDSSVVCKKKLLKDEVAFFRKAVDKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+LFKH+ F++ Y
Sbjct  145  EGKTDPSEYKYFLFKHIQFDVLY  167



>ref|XP_010105529.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXC05024.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=591

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK G+ V LYANKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  22   RSDDSDHRYKDGNPVPLYANKVGPFHNPSETYRYFDLPFCSGGDVKEKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C  KL + DV KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYKLEFKKEKESEVACTTKLKREDVAKFRDAVKKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+HFEI Y
Sbjct  142  EGKADPSEYKYFLYKHIHFEILY  164



>ref|NP_172919.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q940S0.1|TMN2_ARATH RecName: Full=Transmembrane 9 superfamily member 2; AltName: 
Full=Endomembrane protein 8; AltName: Full=Transmembrane nine 
protein 2; Short=AtTMN2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96649.1| T5E21.14/T5E21.14 [Arabidopsis thaliana]
 gb|AAM16222.1| At1g14670/T5E21.14 [Arabidopsis thaliana]
 gb|AEE29200.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C KKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_010445554.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=400

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  19   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  78

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  79   VSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  138

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+DPSEYKYYLF HL FEIFY
Sbjct  139  GKTDPSEYKYYLFNHLQFEIFY  160



>ref|XP_009110529.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  20   RSYASDHRYKEGDIVLLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSEYKY+L+KH+ FEI Y
Sbjct  140  EIKSDPSEYKYFLYKHIEFEILY  162



>ref|XP_011463508.1| PREDICTED: transmembrane 9 superfamily member 2 [Fragaria vesca 
subsp. vesca]
Length=592

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY + D V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYNENDVVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K++EV C++KL+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLEFRKEKDTEVACRRKLTKEEVAEFRKAVEKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ FEI Y
Sbjct  143  EGKTDPSEYKYFLYKHIQFEILY  165



>emb|CDY15803.1| BnaC02g34220D [Brassica napus]
Length=592

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V+ K EA GEVLNGDR
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKDKKEAFGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL F  +K+SE  CKKKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLSFRDEKDSETYCKKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_002876790.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53049.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCIPDGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S+V C+KKLS+  VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFREEKDSDVYCRKKLSREQVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILY  165



>gb|KHG09925.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL +KE+E+ CK+KL++ +V KFR AV++DYYFQMYYDDLP+WG++GKV+K
Sbjct  83   LVSAPYKLEFLTEKEAEIACKRKLTRDEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEI  638
            EGK+DP++YKYYLFKHL FEI
Sbjct  143  EGKTDPADYKYYLFKHLVFEI  163



>ref|XP_002305925.2| endomembrane protein 70 [Populus trichocarpa]
 gb|EEE86436.2| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASD+RYK G++V LY NKVGPFHNPSETY Y DLPFCS    + K EALGE+LNGDR
Sbjct  23   RSDASDNRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ CK KL+K  V +FR A+++D+YFQMYYDDLP+WG+IGKV+K
Sbjct  83   LVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAISKDFYFQMYYDDLPIWGFIGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYL KHLHF IFY
Sbjct  143  EGKNDPSEYKYYLLKHLHFTIFY  165



>ref|XP_008462539.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Cucumis 
melo]
Length=601

 Score =   227 bits (579),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P +V++K EALGEVLNGDRL
Sbjct  34   SDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVKEKKEALGEVLNGDRL  93

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDFL +K+S  VC+KKLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  94   VSAPYKLDFLQEKDSSSVCQKKLSKEDVARFRAAVDKDYYFQMYYDDLPIWGFIGKVDKE  153

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK DPS++KYYL+KH+HF+IFY
Sbjct  154  GK-DPSDFKYYLYKHIHFDIFY  174



>gb|KHN43674.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   227 bits (578),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  20   RSDPSDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCEPGDLKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  DKES  VC +KLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLEFQRDKESISVCNRKLSKQDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPS+Y+Y+L+KH+HF++FY
Sbjct  140  EGK-DPSDYRYFLYKHIHFDVFY  161



>ref|XP_002521898.1| transporter, putative [Ricinus communis]
 gb|EEF40534.1| transporter, putative [Ricinus communis]
Length=525

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P +V++K EALGEVLNGDR
Sbjct  22   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHVKEKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  +K SE VC+KKLSK DV  FR A+ +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYQLNFRDEKSSEGVCRKKLSKEDVAHFRSAIDKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +GK+DPSEYKY+L+KH+ F++ Y
Sbjct  142  DGKTDPSEYKYFLYKHIQFDVLY  164



>ref|XP_006292411.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
 gb|EOA25309.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
Length=592

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK  D V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C+KKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCRKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_009108077.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=592

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  24   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL +K S V C+K+LS+ DV +FR  ++ DYYFQMYYDDLP+WG++GKV K+
Sbjct  84   VTAPYKLEFLGEKNSHVACRKRLSREDVAQFRDVISRDYYFQMYYDDLPIWGFLGKVVKD  143

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GKSDPSE+KYYLF HL FEIFY
Sbjct  144  GKSDPSEFKYYLFNHLQFEIFY  165



>ref|XP_010523531.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=584

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEADSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V++FR AV +D+YFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFREEKDSEVYCKKKLSKDEVKQFRRAVEKDFYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  ERKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_010502204.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK  D V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C+KKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCRKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_010513951.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
 ref|XP_010424990.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK  D V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C+KKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCRKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILY  165



>gb|KFK33411.1| hypothetical protein AALP_AA5G009400 [Arabis alpina]
Length=592

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+G+ V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGETVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SE  CKKKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSERYCKKKLSREEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_010523409.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
 ref|XP_010523411.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523412.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010523413.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Tarenaya 
hassleriana]
Length=592

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEADSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V++FR AV +D+YFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFREEKDSEVYCKKKLSKDEVKQFRRAVEKDFYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  ERKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_008220963.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
Length=591

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY  GD V LYANKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  22   RSDASDHRYNDGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K++EV C++KL+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  82   LVSAPYKLEFRKEKDTEVACRRKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ FE+ Y
Sbjct  142  EGKTDPSEYKYFLYKHIQFEVMY  164



>ref|XP_007225615.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
 gb|EMJ26814.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
Length=591

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY  GD V LYANKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  22   RSDASDHRYNDGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K++EV C++KL+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  82   LVSAPYKLEFRKEKDTEVACRRKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ FE+ Y
Sbjct  142  EGKTDPSEYKYFLYKHIQFEVMY  164



>ref|XP_007045409.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
 gb|EOY01241.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
Length=594

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP ++++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHLKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV++ YKL+F  +++S VVCK KLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVNAPYKLNFREERDSYVVCKTKLSKDEVAIFRKAVDKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ F+I Y
Sbjct  145  EGKADPSEYKYFLYKHIQFDILY  167



>ref|XP_007045410.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
 gb|EOY01242.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
Length=594

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP ++++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHLKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV++ YKL+F  +++S VVCK KLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVNAPYKLNFREERDSYVVCKTKLSKDEVAIFRKAVDKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ F+I Y
Sbjct  145  EGKADPSEYKYFLYKHIQFDILY  167



>ref|XP_008356702.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356703.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356704.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356705.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
Length=433

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSE Y Y DLPFCSP  V +K EALGEVLNGDR
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSEAYGYFDLPFCSPDAVTEKGEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL  K+ EV CKK L+K +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLEFLRHKDPEVACKKTLTKEEVGRFRSAVNKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK  PSEYK YL+KH+HF+++Y
Sbjct  145  EGKDPPSEYKTYLYKHIHFDLYY  167



>emb|CDX81659.1| BnaC08g39420D [Brassica napus]
Length=589

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  20   RSDSSDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V+ FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFRDEKDSEVYCKKKLSKEEVKHFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + KSDPSEYKY+L+KH+ FEI Y
Sbjct  140  DIKSDPSEYKYFLYKHIQFEILY  162



>dbj|BAJ89640.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT32275.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=593

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRL
Sbjct  25   SDGSDHRYKLGDPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+ VC KKL+K DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K 
Sbjct  85   VDAPYKLDFRTDHDSKAVCPKKLTKEDVAKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKG  144

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK DPSE+KYYL++H+ F+I Y
Sbjct  145  GKPDPSEWKYYLYRHIIFDILY  166



>ref|XP_004170088.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 gb|KGN49739.1| hypothetical protein Csa_5G096460 [Cucumis sativus]
Length=589

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            DAS+HRY +GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDRLV
Sbjct  22   DASNHRYSEGDSVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKEKKEALGEVLNGDRLV  81

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  +K++EV CK KLSK +V +FR AV +DYYFQMYYDDLP+WG+IGKVD+EG
Sbjct  82   SAPYKLDFKREKDTEVACKSKLSKKEVAQFRAAVKKDYYFQMYYDDLPIWGFIGKVDREG  141

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
            + DPSEYKY+LFKH+ F+I Y
Sbjct  142  RDDPSEYKYFLFKHIQFDISY  162



>ref|XP_008466877.1| PREDICTED: putative phagocytic receptor 1b [Cucumis melo]
Length=602

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            DAS+HRY +GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDRLV
Sbjct  35   DASNHRYSEGDSVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKEKKEALGEVLNGDRLV  94

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  +K++EV CK KLSK +V +FR AV +DYYFQMYYDDLP+WG+IGKVD+EG
Sbjct  95   SAPYKLDFKREKDTEVACKSKLSKKEVAQFRAAVKKDYYFQMYYDDLPIWGFIGKVDREG  154

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
            + DPSEYKY+LFKH+ F+I Y
Sbjct  155  RDDPSEYKYFLFKHIQFDISY  175



>ref|XP_010066537.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW64446.1| hypothetical protein EUGRSUZ_G02064 [Eucalyptus grandis]
Length=598

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G+ V LYANKVGPFHNPSETY + DLPFCSP NV+ K EALGEVLNGDR
Sbjct  29   RSDASDHRYKDGEVVPLYANKVGPFHNPSETYRFFDLPFCSPDNVKDKPEALGEVLNGDR  88

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  + +S+VVC KKLSK +V +FR AV +DYYFQMYYDDLP+WG+IGKV+K
Sbjct  89   LVSAPYKLNFKEEHDSKVVCSKKLSKEEVARFRAAVKKDYYFQMYYDDLPIWGFIGKVEK  148

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPSEYKY+L+KH+ F+I Y
Sbjct  149  EGKGDPSEYKYFLYKHIQFDILY  171



>ref|XP_010458976.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRYK GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C KKL+K +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCNKKLTKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_010440841.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Camelina 
sativa]
Length=587

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  19   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  78

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  79   VSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  138

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+DPSEYKYYLF HL FEIFY
Sbjct  139  GKTDPSEYKYYLFNHLQFEIFY  160



>gb|KDP38191.1| hypothetical protein JCGZ_04834 [Jatropha curcas]
Length=591

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P ++++K+EALGEVLNGDR
Sbjct  22   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKEKTEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K++ VVC+KKL+K +V KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYKLNFRDEKDTAVVCRKKLTKEEVAKFRSAVDKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPS+YKY+L+KH+ ++I Y
Sbjct  142  EGKADPSDYKYFLYKHIQYDILY  164



>ref|XP_004985073.1| PREDICTED: putative phagocytic receptor 1b-like [Setaria italica]
Length=593

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            D SDHRYK G+ V LYANKVGPFHNPSETY Y DLPFCSP  V +KSEALGEVLNGDRLV
Sbjct  26   DGSDHRYKAGEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVREKSEALGEVLNGDRLV  85

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  D +S  VC KKL+  DV KFR+AVA+DYYFQMYYDDLP+WG+IGKVDKEG
Sbjct  86   DAPYKLDFRVDLDSRSVCSKKLTTEDVAKFRNAVAKDYYFQMYYDDLPLWGFIGKVDKEG  145

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
            K+DPSE+KYYL+KH+ F+I +
Sbjct  146  KADPSEWKYYLYKHIIFDILF  166



>ref|XP_009355975.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=593

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP  V++K EALGEVLNGDR
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCSPDAVKEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL  K++EV CKK L+K +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLEFLRHKDTEVACKKTLTKEEVARFRSAVNKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPSEYK YL+KH+HF+++Y
Sbjct  145  EGK-DPSEYKTYLYKHIHFDLYY  166



>ref|XP_006307070.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
 gb|EOA39968.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
Length=592

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKERDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KE EV C KKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFREEKEGEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + KSDPSEYKY+L+KH+ FEI Y
Sbjct  143  DIKSDPSEYKYFLYKHIQFEILY  165



>ref|XP_009380058.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYKQGD V LYANKVGPFHNPSETY Y DLPFC P +V +K EALGEVLNGDRL
Sbjct  20   SDASDHRYKQGDPVPLYANKVGPFHNPSETYRYFDLPFCVPEHVTEKKEALGEVLNGDRL  79

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D++SE +CKKKL+K DV KFR AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  80   VEAPYKLDFRVDRDSEPLCKKKLTKEDVAKFRSAVTKDYYFQMYYDDLPIWGFIGKVDKE  139

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K D SEYKYYL++H+HF+I Y
Sbjct  140  RK-DLSEYKYYLYRHIHFDILY  160



>gb|KDP38192.1| hypothetical protein JCGZ_04835 [Jatropha curcas]
Length=591

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  22   RSDGSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKEKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K S VVC+KKL++ DV +FR A+ +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYKLNFRDEKVSAVVCQKKLTQEDVARFRSAIGKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY L+KH+ F++ Y
Sbjct  142  EGKADPSEYKYLLYKHIQFDVLY  164



>ref|XP_010450487.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=593

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  25   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  85   VSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  144

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+DPSEYKYYLF HL FEIFY
Sbjct  145  GKTDPSEYKYYLFNHLQFEIFY  166



>ref|XP_007152616.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
 gb|ESW24610.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
Length=594

 Score =   224 bits (572),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDHRYKQGD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  26   RSDSSDHRYKQGDIVPLYANKVGPFHNPSETYRYFDLPFCPPVDLKEKKEALGEVLNGDR  85

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y L+F  DKES  VC  KLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  86   LVSAPYVLEFQRDKESVHVCDAKLSKKDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  145

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPSEY+Y+L+KH+HF++FY
Sbjct  146  EGK-DPSEYRYFLYKHIHFDVFY  167



>ref|XP_007158822.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
 gb|ESW30816.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
Length=592

 Score =   224 bits (572),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC   N ++K+EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDHVPLYANKVGPFHNPSETYRYFDLPFCVTGNEKEKTEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+LDF  +K++++VC +KL K +V +FR AV +DYYFQMYYDDLP+WG+IG VDK
Sbjct  83   LVSTPYELDFRTEKDAKLVCSRKLKKQEVAQFREAVKKDYYFQMYYDDLPIWGFIGTVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ F+I Y
Sbjct  143  EGKTDPSEYKYFLYKHIQFDILY  165



>ref|XP_008393472.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=593

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP  V++K EALGEVLNGDR
Sbjct  25   RSDGSDHRYKEGDLVPLYANKVGPFHNPSETYRYFDLPFCSPGAVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL  K+++V CK KL K +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLEFLKHKDTDVACKTKLKKEEVAQFRSAVNKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPSEYK YL+KH+HF+++Y
Sbjct  145  EGK-DPSEYKTYLYKHIHFDLYY  166



>ref|XP_010917284.1| PREDICTED: transmembrane 9 superfamily member 2-like [Elaeis 
guineensis]
Length=596

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = +3

Query  138  MDRRRAMRHYavvlavlllgtatevvRSDASDHRYKQGDEVHLYANKVGPFHNPSETYMY  317
            M R++AM   AV++AV LL      V +DASDHRYK G+ V LYANKVGPFHNPSETY Y
Sbjct  1    MGRKKAMVLVAVLVAVFLLCFGIAGVAADASDHRYKAGEPVPLYANKVGPFHNPSETYRY  60

Query  318  HDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRH  497
             DLPFCSP +V++KSEALGEVLNGDRLV + YKLDF  D +S+VVC KKL   +V +FR 
Sbjct  61   FDLPFCSPEHVKEKSEALGEVLNGDRLVDAPYKLDFRVDLDSKVVCTKKLKSEEVAQFRS  120

Query  498  AVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFY  644
            AV +DYYFQMYYDDLP+WG+IGKVD+EGK+D +EYKYYL++H+HF++ Y
Sbjct  121  AVLKDYYFQMYYDDLPIWGFIGKVDREGKTDENEYKYYLYRHIHFDVLY  169



>ref|XP_009387842.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=597

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRYK GD V LY NKVGPFHNPSETY Y DLPFC+P +V +K EALGEVLNGDR
Sbjct  29   RSDASNHRYKTGDHVPLYVNKVGPFHNPSETYRYFDLPFCTPEHVTEKKEALGEVLNGDR  88

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  D+ESEV+CKKKL K DV KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  89   LVDAPYKLDFRVDRESEVLCKKKLKKEDVAKFRSAVTKDYYFQMYYDDLPLWGFIGKVDK  148

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK D  EYKYYL+K  HF++ Y
Sbjct  149  EGK-DLGEYKYYLYKRFHFDVLY  170



>ref|XP_006283389.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 ref|XP_006283390.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16287.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16288.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
Length=590

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRY  GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  22   SDGSDHRYMVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL+ K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  82   VSAPYKLEFLSYKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  141

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+DPSEYKYYLF HL FEIFY
Sbjct  142  GKTDPSEYKYYLFNHLQFEIFY  163



>ref|XP_010496367.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRYK GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C KKL+K +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCNKKLTKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILY  165



>ref|XP_003548324.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=587

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  19   RSDPSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCEPGDLKEKKEALGEVLNGDR  78

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  DKE   VC +KLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  79   LVSAPYKLEFQRDKELVSVCDRKLSKQDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  138

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPS+Y+Y+L+KH+HF++FY
Sbjct  139  EGK-DPSDYRYFLYKHIHFDVFY  160



>ref|XP_008789222.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789223.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789224.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789225.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789226.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=595

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +DASDHRYK G+ V LYANKVGPFHNPSETY Y DLPFCSP  +++KSEALGEVLNGDRL
Sbjct  27   ADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCSPEPMKEKSEALGEVLNGDRL  86

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+V CKKKL+K +V +FR AV +DYYFQMYYDDLP+WG+IGKVD+E
Sbjct  87   VDAPYKLDFRVDLDSKVACKKKLTKEEVAQFRSAVLKDYYFQMYYDDLPIWGFIGKVDRE  146

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+D +E+KYYL++H+HF+I Y
Sbjct  147  GKTDENEFKYYLYRHIHFDILY  168



>ref|XP_010476529.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRYK GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C KKL+K +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCNKKLTKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + KSDPSE+KY+L+KH+ FEI Y
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILY  165



>gb|KHN24548.1| Putative phagocytic receptor 1b [Glycine soja]
Length=586

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  18   RSDPSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCEPGDLKEKKEALGEVLNGDR  77

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  DKE   VC +KLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  78   LVSAPYKLEFQRDKELVSVCDRKLSKQDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  137

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPS+Y+Y+L+KH+HF++FY
Sbjct  138  EGK-DPSDYRYFLYKHIHFDVFY  159



>gb|AHA84153.1| phagocytic receptor 1b [Phaseolus vulgaris]
Length=588

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDHRYKQGD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  26   RSDSSDHRYKQGDIVPLYANKVGPFHNPSETYRYFDLPFCPPVDLKEKKEALGEVLNGDR  85

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y L+F  DKES  VC  KLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  86   LVSAPYVLEFQRDKESVHVCDAKLSKKDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  145

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPSEY+Y+L+KH+HF++FY
Sbjct  146  EGK-DPSEYRYFLYKHIHFDVFY  167



>ref|XP_009351612.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=592

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY +GD V LY+NKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYNEGDAVPLYSNKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  DK+SEV C+KKL+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLEFRKDKDSEVACRKKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFE  635
            EGK+DP EYKY+L+KH+ F+
Sbjct  143  EGKTDPREYKYFLYKHIQFD  162



>ref|XP_008340538.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=592

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY +GD V LYANKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYNEGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  DK+SEV C++KL+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLEFRKDKDSEVACRRKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFE  635
            EGK+DP EYKY+L+KH+ F+
Sbjct  143  EGKTDPREYKYFLYKHIQFD  162



>ref|XP_008791844.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=596

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +DASDHRYK G+ V LYANKVGPFHNPSETY Y DLPFC P +V++KSEALGEVLNGDRL
Sbjct  28   ADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCIPEHVKEKSEALGEVLNGDRL  87

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+VVC KKL   DV +FR AV +DYYFQMYYDDLP+WG+IGKVD+E
Sbjct  88   VDAPYKLDFRVDLDSKVVCPKKLKGEDVAQFRSAVLKDYYFQMYYDDLPIWGFIGKVDRE  147

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+D +EYKYYL++H+HFE+ Y
Sbjct  148  GKTDENEYKYYLYRHIHFEVLY  169



>ref|XP_004515238.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDHR+K+GD V L+ANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  24   RSDSSDHRFKEGDLVPLFANKVGPFHNPSETYRYFDLPFCIPDHLKEKKEALGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L++  DKES  VCKKKL+K DV KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  84   LVSAPYQLEYRRDKESVSVCKKKLTKEDVGKFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPS+Y+YYL+KH+HF+IFY
Sbjct  144  EGK-DPSDYRYYLYKHIHFDIFY  165



>ref|XP_010936838.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=592

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK  D V LYANKVGPF NPSETY Y DLPFC+P +V +K E LGEVLNGDRL
Sbjct  25   SDASDHRYKPEDPVPLYANKVGPFQNPSETYRYFDLPFCTPEHVTEKKEDLGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D++S+VVCKK+L+K DV KFR+AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  85   VVAPYKLDFRVDQDSQVVCKKQLTKEDVAKFRNAVIKDYYFQMYYDDLPIWGFIGKVDKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            G+ DPSEYKY+L+KH+HF+I Y
Sbjct  145  GR-DPSEYKYFLYKHIHFDILY  165



>ref|XP_010435562.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=589

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK  D+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  21   SDGSDHRYKVSDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  81   VSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  140

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+DPSEYKYYLF HL FEIFY
Sbjct  141  GKTDPSEYKYYLFNHLQFEIFY  162



>ref|XP_003524839.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
 gb|KHN25962.1| Putative phagocytic receptor 1b [Glycine soja]
Length=601

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC   + ++K+EALGEVLNGDR
Sbjct  32   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCVTGHEKEKTEALGEVLNGDR  91

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L F  +K+S+VVCK+KL+K  V +FR AV +DYYFQMYYDDLP+WG+IG +DK
Sbjct  92   LVSAPYELSFKKEKDSKVVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTIDK  151

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ F+I Y
Sbjct  152  EGKTDPSEYKYFLYKHIQFDILY  174



>ref|XP_007210263.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
 ref|XP_008240392.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
 gb|EMJ11462.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
Length=593

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP  V++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKEGDLVPLYANKVGPFHNPSETYRYFDLPFCSPDKVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F   K+SEV CK+ + K +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLEFQKHKDSEVACKRTIKKEEVARFRSAVNKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPSEYK YL+KH+HF+I Y
Sbjct  145  EGK-DPSEYKTYLYKHIHFDISY  166



>ref|XP_004299493.1| PREDICTED: transmembrane 9 superfamily member 3-like [Fragaria 
vesca subsp. vesca]
Length=599

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDAS+HRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP  V++K EALGEVLNGDRL
Sbjct  32   SDASNHRYKEGDVVPLYANKVGPFHNPSETYRYFDLPFCSPDAVKEKKEALGEVLNGDRL  91

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K+SE VCKK L+K +V KFR AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  92   VSAPYKLEFLKHKDSEQVCKKSLTKEEVAKFRSAVNKDYYFQMYYDDLPIWGFIGKVDKE  151

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K DPSEYK YL+KH+HF+I Y
Sbjct  152  NK-DPSEYKTYLYKHIHFDILY  172



>ref|XP_008798135.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=592

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK  D V LYANKVGPFHNPSETY Y DLPFC+P ++ +K E LGEVLNGDRL
Sbjct  25   SDASDHRYKPDDPVPLYANKVGPFHNPSETYRYFDLPFCTPEHLTEKKEDLGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D++S+VVCKK L+K D  KFR+AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  85   VVAPYKLDFRVDQDSQVVCKKHLTKEDAAKFRNAVMKDYYFQMYYDDLPIWGFIGKVDKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK DPSEYKY+L+KH+HF+I Y
Sbjct  145  GK-DPSEYKYFLYKHIHFDILY  165



>ref|XP_006448060.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 gb|ESR61300.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=545

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEK-KSEALGEVLNGD  392
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP  + K K EALGEVLNGD
Sbjct  23   RSDASDHRYKVGDVVPLYANKVGPFHNPSETYRYFDLPFCSPDGIIKEKREALGEVLNGD  82

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKL+F  +K+S V C+KKLS+ DV +FR AV +D+YFQMYYDDLP+WG+IGKVD
Sbjct  83   RLVSAPYKLNFRDEKDSAVACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKVD  142

Query  573  KEGKSDPSEYKYYLFKHLHFEIFY  644
            KEGK+ P+EYKY+L+KH+ F+I Y
Sbjct  143  KEGKTHPNEYKYFLYKHIQFDILY  166



>ref|XP_008356712.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=301

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP  V++K EALGE LNGDR
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCSPDAVKEKREALGEALNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL  K++EV CKK L+K +V +FR AV +DYYFQMYYDDLP WG+IG VDK
Sbjct  85   LVSAPYKLEFLRHKDTEVACKKTLTKEEVARFRSAVNKDYYFQMYYDDLPTWGFIGXVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK D SEYK YL++H+HF+++Y
Sbjct  145  EGK-DXSEYKTYLYEHIHFDLYY  166



>ref|XP_003531127.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=604

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC   + + K+EALGEVLNGDR
Sbjct  35   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCVTGHEKDKTEALGEVLNGDR  94

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L F  +K+S+VVCK+KL+K  V +FR AV +DYYFQMYYDDLP+WG+IG VDK
Sbjct  95   LVSAPYELSFKKEKDSKVVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTVDK  154

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ F+I Y
Sbjct  155  EGKTDPSEYKYFLYKHIQFDIHY  177



>ref|XP_010932502.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
 ref|XP_010932503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=597

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +DASDHRYK G+ V LYANKVGPFHNPSETY Y DLPFC P ++++KSEALGEVLNGDRL
Sbjct  29   ADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCPPEHMKEKSEALGEVLNGDRL  88

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+ VCKKKL+  +V +FR AV +DYYFQMYYDDLP+WG+IGKVD+E
Sbjct  89   VDAPYKLDFRVDLDSKAVCKKKLTIEEVAQFRSAVLKDYYFQMYYDDLPIWGFIGKVDRE  148

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+D  EYKYYL++H+HF+I Y
Sbjct  149  GKTDEDEYKYYLYRHIHFDILY  170



>gb|KHN28892.1| Putative phagocytic receptor 1b [Glycine soja]
Length=604

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC   + + K+EALGEVLNGDR
Sbjct  35   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCVTGHEKDKTEALGEVLNGDR  94

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L F  +K+S+VVCK+KL+K  V +FR AV +DYYFQMYYDDLP+WG+IG VDK
Sbjct  95   LVSAPYELSFKKEKDSKVVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTVDK  154

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ F+I Y
Sbjct  155  EGKTDPSEYKYFLYKHIQFDIHY  177



>ref|XP_006431398.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44638.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=545

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP-ANVEKKSEALGEVLNGD  392
            RSD+SDHR+K GD V LYANKVGPFHNPSETY Y DLPFCSP A +++K EALGEVLNGD
Sbjct  23   RSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDAIIKEKREALGEVLNGD  82

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKL+F  +K+S + C+KKLS+ DV +FR AV +D+YFQMYYDDLP+WG+IGKVD
Sbjct  83   RLVSAPYKLNFRDEKDSALACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKVD  142

Query  573  KEGKSDPSEYKYYLFKHLHFEIFY  644
            KEGK+ PSEYKY+L+KH+ F+I Y
Sbjct  143  KEGKTHPSEYKYFLYKHIQFDILY  166



>ref|XP_010920043.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X3 [Elaeis guineensis]
Length=524

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDR
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ES  +C+K LS+ D+ K R+AVA+DYYFQMYYDDLP WG+IGKVDK
Sbjct  80   LVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +   DPSEYKY LFKH+HF+IFY
Sbjct  140  DNL-DPSEYKYLLFKHIHFDIFY  161



>ref|XP_006448061.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 ref|XP_006492286.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492287.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Citrus 
sinensis]
 gb|ESR61301.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=593

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEK-KSEALGEVLNGD  392
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP  + K K EALGEVLNGD
Sbjct  23   RSDASDHRYKVGDVVPLYANKVGPFHNPSETYRYFDLPFCSPDGIIKEKREALGEVLNGD  82

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKL+F  +K+S V C+KKLS+ DV +FR AV +D+YFQMYYDDLP+WG+IGKVD
Sbjct  83   RLVSAPYKLNFRDEKDSAVACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKVD  142

Query  573  KEGKSDPSEYKYYLFKHLHFEIFY  644
            KEGK+ P+EYKY+L+KH+ F+I Y
Sbjct  143  KEGKTHPNEYKYFLYKHIQFDILY  166



>ref|XP_010920044.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X4 [Elaeis guineensis]
Length=516

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDR
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ES  +C+K LS+ D+ K R+AVA+DYYFQMYYDDLP WG+IGKVDK
Sbjct  80   LVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +   DPSEYKY LFKH+HF+IFY
Sbjct  140  DNL-DPSEYKYLLFKHIHFDIFY  161



>ref|XP_006854108.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
 gb|ERN15575.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
Length=631

 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDH+YKQGD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K E LGEVLNGDRL
Sbjct  63   ADGSDHKYKQGDRVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKREDLGEVLNGDRL  122

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L F  ++ESEV+CKKKLSK  V + R AV +DYYFQMYYDDLP+WG+IGKVDK+
Sbjct  123  VDAPYQLQFRLERESEVLCKKKLSKDKVAQLRDAVNKDYYFQMYYDDLPIWGFIGKVDKD  182

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K+DPSEY+Y LFKH+HFEI Y
Sbjct  183  NKADPSEYRYLLFKHIHFEISY  204



>tpg|DAA44289.1| TPA: hypothetical protein ZEAMMB73_547933 [Zea mays]
Length=526

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRLV +
Sbjct  28   SDHRYKMYEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRLVDA  87

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
             YKLDF ++ ES+ VC KKL+K DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K GK+
Sbjct  88   PYKLDFRSEVESKAVCSKKLTKEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGGKA  147

Query  588  DPSEYKYYLFKHLHFEIFY  644
            DPSE+KYYL++H+ F+I Y
Sbjct  148  DPSEWKYYLYRHIIFDILY  166



>ref|XP_008389133.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=591

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY +GD V LYANKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  22   RSDASDHRYNEGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y L+F  DK+SEV C++ L+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  82   LVSAPYNLEFRKDKDSEVACRRMLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFE  635
            EGK+DP EYKY+L+KH+ F+
Sbjct  142  EGKTDPREYKYFLYKHIQFD  161



>ref|XP_006431397.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44637.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=593

 Score =   219 bits (558),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP-ANVEKKSEALGEVLNGD  392
            RSD+SDHR+K GD V LYANKVGPFHNPSETY Y DLPFCSP A +++K EALGEVLNGD
Sbjct  23   RSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDAIIKEKREALGEVLNGD  82

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKL+F  +K+S + C+KKLS+ DV +FR AV +D+YFQMYYDDLP+WG+IGKVD
Sbjct  83   RLVSAPYKLNFRDEKDSALACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKVD  142

Query  573  KEGKSDPSEYKYYLFKHLHFEIFY  644
            KEGK+ PSEYKY+L+KH+ F+I Y
Sbjct  143  KEGKTHPSEYKYFLYKHIQFDILY  166



>emb|CDY41095.1| BnaC05g10860D [Brassica napus]
Length=589

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC P  V++K EA GEVLNGDR
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLAFCVPEGVKEKKEAFGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V++FR AV + YYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCKKKLSKEEVKQFRKAVEKAYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E KSDPSE++Y L+KH+ FEI Y
Sbjct  143  EIKSDPSEHRYVLYKHIQFEILY  165



>ref|XP_003558407.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=593

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRL
Sbjct  25   SDGSDHRYKSSEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+ VC KKL+K DV KFR++VA+DYYFQMYYDDLP+WG+IGK++K 
Sbjct  85   VDAPYKLDFRVDLDSKPVCSKKLTKEDVAKFRNSVAKDYYFQMYYDDLPLWGFIGKLEKT  144

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K+DPSE+KYYL++H+ F+I Y
Sbjct  145  AKADPSEWKYYLYRHIIFDILY  166



>gb|ADQ43185.1| endomemebrane protein 70 [Schrenkiella parvula]
Length=587

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 2/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNP ETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNP-ETYRYFDLPFCVP-GVKDKKEALGEVLNGDR  80

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL F  +K+SE  CKKKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  81   LVSAPYKLSFRDEKDSETYCKKKLSREEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  140

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            E K+DPSE+KY+L+KH+ FEI Y
Sbjct  141  ESKADPSEFKYFLYKHIQFEILY  163



>ref|XP_009389646.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=599

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK GD V LY NKVGPFHNPSETY Y DLPFC+P +V +K EALGEVLNGDRL
Sbjct  32   SDASDHRYKTGDHVPLYVNKVGPFHNPSETYRYFDLPFCTPEHVTEKREALGEVLNGDRL  91

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D ESEV+CKK+L++ +V KFR AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  92   VDAPYKLDFRVDHESEVLCKKRLTREEVSKFRSAVTKDYYFQMYYDDLPLWGFIGKVDKE  151

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK D  EYKYYL+K  HF++ Y
Sbjct  152  GK-DLGEYKYYLYKRFHFDVLY  172



>ref|XP_004504610.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY  GD V LYANKVGPFHNPSETY Y DLPFC   + ++K+EALGEVLNGDR
Sbjct  23   RSDASDHRYGDGDPVPLYANKVGPFHNPSETYRYLDLPFCVTGHEKEKTEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L F  +K+S VVCKKKL++ +V +FR AV +DYYFQMYYDDLP+WG+IG VDK
Sbjct  83   LVSAPYELHFRKEKDSNVVCKKKLTREEVNQFREAVKKDYYFQMYYDDLPIWGFIGTVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKY+L+KH+ F++ Y
Sbjct  143  EGKTDPSEYKYFLYKHIQFDVLY  165



>ref|XP_010920042.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Elaeis guineensis]
Length=582

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDR
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ES  +C+K LS+ D+ K R+AVA+DYYFQMYYDDLP WG+IGKVDK
Sbjct  80   LVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +   DPSEYKY LFKH+HF+IFY
Sbjct  140  DNL-DPSEYKYLLFKHIHFDIFY  161



>ref|NP_001148980.1| LOC100282600 precursor [Zea mays]
 gb|ACG33705.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 tpg|DAA44288.1| TPA: transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRLV +
Sbjct  28   SDHRYKMYEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRLVDA  87

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
             YKLDF ++ ES+ VC KKL+K DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K GK+
Sbjct  88   PYKLDFRSEVESKAVCSKKLTKEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGGKA  147

Query  588  DPSEYKYYLFKHLHFEIFY  644
            DPSE+KYYL++H+ F+I Y
Sbjct  148  DPSEWKYYLYRHIIFDILY  166



>ref|XP_002468203.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
 gb|EER95201.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
Length=595

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            D SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V +KSEALGEVLNGDRLV
Sbjct  28   DGSDHRYKMNEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVREKSEALGEVLNGDRLV  87

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  + ES+ VC KKL+  DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K G
Sbjct  88   DAPYKLDFRLEVESKAVCSKKLTVEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  147

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
            K+DPSE+KYYL++H+ F+I Y
Sbjct  148  KADPSEWKYYLYRHIIFDILY  168



>ref|XP_006470811.1| PREDICTED: putative phagocytic receptor 1b-like [Citrus sinensis]
Length=593

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP-ANVEKKSEALGEVLNGD  392
            RSD+SDHR+K GD V LYANKVGPFHNPSETY Y DLPFCSP A +++K EALGEVLNGD
Sbjct  23   RSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDAIIKEKREALGEVLNGD  82

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKL+F  +K+S + C+KKLS+ DV +FR AV +D+YFQMYYDDLP+WG+IGKVD
Sbjct  83   RLVSAPYKLNFRDEKDSALACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKVD  142

Query  573  KEGKSDPSEYKYYLFKHLHFEIFY  644
            KEGK+ P+EYKY+L+KH+ F+I Y
Sbjct  143  KEGKTHPNEYKYFLYKHIQFDILY  166



>ref|XP_008787888.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Phoenix 
dactylifera]
Length=555

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = +3

Query  225  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVH  404
            ASD RYK  D V LYANKVGPFHNPSETY Y DLPFC+P +V +K E LGEVLNGDRLV 
Sbjct  27   ASDRRYKPEDPVPLYANKVGPFHNPSETYRYFDLPFCTPEHVTEKKEDLGEVLNGDRLVI  86

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGK  584
            + YKLDF  D++S+VVCKK+L K DV KFR+A+ +DYYFQMYYDDLP+WGYIGKVDKEGK
Sbjct  87   APYKLDFRVDRDSKVVCKKQLKKEDVAKFRNAIIKDYYFQMYYDDLPIWGYIGKVDKEGK  146

Query  585  SDPSEYKYYLFKHLHFEIFY  644
             DPSE+KY+L+KH+HF+I Y
Sbjct  147  -DPSEFKYFLYKHIHFDILY  165



>ref|XP_010920041.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=588

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDR
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ES  +C+K LS+ D+ K R+AVA+DYYFQMYYDDLP WG+IGKVDK
Sbjct  80   LVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +   DPSEYKY LFKH+HF+IFY
Sbjct  140  D-NLDPSEYKYLLFKHIHFDIFY  161



>gb|AGT15903.1| transmembrane 9 superfamily protein [Saccharum hybrid cultivar 
R570]
Length=593

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            D SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V +KSEALGEVLNGDRLV
Sbjct  26   DGSDHRYKMNEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVREKSEALGEVLNGDRLV  85

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  + ES+ VC KKL+  DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K G
Sbjct  86   DAPYKLDFRFEVESKAVCSKKLTVEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  145

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
            K+DPSE+KYYL++H+ F+I Y
Sbjct  146  KADPSEWKYYLYRHIIFDILY  166



>ref|XP_010939968.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=609

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S ASDHRYK  D V LYANKVGPF NPSETY Y DLPFC+P +V +K E LGEVLNGDRL
Sbjct  42   SSASDHRYKPEDPVPLYANKVGPFQNPSETYRYFDLPFCTPEHVTEKKEDLGEVLNGDRL  101

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  +++S+VVCKK+L+K DV KFR+AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  102  VVAPYKLDFHVNQDSKVVCKKQLTKEDVAKFRNAVIKDYYFQMYYDDLPIWGFIGKVDKE  161

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK DPSEYKY+L+KH+HF+I Y
Sbjct  162  GK-DPSEYKYFLYKHIHFDILY  182



>ref|XP_002521899.1| transporter, putative [Ricinus communis]
 gb|EEF40535.1| transporter, putative [Ricinus communis]
Length=592

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V  YANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  23   RSDTSDHRYKEGDPVPFYANKVGPFHNPSETYRYFDLPFCVPDHLKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y L+F  DK S  VC+KKLSK DV +FR A+A+DYYFQMYYDDLP+WG+IGKV K
Sbjct  83   LVSAPYTLNFRDDKVSAPVCQKKLSKEDVAQFRSAIAKDYYFQMYYDDLPIWGFIGKVVK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +GK DPSEYKY+L++H+ F++ Y
Sbjct  143  DGKDDPSEYKYFLYQHVQFDVLY  165



>ref|XP_003620064.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES76282.1| transmembrane 9 family protein [Medicago truncatula]
Length=588

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SD RYK+GD V L+ANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  20   RSDSSDKRYKEGDLVPLFANKVGPFHNPSETYRYFDLPFCIPDHLKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  DK+S  VCKK L+K +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYQLEFQKDKDSLSVCKKTLTKEEVANFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPS+Y+YYL+KH+HF+IFY
Sbjct  140  EGK-DPSDYRYYLYKHIHFDIFY  161



>ref|XP_008787887.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Phoenix 
dactylifera]
Length=592

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = +3

Query  225  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVH  404
            ASD RYK  D V LYANKVGPFHNPSETY Y DLPFC+P +V +K E LGEVLNGDRLV 
Sbjct  27   ASDRRYKPEDPVPLYANKVGPFHNPSETYRYFDLPFCTPEHVTEKKEDLGEVLNGDRLVI  86

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGK  584
            + YKLDF  D++S+VVCKK+L K DV KFR+A+ +DYYFQMYYDDLP+WGYIGKVDKEGK
Sbjct  87   APYKLDFRVDRDSKVVCKKQLKKEDVAKFRNAIIKDYYFQMYYDDLPIWGYIGKVDKEGK  146

Query  585  SDPSEYKYYLFKHLHFEIFY  644
             DPSE+KY+L+KH+HF+I Y
Sbjct  147  -DPSEFKYFLYKHIHFDILY  165



>ref|NP_001049492.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|AAO06970.1| Putative endosomal protein [Oryza sativa Japonica Group]
 gb|ABF94848.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11406.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|EAZ26202.1| hypothetical protein OsJ_10070 [Oryza sativa Japonica Group]
 dbj|BAG89207.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRL
Sbjct  27   ADGSDHRYKANELVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRL  86

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+ VC KKL+K +V KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K 
Sbjct  87   VDAPYKLDFRVDYDSKPVCSKKLTKEEVAKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKG  146

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK+DP E+KYYL++H+ F+I Y
Sbjct  147  GKTDPKEWKYYLYRHIIFDILY  168



>ref|XP_008375035.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=611

 Score =   217 bits (552),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCS   V++K EALGEVLNGDR
Sbjct  43   RSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCSRDAVKEKREALGEVLNGDR  102

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL  K++EV CKK L+K +V +FR AV +DYYFQMYYDDLP WG+IGKVDK
Sbjct  103  LVSAPYKLEFLRHKDTEVACKKXLTKEEVARFRSAVNKDYYFQMYYDDLPXWGFIGKVDK  162

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK DPSEYK YL+ H+HF+++Y
Sbjct  163  EGK-DPSEYKTYLYXHIHFDLYY  184



>ref|XP_009404153.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S+ASDHRYKQGD V LYANKVGPFHNPSETY + DLPFC P +V +K EALGEVLNGDRL
Sbjct  20   SEASDHRYKQGDPVPLYANKVGPFHNPSETYRFFDLPFCIPDHVTEKKEALGEVLNGDRL  79

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +SE++CKKKL+K DV KFR AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  80   VGAPYKLDFRVDYDSELLCKKKLTKGDVGKFRDAVTKDYYFQMYYDDLPIWGFIGKVDKE  139

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK D S   YYL++H+HF+I Y
Sbjct  140  GK-DLSNDNYYLYRHIHFDILY  160



>ref|NP_001151315.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN28721.1| unknown [Zea mays]
 gb|AFW89069.1| transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            D SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRLV
Sbjct  26   DGSDHRYKIREPVPLYANKVGPFHNPSETYRYFDLPFCSPDKVKEKSEALGEVLNGDRLV  85

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  + ES+ VC KKL+  DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K G
Sbjct  86   DAPYKLDFRDEVESKAVCSKKLTTEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  145

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
            K DPSE+KYYL++H+ F+I Y
Sbjct  146  KDDPSEWKYYLYRHIIFDILY  166



>gb|ACG42357.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
Length=593

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            D SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRLV
Sbjct  26   DGSDHRYKIREPVPLYANKVGPFHNPSETYRYFDLPFCSPDKVKEKSEALGEVLNGDRLV  85

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  + ES+ VC KKL+  DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K G
Sbjct  86   DAPYKLDFRDEVESKAVCSKKLTTEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  145

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
            K DPSE+KYYL++H+ F+I Y
Sbjct  146  KDDPSEWKYYLYRHIIFDILY  166



>ref|XP_009628015.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628016.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=592

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS HRYK G+EV LYANKVGPF NPSETY Y DLPFC P N+EKK E+LGE+LNGDR
Sbjct  22   QSDASTHRYKSGEEVPLYANKVGPFFNPSETYAYFDLPFCRPDNMEKKKESLGELLNGDR  81

Query  396  LVHSLYKLDFLAD-KESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            L  + YKL+FLAD K+++VVCKK+L+K +V +FR AVA DYY QMYYDDLP+W +IGK+D
Sbjct  82   LTFAPYKLEFLADKKDAKVVCKKRLTKEEVAQFRTAVALDYYIQMYYDDLPIWAFIGKID  141

Query  573  KEGKSDPSEYKYYLFKHLHFEIFY  644
            KEG  DP+E+KY+++   HFEIFY
Sbjct  142  KEGSYDPNEFKYHIYTMFHFEIFY  165



>ref|XP_009419338.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=593

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK+ D V LYANKVGPFHNPSETY Y DLPFC+P +V +  EALGEVLNGDRL
Sbjct  26   SDASDHRYKKRDSVPLYANKVGPFHNPSETYRYFDLPFCAPEHVTEIREALGEVLNGDRL  85

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL D +S+ +CKKKL+K DV KFR AV +DYYFQMY+DDLP+WG+IGKVDKE
Sbjct  86   VDAPYKLNFLVDLDSKQLCKKKLTKEDVAKFRSAVTKDYYFQMYFDDLPIWGFIGKVDKE  145

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            GK D  +YKYYL++H+HF++ Y
Sbjct  146  GK-DLGDYKYYLYRHIHFDVLY  166



>ref|XP_008788644.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008788651.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=588

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDRL
Sbjct  21   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVTEKKEALGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  D+ES  +CKK LS+ D+ K R AVA+DYYFQM+YDDLP WG+IGK+DK+
Sbjct  81   VDAPYELNFREDRESTTICKKSLSEEDIAKLRDAVAKDYYFQMFYDDLPFWGFIGKIDKD  140

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
               DPSE KY LFKH+HF+IFY
Sbjct  141  -NLDPSENKYLLFKHIHFDIFY  161



>gb|KHG20583.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=589

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGPF NPSETY Y D PFCS   +++K EA GEVLNGDR
Sbjct  23   RSSASDHRYKAGDEVPLYANKVGPFGNPSETYRYFDFPFCSSVPLKEKKEAFGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV   Y++DFL +K++E+ CK+KLSK +V +FR A+++DYYFQMY+DDLP WG+ GKVD 
Sbjct  83   LVSGPYRIDFLREKDAEIACKRKLSKEEVARFRTAISKDYYFQMYFDDLPFWGFFGKVDN  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
             GK+DPS+ KYYL+KHL FEIFY
Sbjct  143  VGKADPSDCKYYLYKHLVFEIFY  165



>ref|XP_007141945.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
 gb|ESW13939.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
Length=596

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDA+DHRY +GD V  YANKVGPFHNPSETY Y DLPFCSPANVE+K E LGEVLNGDRL
Sbjct  28   SDAADHRYNKGDSVPFYANKVGPFHNPSETYKYFDLPFCSPANVEEKKEDLGEVLNGDRL  87

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+F  DKE E +CKK+L+K +V +FRHAV +DY++QMYYDDLP+WG++GK D E
Sbjct  88   VVAPYKLNFQIDKEPESICKKRLTKKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSE  147

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K DP+    +LF H+HFEI Y
Sbjct  148  DKDDPTGATVHLFTHVHFEILY  169



>gb|KJB43179.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
 gb|KJB43180.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
Length=589

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGPF NPSETY Y D PFCSP  +++K EALGEVLNGDR
Sbjct  23   RSSASDHRYKAGDEVPLYANKVGPFGNPSETYRYFDFPFCSPVPLKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV   Y++DFL++K++E+ CK+KLSK +V +FR A+++DYYFQMY+DDLP WG+ GKV  
Sbjct  83   LVSGPYRIDFLSEKDAEIACKRKLSKEEVARFRTAISKDYYFQMYFDDLPFWGFFGKVYN  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
             GK+DPS+ KYYL+KH  F+IFY
Sbjct  143  VGKADPSDCKYYLYKHPVFQIFY  165



>ref|XP_009782678.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782682.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782687.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=592

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS H+YK G++V LYANKVGPF NPSETY Y+DLPFC P N+EKK E+LGEVLNGDR
Sbjct  22   QSDASTHQYKSGEKVPLYANKVGPFFNPSETYSYYDLPFCRPDNLEKKKESLGEVLNGDR  81

Query  396  LVHSLYKLDFLAD-KESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            L  + YKL+FLAD K+++VVCKK+L+K +V +FR AV  DYY QMYYDDLP+W +IGK+D
Sbjct  82   LTFAPYKLEFLADKKDAKVVCKKRLTKEEVAQFRTAVTLDYYIQMYYDDLPIWAFIGKID  141

Query  573  KEGKSDPSEYKYYLFKHLHFEIFY  644
            KEG  DP+E+KY+++   HFEIFY
Sbjct  142  KEGSYDPNEFKYHIYTMFHFEIFY  165



>ref|XP_010036999.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48635.1| hypothetical protein EUGRSUZ_K02293 [Eucalyptus grandis]
Length=592

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S  S+HRY++ D V LYANKVGPFHNPSETY Y DLP+C+P  ++ K EALGEVLNGDRL
Sbjct  25   SSPSNHRYEERDPVPLYANKVGPFHNPSETYRYFDLPYCTPDQMKDKKEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + + L+FL +KE EVVCKK LSK++V +FR A+ +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  85   VSAPFDLNFLTNKEYEVVCKKTLSKAEVARFRSAIIQDYYFQMYYDDLPIWGFIGKVDKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             + DPSEYKY L+KH+ FEIFY
Sbjct  145  DR-DPSEYKYLLYKHIIFEIFY  165



>ref|XP_010276746.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=590

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D S+H+YK+ D V LYANKVGPFHNPSETY Y+DLPFCSP +V++K EALGEVLNGDRL
Sbjct  22   ADGSNHKYKERDLVPLYANKVGPFHNPSETYRYYDLPFCSPDHVKEKREALGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK+S+++C+KKL+K +V + R AV +DYYFQMYYDDLP WG++GKV+K+
Sbjct  82   VDAPYELNFRVDKQSKIICQKKLTKEEVAQLRTAVLKDYYFQMYYDDLPFWGFVGKVEKD  141

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K DP+EYKY LFKH+HF++ Y
Sbjct  142  NKEDPNEYKYLLFKHIHFDVLY  163



>emb|CDP05457.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRY+ G+ V LYANK+GPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  21   RSDASNHRYQPGEPVPLYANKIGPFHNPSETYRYFDLPFCIPDHIKEKKEALGEVLNGDR  80

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV   Y LDFL DKES+++CKKKL+K +V +FR AV +DYYFQMYYDDLP+WG IG+VD+
Sbjct  81   LVSGPYSLDFLVDKESDLLCKKKLTKEEVSQFRKAVEKDYYFQMYYDDLPIWGLIGRVDR  140

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EG+++  +Y+YYL++H+HF+I Y
Sbjct  141  EGRAE-KDYRYYLYEHVHFDIQY  162



>ref|XP_006849485.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
 gb|ERN11066.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
Length=591

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS+H+YK GD V LY NKVGPFHNPSETY Y DLPFC PA++ +K EALGEVLNGDR
Sbjct  19   QSDASNHKYKPGDPVPLYVNKVGPFHNPSETYRYFDLPFCPPAHLTEKKEALGEVLNGDR  78

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  DK+S+VVCKK+LS+ +V  FR+AV +DYYFQM YDDLP+WG++GK++K
Sbjct  79   LVEAAYKLDFRVDKDSDVVCKKRLSRDEVASFRNAVIKDYYFQMIYDDLPLWGFVGKIEK  138

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + K+D  E++Y L+KH+HFE  Y
Sbjct  139  DIKADVPEFRYLLYKHIHFEAIY  161



>ref|XP_010099693.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXB80270.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=637

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            SDHRY +GD V LYANKVGPF NPSETY Y DLPFCSP  V++K EALGEVLNGDRLV +
Sbjct  26   SDHRYHEGDSVPLYANKVGPFQNPSETYRYFDLPFCSPDGVKEKKEALGEVLNGDRLVSA  85

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
             YKL+F  +KES+V CK KL K +V +FR AV +DYYFQMYYDDLPVWG+IGKV KEGK 
Sbjct  86   PYKLEFQKNKESKVACKSKLKKEEVARFRSAVNKDYYFQMYYDDLPVWGFIGKVVKEGK-  144

Query  588  DPSEYKYYLFKHLHFEIFY  644
            +PSEYKYYL++H+HF+I Y
Sbjct  145  EPSEYKYYLYRHIHFDISY  163



>ref|XP_010910475.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X3 [Elaeis guineensis]
Length=515

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDRL
Sbjct  23   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK+S  +C K LSK +V + R+AV++DYYFQMYYDDLP WG++GKV+K+
Sbjct  83   VDAPYELNFREDKQSISLCTKTLSKENVAELRNAVSKDYYFQMYYDDLPFWGFLGKVEKD  142

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K DP+E KY LFKH+HFEI Y
Sbjct  143  -KLDPNENKYLLFKHIHFEILY  163



>gb|ABK25212.1| unknown [Picea sitchensis]
Length=355

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 111/140 (79%), Gaps = 4/140 (3%)
 Frame = +3

Query  225  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVH  404
            ASDHRY +GD V LYANKVGPFHNPSETY Y DLPFC P  V +K E LGEVLNGDR+V 
Sbjct  23   ASDHRYSKGDHVPLYANKVGPFHNPSETYRYFDLPFCPPDKVTEKREDLGEVLNGDRMVD  82

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGK  584
            + YKL F  DK SE++C+KKL+K D+EKFR AV +DYYFQMYYDDLP+WG+IGK D+E  
Sbjct  83   ARYKLHFQDDKNSELLCRKKLTKDDLEKFREAVKKDYYFQMYYDDLPIWGFIGKTDRETN  142

Query  585  SDPSEYKYYLFKHLHFEIFY  644
            +DP    + L+KHLHFEI Y
Sbjct  143  ADP----FLLYKHLHFEILY  158



>gb|KHN41041.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DLPFCSPANVE+K E LGEVLNGDRL
Sbjct  20   SDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGDRL  79

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D E E  CKK+L+  +V +FRHAV +DY++QMYYDDLP+WG++GK D E
Sbjct  80   VAAPYKLDFQIDIEPESYCKKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSE  139

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K D S    +LFKH+HFEI Y
Sbjct  140  DKDDQSGAIVHLFKHVHFEILY  161



>ref|XP_003518365.2| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Glycine 
max]
Length=592

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DLPFCSPANVE+K E LGEVLNGDRL
Sbjct  24   SDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D E E  CKK+L+  +V +FRHAV +DY++QMYYDDLP+WG++GK D E
Sbjct  84   VAAPYKLDFQIDIEPESYCKKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSE  143

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K D S    +LFKH+HFEI Y
Sbjct  144  DKDDQSGAIVHLFKHVHFEILY  165



>gb|KJB10378.1| hypothetical protein B456_001G198000 [Gossypium raimondii]
Length=500

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 112/143 (78%), Gaps = 12/143 (8%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRY  GDEV LYANKVGPFHNPSETY   D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSSASDHRYTAGDEVPLYANKVGPFHNPSETYRLFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+LDFL            L+K +V KFR AV+++YYFQMYY+DLP+WG++GKVD 
Sbjct  83   LVSAPYRLDFL------------LAKEEVAKFRTAVSKNYYFQMYYNDLPIWGFLGKVDN  130

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+DPSEYKYYLFKHL FEI Y
Sbjct  131  EGKADPSEYKYYLFKHLIFEILY  153



>ref|XP_010910474.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Elaeis guineensis]
Length=554

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDRL
Sbjct  23   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK+S  +C K LSK +V + R+AV++DYYFQMYYDDLP WG++GKV+K+
Sbjct  83   VDAPYELNFREDKQSISLCTKTLSKENVAELRNAVSKDYYFQMYYDDLPFWGFLGKVEKD  142

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K DP+E KY LFKH+HFEI Y
Sbjct  143  -KLDPNENKYLLFKHIHFEILY  163



>ref|XP_008813153.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=590

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDRL
Sbjct  23   ADESDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK+S  +CKK LSK  V + R+AV++DYYFQMYYDDLP WG++GKV+K+
Sbjct  83   VDAPYELNFREDKQSMSLCKKTLSKEKVAELRNAVSKDYYFQMYYDDLPFWGFLGKVEKD  142

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K DPSE KY LFKH+HF+I Y
Sbjct  143  -KPDPSENKYLLFKHIHFDILY  163



>ref|XP_010910473.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=590

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDRL
Sbjct  23   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK+S  +C K LSK +V + R+AV++DYYFQMYYDDLP WG++GKV+K+
Sbjct  83   VDAPYELNFREDKQSISLCTKTLSKENVAELRNAVSKDYYFQMYYDDLPFWGFLGKVEKD  142

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K DP+E KY LFKH+HFEI Y
Sbjct  143  -KLDPNENKYLLFKHIHFEILY  163



>ref|XP_004972768.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Setaria 
italica]
Length=768

 Score =   208 bits (530),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 91/143 (64%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDH+YK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDR
Sbjct  201  RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDR  260

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  DK S+++C+K L+K  V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  261  LVDAPYELNFKEDKNSKILCEKTLTKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKMDK  320

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +   +  + KY LFKH+HF+I Y
Sbjct  321  D--REQGDAKYLLFKHIHFDIMY  341



>ref|XP_003616193.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=682

 Score =   207 bits (526),  Expect = 9e-59, Method: Composition-based stats.
 Identities = 92/143 (64%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK+GD V  YANKVGPFHNPSETY Y DLPFCSP NVE+K E LGEVLNGDRL
Sbjct  22   SDASDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCSPENVEEKKEDLGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL DK+ E +C+K L++ +V +FRHAV +DY++QMYYDDLP+WG++G+ + +
Sbjct  82   VVAPYKLEFLIDKKPESICQKMLTRKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGRFETD  141

Query  579  GKS-DPSEYKYYLFKHLHFEIFY  644
             K  D +E   YLF+++HFEI Y
Sbjct  142  EKDVDTNEATVYLFRNVHFEILY  164



>ref|XP_010037000.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48638.1| hypothetical protein EUGRSUZ_K02296 [Eucalyptus grandis]
Length=592

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S  S  RYK+G+ V LYANKVGPFHNPSETY Y DLP+C+P  V++K E LGEVLNGDRL
Sbjct  25   SSPSGQRYKEGEPVPLYANKVGPFHNPSETYRYFDLPYCTPDRVKEKKETLGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + +KL+FL  KE EV C+K LSK +V +FR A+ +DYYFQMYYDDLP+WG+IG +DK+
Sbjct  85   VSAPFKLEFLVSKEDEVACRKTLSKVEVARFRTAIIQDYYFQMYYDDLPIWGFIGMIDKD  144

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
            G+ DP+EYKY LFK + FEIFY
Sbjct  145  GR-DPNEYKYLLFKRVIFEIFY  165



>ref|XP_003544357.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=593

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DLPFCSPANVE+K E LGEVLNGDRL
Sbjct  24   SDASDHRYMKGDFVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D E E +C K+L+  +V +FRHAV +DY++QMYYDDLP+WG++GK D E
Sbjct  84   VVAPYKLDFQIDIEPESICTKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSE  143

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K D +    +LFKH+HFEI Y
Sbjct  144  DKDDQTGAIVHLFKHVHFEILY  165



>ref|XP_004240860.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322124.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
Length=591

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS HRYK GD+V  YANKVGPF NPSETY Y DLPFC P N+EKK E+ GE LNGDR
Sbjct  22   QSDASTHRYKSGDDVPFYANKVGPFSNPSETYAYFDLPFCQPDNLEKKKESFGEPLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            L+ + YKL+FLA+K+++V+CKK+L+K +V +FR AVA DYY QMYYDDLP+W ++GKV+K
Sbjct  82   LIFAPYKLEFLAEKDAKVICKKRLTKEEVAQFRTAVALDYYVQMYYDDLPIWAFLGKVEK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +G  DP+EY+Y+++    FEI+Y
Sbjct  142  DGIDDPNEYRYHIYTFYQFEIYY  164



>gb|EEE68090.1| hypothetical protein OsJ_26137 [Oryza sativa Japonica Group]
Length=864

 Score =   207 bits (526),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 93/143 (65%), Positives = 115/143 (80%), Gaps = 2/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDHRYK GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDR
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPSETYRYYDLPFCAPDHPKDKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ S+V+C+K LSK +V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  85   LVDAPYELNFKEDRNSKVLCQKSLSKVEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +   +    KY LFKH+HF+I Y
Sbjct  145  D--KEQGNAKYLLFKHIHFDIMY  165



>ref|XP_009784369.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=595

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 118/144 (82%), Gaps = 3/144 (2%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP--ANVEKKSEALGEVLNGDR  395
            DASDHRYK+GD V LYANKVGPFHNPSE+Y Y+DLPFC P    +E+K EALGEVLNGDR
Sbjct  26   DASDHRYKRGDPVPLYANKVGPFHNPSESYRYYDLPFCIPDKVKLEEKKEALGEVLNGDR  85

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKV-D  572
            LV   Y LDFL +K+ E++C+KKL+K +V +FR AV +DYYF+MYYD+LP+WG IG+V +
Sbjct  86   LVSGPYALDFLVEKDMEILCRKKLTKEEVAQFRRAVDKDYYFEMYYDELPIWGLIGRVEN  145

Query  573  KEGKSDPSEYKYYLFKHLHFEIFY  644
            +E   DP +YKYYL+KH+HF+I Y
Sbjct  146  REETDDPKDYKYYLYKHIHFDILY  169



>ref|XP_004490795.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=593

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SD+ DHRYK+GD V  YANKVGPFHNPSETY Y DLPFC+P NVE+K E LGEVLNGDR
Sbjct  24   KSDSLDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCAPDNVEEKKEDLGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YK+DFL +K+ E +C KKL++++V +FRHAV +DY++QMYYDDLP+WG++G+ + 
Sbjct  84   LVVAPYKMDFLINKKPESICGKKLTRNEVAQFRHAVLKDYFYQMYYDDLPIWGFLGRFEN  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            + K D +E   YLF+H+HFEI Y
Sbjct  144  DDKDDTNEATVYLFRHVHFEILY  166



>ref|XP_006358745.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=591

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS HRYK GD+V  YANKVGP+ NPSETY Y DLPFC P N+EKK E+ GE LNGD 
Sbjct  22   QSDASTHRYKSGDDVPFYANKVGPYFNPSETYAYFDLPFCQPDNLEKKKESFGEALNGDH  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            L  + YKL+FLADK+++V+CKK+L+K +V +FR AVA DYY QMYYDDLP+W ++GKVDK
Sbjct  82   LTFAPYKLEFLADKDAKVICKKRLTKEEVAQFRTAVALDYYVQMYYDDLPIWAFLGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +G  DP+EY+Y+++    FEI+Y
Sbjct  142  DGIDDPNEYRYHIYTFYQFEIYY  164



>ref|XP_009388099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388100.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=586

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY ++DLPFCSP +V +K EALGEVLNGDRL
Sbjct  19   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRFYDLPFCSPGHVTEKKEALGEVLNGDRL  78

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  +K+++ +CK+ LS+ DV K R AV++DYYFQMYYDDLP+WG++G+++K 
Sbjct  79   VDAPYELNFREEKQAKSLCKRTLSEGDVGKLRDAVSKDYYFQMYYDDLPLWGFLGRIEKN  138

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K D SE+KY LF H+HFEI Y
Sbjct  139  -KLDSSEFKYLLFLHIHFEILY  159



>ref|XP_006575472.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Glycine 
max]
Length=594

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPA--NVEKKSEALGEVLNGD  392
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DLPFCSPA  NVE+K E LGEVLNGD
Sbjct  24   SDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCSPAAANVEEKREDLGEVLNGD  83

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKLDF  D E E  CKK+L+  +V +FRHAV +DY++QMYYDDLP+WG++GK D
Sbjct  84   RLVAAPYKLDFQIDIEPESYCKKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFD  143

Query  573  KEGKSDPSEYKYYLFKHLHFEIFY  644
             E K D S    +LFKH+HFEI Y
Sbjct  144  SEDKDDQSGAIVHLFKHVHFEILY  167



>ref|XP_002521900.1| transporter, putative [Ricinus communis]
 gb|EEF40536.1| transporter, putative [Ricinus communis]
Length=588

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 118/143 (83%), Gaps = 6/143 (4%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P ++++K+EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKEKTEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K++ VVC+KKL+K +V +FR AV +DYYFQMYYDDLPVWG+IGK+DK
Sbjct  85   LVSAPYKLNFRDEKDTAVVCRKKLTKEEVGRFRSAVDKDYYFQMYYDDLPVWGFIGKIDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +      + KY+L+KH+ F++ Y
Sbjct  145  Q------DNKYFLYKHIQFDVLY  161



>gb|ABK24901.1| unknown [Picea sitchensis]
Length=585

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 111/142 (78%), Gaps = 4/142 (3%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
              ASDHRY +GD V LYANKVGPFHNPSETY Y DLPFC P  V +K E LGEVLNGDR+
Sbjct  21   GSASDHRYSKGDHVPLYANKVGPFHNPSETYRYFDLPFCPPDKVTEKREDLGEVLNGDRM  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL F  DK SE++C+KKL+K D+EKFR AV +DYYFQMYYDDLP+WG+IGK D+E
Sbjct  81   VDARYKLHFQDDKNSELLCRKKLTKDDLEKFREAVKKDYYFQMYYDDLPIWGFIGKTDRE  140

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
              +DP    + L+KHLHFEI Y
Sbjct  141  TNADP----FLLYKHLHFEILY  158



>gb|AES99151.2| transmembrane 9 family protein [Medicago truncatula]
Length=591

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK+GD V  YANKVGPFHNPSETY Y DLPFCSP NVE+K E LGEVLNGDRL
Sbjct  22   SDASDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCSPENVEEKKEDLGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL DK+ E +C+K L++ +V +FRHAV +DY++QMYYDDLP+WG++G+ + +
Sbjct  82   VVAPYKLEFLIDKKPESICQKMLTRKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGRFETD  141

Query  579  GK-SDPSEYKYYLFKHLHFEIFY  644
             K  D +E   YLF+++HFEI Y
Sbjct  142  EKDVDTNEATVYLFRNVHFEILY  164



>ref|XP_009408099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=589

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D  DHRYK+GD V LYANKVGPFHNPSETY ++DLPFCSP +V +K EALGEVLNGDRL
Sbjct  22   ADGRDHRYKEGDHVPLYANKVGPFHNPSETYRFYDLPFCSPDHVTEKKEALGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  +K S+ +CKK LSK DV K R AV++DYYFQMYYDDLP+WG++G++ K+
Sbjct  82   VDAPYELNFREEKRSKSLCKKALSKKDVGKLRDAVSKDYYFQMYYDDLPLWGFLGRIKKD  141

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K+D S+ KY LFKH+HFEI Y
Sbjct  142  -KTDSSKSKYLLFKHIHFEILY  162



>ref|XP_009615617.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=596

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 119/145 (82%), Gaps = 4/145 (3%)
 Frame = +3

Query  222  DASD-HRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANV--EKKSEALGEVLNGD  392
            DASD HRYK+GD V LYANKVGPFHNPSE+Y Y+DLPFC P  V  E+K EALGEVLNGD
Sbjct  26   DASDDHRYKRGDPVPLYANKVGPFHNPSESYRYYDLPFCIPDKVKLEEKKEALGEVLNGD  85

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKV-  569
            RLV   Y LDFL +K+SE++C+KKL+K +V +FR AV +DYYF+MYYDDLP+WG IG+V 
Sbjct  86   RLVSGPYALDFLVEKDSEILCRKKLTKEEVAQFRKAVDKDYYFEMYYDDLPIWGLIGRVE  145

Query  570  DKEGKSDPSEYKYYLFKHLHFEIFY  644
            +KE   DP +YKY+++KH+HF+I Y
Sbjct  146  NKEETEDPKDYKYFMYKHIHFDIHY  170



>ref|XP_008356706.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Malus domestica]
Length=421

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 109/143 (76%), Gaps = 12/143 (8%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSE Y Y DLPFCSP  V +K EALG       
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSEAYGYFDLPFCSPDAVTEKGEALG-------  77

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
                 YKL+FL  K+ EV CKK L+K +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  78   -----YKLEFLRHKDPEVACKKTLTKEEVGRFRSAVNKDYYFQMYYDDLPIWGFIGKVDK  132

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK  PSEYK YL+KH+HF+++Y
Sbjct  133  EGKDPPSEYKTYLYKHIHFDLYY  155



>ref|NP_001148367.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACG31130.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN29105.1| unknown [Zea mays]
 gb|AFW57246.1| putative Transmembrane 9 family protein member 1 [Zea mays]
Length=589

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDH+YK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDR
Sbjct  22   RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ S+V+CKK LSK  V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  82   LVDAPYELNFKEDRNSKVLCKKVLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +   +  + KY LFKH+HF+I Y
Sbjct  142  D--KEQGDVKYLLFKHIHFDIMY  162



>gb|EEC82941.1| hypothetical protein OsI_27915 [Oryza sativa Indica Group]
Length=592

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 115/143 (80%), Gaps = 2/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDHRYK GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDR
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPSETYRYYDLPFCAPDHPKDKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ S+V+C+K LSK +V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  85   LVDAPYELNFKEDRNSKVLCQKSLSKVEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +   +    KY LFKH+HF+I Y
Sbjct  145  D--KEQGNAKYLLFKHIHFDIMY  165



>ref|XP_004972769.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Setaria 
italica]
Length=589

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDH+YK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDR
Sbjct  22   RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  DK S+++C+K L+K  V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  82   LVDAPYELNFKEDKNSKILCEKTLTKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKMDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            +   +  + KY LFKH+HF+I Y
Sbjct  142  D--REQGDAKYLLFKHIHFDIMY  162



>ref|XP_003573450.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=588

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDRL
Sbjct  22   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK S+ +CKK LSK +V K R AVA+DYYFQMYYDDLP+WG++GK++K+
Sbjct  82   VDAPYELNFKEDKNSKTLCKKTLSKEEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLEKD  141

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             +      KY LFKH+HF+I Y
Sbjct  142  KEQGAG--KYLLFKHIHFDIMY  161



>gb|EPS73381.1| hypothetical protein M569_01372, partial [Genlisea aurea]
Length=584

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSL  410
            +H YK GD V LYANKVGPF NPSETY Y+ LPFCSP ++E+K EALGEVLNGDRLV + 
Sbjct  17   NHVYKAGDLVPLYANKVGPFRNPSETYRYYYLPFCSPGDIEEKKEALGEVLNGDRLVSAP  76

Query  411  YKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSD  590
            YKL F  D E++ VCKKKL+  +   FR+A+++ Y F+MY+DDLP+WG++GK++ EGK+ 
Sbjct  77   YKLHFKQDVETKTVCKKKLTMKEGALFRYAISKSYTFEMYFDDLPIWGFVGKIEGEGKTV  136

Query  591  PSEYKYYLFKHLHFEIFY  644
            PSE++YYLF HLHF+I Y
Sbjct  137  PSEFRYYLFNHLHFDILY  154



>gb|ABR16201.1| unknown [Picea sitchensis]
Length=585

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            SDH+Y +GD V LYANKVGPF NPSETY Y DLPFC P ++ +K E LGEVLNGDR+V +
Sbjct  23   SDHKYSKGDHVPLYANKVGPFQNPSETYRYFDLPFCQPEHMTEKREDLGEVLNGDRMVDA  82

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
             YKLDF  DKESEV+CKKK    DV KFR AV   YYFQMYYDDLP+WG+IGKV+KE K 
Sbjct  83   QYKLDFNVDKESEVLCKKKFKAEDVAKFREAVKNSYYFQMYYDDLPLWGFIGKVEKESKI  142

Query  588  DPSEYKYYLFKHLHFEI  638
            D    KY LF HLHF+I
Sbjct  143  DQ---KYSLFTHLHFDI  156



>ref|XP_006659860.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=590

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK  D V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDRL
Sbjct  24   ADGSDHRYKDRDYVPLYANKVGPFHNPSETYRYYDLPFCAPDHPKDKREALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  D+ S+++C+K LSK++V K R AVA+DYYFQMYYDDLP+WG++GK+DK+
Sbjct  84   VDAPYELNFKEDRTSKILCQKTLSKAEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDKD  143

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
               +    KY LFKH+HF+I Y
Sbjct  144  --KEQGNAKYLLFKHIHFDIMY  163



>emb|CDP05449.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS HRY+QGD V LY NKV PFHNPSET+ Y+ LPFC P  + +K E+L EVLNG  
Sbjct  24   KSDASKHRYQQGDSVPLYGNKVAPFHNPSETHAYYSLPFCRPDPLIEKRESLIEVLNGYH  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL     +V+C+K L++ +  +FR A+ +DY+++MYYDDLP+WG IGKVD+
Sbjct  84   LVSAPYKLDFLIKSGLQVLCRKNLTREEAFQFRTALVQDYFWEMYYDDLPLWGSIGKVDR  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
            EGK+ P EYKY+++  +HF IF+
Sbjct  144  EGKASPEEYKYFIYTRIHFNIFF  166



>gb|KHN39489.1| Putative phagocytic receptor 1b [Glycine soja]
Length=561

 Score =   189 bits (480),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  246  QGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDF  425
            +GD V  YANKVGPFHNPSETY Y DLPFCSPANVE+K E LGEVLNGDRLV + YKLDF
Sbjct  2    KGDFVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGDRLVVAPYKLDF  61

Query  426  LADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYK  605
              D E E +C K+L+  +V +FRHAV +DY++QMYYDDLP+WG++GK D E K D +   
Sbjct  62   QIDIEPESICTKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSEDKDDQTGAI  121

Query  606  YYLFKHLHFEIFY  644
             +LFKH+HFEI Y
Sbjct  122  VHLFKHVHFEILY  134



>gb|EMT19161.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=590

 Score =   189 bits (481),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDRL
Sbjct  24   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKREALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  D  S+ +CKK LSK  V K R AVA+DYYFQMYYDDLP+WG++GK+D+ 
Sbjct  84   VDAPYELNFKEDTNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDRN  143

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             +      K  LFKH+HF+I Y
Sbjct  144  KEHGGG--KCLLFKHIHFDIMY  163



>ref|XP_006661606.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=586

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            + A  HR++ GD V LYANKVGPFHNPSETY Y DLPFC+P  V+ K EALGEVLNGDRL
Sbjct  21   ATADSHRFRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPDKVKDKIEALGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +++ VC KKL+K DV KFRHAV++DYYFQMYYDDLP+WG+IG   K 
Sbjct  81   VDAPYKLDFRVDYDAKFVCSKKLTKDDVIKFRHAVSKDYYFQMYYDDLPLWGFIGT--KP  138

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K+D  + KYYL++HL F+I Y
Sbjct  139  EKADGGD-KYYLYRHLIFDILY  159



>ref|NP_001064040.1| Os10g0112600 [Oryza sativa Japonica Group]
 gb|AAP51848.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF25954.1| Os10g0112600 [Oryza sativa Japonica Group]
 dbj|BAG94270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=585

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            + A  HRY+ GD V LYANKVGPFHNPSETY Y DLPFC+P  V+ K EALGEVLNGDRL
Sbjct  20   AAADSHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPEKVKDKIEALGEVLNGDRL  79

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +++ VC ++LSK DV KFRHAV++DYYFQMYYDDLP WG+IG   K 
Sbjct  80   VDAPYKLDFRVDFDAKSVCSRRLSKDDVVKFRHAVSKDYYFQMYYDDLPFWGFIGT--KP  137

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K+D  + KYYL++H+ F+I Y
Sbjct  138  EKADAGD-KYYLYRHIIFDILY  158



>gb|EMS60954.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=590

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDH+YK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDRL
Sbjct  24   ADGSDHKYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKREALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  D  S+ +CKK LSK  V K R AVA+DYYFQMYYDDLP+WG++GK+D+ 
Sbjct  84   VDAPYELNFKEDTNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDRN  143

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             +      K  LFKH+HF+I Y
Sbjct  144  KEHGGG--KCLLFKHIHFDIMY  163



>gb|EEC66468.1| hypothetical protein OsI_32547 [Oryza sativa Indica Group]
Length=631

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            + A  HRY+ GD V LYANKVGPFHNPSETY Y DLPFC+P  V+ K EALGEVLNGDRL
Sbjct  21   AAADSHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPEKVKDKIEALGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +++ VC ++LSK DV KFRHAV++DYYFQMYYDDLP WG+IG   K 
Sbjct  81   VDAPYKLDFRVDFDAKSVCSRRLSKDDVVKFRHAVSKDYYFQMYYDDLPFWGFIGT--KP  138

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K+D  + KYYL++H+ F+I Y
Sbjct  139  EKADAGD-KYYLYRHIIFDILY  159



>gb|AAK52585.1|AC079685_16 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|AAM44876.1|AC098694_15 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|EAZ15105.1| hypothetical protein OsJ_30519 [Oryza sativa Japonica Group]
Length=627

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            + A  HRY+ GD V LYANKVGPFHNPSETY Y DLPFC+P  V+ K EALGEVLNGDRL
Sbjct  17   AAADSHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPEKVKDKIEALGEVLNGDRL  76

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +++ VC ++LSK DV KFRHAV++DYYFQMYYDDLP WG+IG   K 
Sbjct  77   VDAPYKLDFRVDFDAKSVCSRRLSKDDVVKFRHAVSKDYYFQMYYDDLPFWGFIGT--KP  134

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             K+D  + KYYL++H+ F+I Y
Sbjct  135  EKADAGD-KYYLYRHIIFDILY  155



>ref|XP_001770691.1| predicted protein [Physcomitrella patens]
 gb|EDQ64515.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 110/143 (77%), Gaps = 5/143 (3%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP-ANVEKKSEALGEVLNGDR  395
              +S+H+Y  GD V LYANKVGPFHNPSETY Y DLPFC P   V +K EALGEVLNGDR
Sbjct  25   GSSSNHKYGAGDPVPLYANKVGPFHNPSETYKYFDLPFCHPKGEVTEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            +V +LY+L F  DKE E++C+K L+K+D++KFR AV  DYYFQMYYDDLP+WG++GK++K
Sbjct  85   MVEALYELKFKQDKEMEILCEKPLTKNDIKKFRDAVKNDYYFQMYYDDLPIWGFVGKIEK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
             G+    + KY L  H+HF+I Y
Sbjct  145  SGQ----DVKYSLNTHVHFDIQY  163



>dbj|BAJ89513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 109/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK GD V LYANK+GPFHNPSETY Y+DL FC+P + + K EALGEVLNGDRL
Sbjct  24   ADGSDHRYKAGDRVPLYANKIGPFHNPSETYRYYDLSFCAPDHPKDKREALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  D  S+ +CKK LSK  V K R AVA+DYYFQMYYDDLP+WG++GK++K+
Sbjct  84   VDAPYELNFKEDMNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLEKD  143

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             +      K  LFKH+HF+I Y
Sbjct  144  KERGGG--KCLLFKHIHFDIMY  163



>ref|XP_001775546.1| predicted protein [Physcomitrella patens]
 gb|EDQ59629.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 108/143 (76%), Gaps = 5/143 (3%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPAN-VEKKSEALGEVLNGDR  395
            +  S+H+Y  GD V LYANKVGPFHNPSETY Y DLPFC P   V +K EALGEVLNGDR
Sbjct  25   ASGSNHKYATGDPVPLYANKVGPFHNPSETYKYFDLPFCHPVGEVTEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            +V +LY+L F  DKE + +C+K L+K D++KF+ AV  DY+F+MYYDDLP+WGY+GK + 
Sbjct  85   MVEALYELRFRVDKEMKTLCEKTLTKDDIKKFQDAVKNDYFFEMYYDDLPIWGYVGKKED  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
             G+    + KY+L+ H+HFEI Y
Sbjct  145  SGQ----DVKYFLYTHVHFEILY  163



>ref|XP_004228944.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=594

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 111/141 (79%), Gaps = 3/141 (2%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANV--EKKSEALGEVLNGDRLVH  404
            DH YKQGD V L+ANK+GPFHNPSE+Y Y+DLPFC P +V  E+  E +GEVLNGDRL+ 
Sbjct  32   DHFYKQGDHVPLFANKIGPFHNPSESYRYYDLPFCIPDHVKLEENKEDVGEVLNGDRLMS  91

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKV-DKEG  581
              Y LDFL DK+SE++C+KKL+K +V +FR AV +DYYF+MYYD+LP+WG IG+V ++E 
Sbjct  92   GPYALDFLVDKDSEILCRKKLTKDEVAQFRRAVDKDYYFEMYYDELPIWGLIGRVENREV  151

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
              D   Y Y+L+KH+HF+I Y
Sbjct  152  TEDTKYYSYFLYKHIHFDIHY  172



>ref|XP_010521657.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Tarenaya 
hassleriana]
Length=590

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S  SDHRY  GD V L+ NKVGPFHNPSETY Y+DLPFC P  V  K E LGEVLNGDRL
Sbjct  23   SSPSDHRYNVGDHVPLFVNKVGPFHNPSETYQYYDLPFCHPEPVILKQETLGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
              SLY+L F  +K    +C K+ + ++V K R A+A+D+YFQMYYDDLP+WG++GKV+ +
Sbjct  83   TSSLYELKFREEKSGAALCSKRFAPNEVAKLRDAIAQDFYFQMYYDDLPLWGFLGKVEGD  142

Query  579  --GKSDPSEYKYYLFKHLHFEIFY  644
              G+ +    KYYLFKHL F + Y
Sbjct  143  YLGRGEKKHDKYYLFKHLQFNVLY  166



>ref|XP_011003770.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Populus euphratica]
Length=586

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 105/142 (74%), Gaps = 6/142 (4%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRY+QGD+V  Y NKVGPFHNPSETY Y DLP+C P   ++K  +LGEVLNGDRL
Sbjct  25   SDESDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYCLPDKTKEKRLSLGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V   + ++FL ++ S  VCKKKLSK DV KFR  + EDYY+QMY+DDLP+WG++G V+KE
Sbjct  85   VSRPFPIEFLRERNSVPVCKKKLSKEDVAKFRAVIHEDYYYQMYFDDLPIWGFLGMVNKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
                  + +YYLF H+   I+Y
Sbjct  145  ------QQRYYLFNHILLNIYY  160



>emb|CDP05446.1| unnamed protein product [Coffea canephora]
Length=585

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 107/143 (75%), Gaps = 3/143 (2%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDA  H+Y++GD V LYAN VGPFHNPSETY Y+ LPFC P + E+K    GEVLNGDR
Sbjct  22   KSDAFTHKYEKGDPVPLYANTVGPFHNPSETYPYYSLPFCPPDHWEEKKGTFGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  D+ES+V+C+K L++ +V +FR  +A+DYY QMYYDDLP+W +IGK+  
Sbjct  82   LVSAPYKLDFRVDRESQVLCRKNLTREEVSQFRTVIAQDYYLQMYYDDLPMWAFIGKI--  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFY  644
                 P+  +Y+++  +HFEI+Y
Sbjct  140  -ANGSPNGSRYFIYTKMHFEIYY  161



>ref|XP_006849484.1| hypothetical protein AMTR_s00024p00115000 [Amborella trichopoda]
 gb|ERN11065.1| hypothetical protein AMTR_s00024p00115000 [Amborella trichopoda]
Length=590

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 109/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDA D RYK GD V LYA K+GP HNPSETY Y+D+PFCSP +V +K E  GE LNGD L
Sbjct  24   SDAFDQRYKHGDFVPLYATKIGPSHNPSETYRYYDMPFCSPEHVTEKKETFGEFLNGDHL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+F  +KESE+ C KKLSK +V +FR+A+ +DYYFQMYYDDLP+W + G+ ++ 
Sbjct  84   VDAPYKLEFRVNKESEIACGKKLSKGEVAQFRNAILKDYYFQMYYDDLPIWSFFGRTEEG  143

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
             ++D  E+KY L+K+++F+I Y
Sbjct  144  NRAD--EFKYLLYKNINFDILY  163



>ref|XP_002892454.1| endomembrane protein 70 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68713.1| endomembrane protein 70 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=589

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 105/143 (73%), Gaps = 3/143 (2%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
              S +RY  GD V L+ NKVGP HNPSETY Y+DLPFC P  V +K E LGEVLNGDRL+
Sbjct  23   SGSSNRYNAGDHVPLFVNKVGPLHNPSETYQYYDLPFCRPEPVIEKQETLGEVLNGDRLM  82

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE-  578
             SLY+L F  DK   V+C+K+L+ SDV +FR  +A+DYYFQMYYDDLP+WG++GKV+++ 
Sbjct  83   SSLYELKFREDKTHLVLCRKRLTSSDVARFRDTIAQDYYFQMYYDDLPLWGFVGKVERDY  142

Query  579  -GKSDPSEYKYYLFKHLHFEIFY  644
             G+ +    KYY+F HL F + Y
Sbjct  143  FGQEE-KHTKYYIFSHLKFNVLY  164



>ref|XP_006364083.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=597

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 111/141 (79%), Gaps = 3/141 (2%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANV--EKKSEALGEVLNGDRLVH  404
            DH YK GD V L A+K+GPFHNPSE+Y Y+DLPFC P +V  E+K E LGEVLN DRLV 
Sbjct  32   DHFYKHGDHVRLSASKIGPFHNPSESYRYYDLPFCIPDHVKLEEKKEDLGEVLNEDRLVS  91

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKV-DKEG  581
              Y+LDFL DK+SE++C+KKL+K +V +FR AV +DYYF+MYYD+LPVWG IG+V ++E 
Sbjct  92   GPYELDFLVDKDSEMLCRKKLTKDEVAQFRRAVDKDYYFEMYYDELPVWGLIGRVENREE  151

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
              D   YKY+L+KH+HF+I Y
Sbjct  152  TEDTKYYKYFLYKHIHFDIHY  172



>ref|XP_006361076.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=589

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +  +DHRY  GDEV L+ NKVGP +NPSETY Y+DLPFC P  +  + E+LGEVLNGDRL
Sbjct  23   ASLNDHRYNIGDEVPLFVNKVGPLNNPSETYQYYDLPFCQPGELLPEKESLGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
             ++LY+L F A+K+  V+C KKL ++DV KFR A+ +DYY+QMY+DDLP WG++GK++ E
Sbjct  83   TNTLYQLKFGAEKDGVVLCHKKLDQNDVSKFRAAIIKDYYYQMYFDDLPFWGFVGKIEDE  142

Query  579  GKS-DPSEYKYYLFKHLHFEIFY  644
              + D    KY+LFKH+ F++ Y
Sbjct  143  LWTLDGKGPKYFLFKHVQFDVLY  165



>ref|XP_009592973.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=590

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +  +DHRY  GDEV L  NK+GP +NPSETY Y+DLPFC P  V  K E+LGEVLNGDRL
Sbjct  24   ASPNDHRYNFGDEVPLSVNKIGPLNNPSETYQYYDLPFCQPGEVLPKKESLGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
             ++LY+L F  DK+  V+C+KKL+++DV KFR A+ +DYY+QMY+DDLP WG++GK++ E
Sbjct  84   TNTLYQLKFGVDKDGVVLCQKKLNQNDVSKFRDAIIKDYYYQMYFDDLPFWGFVGKIEDE  143

Query  579  GKS-DPSEYKYYLFKHLHFEIFY  644
              + D    KY+LFKH+ F++ +
Sbjct  144  HWTLDGKGPKYFLFKHVQFDVLH  166



>ref|XP_010322438.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Solanum 
lycopersicum]
Length=507

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +  +DHRY  GDEV L+ NKVGP  NPSETY Y+DLPFC P  +  + E+LGEVLNGDRL
Sbjct  23   ASLNDHRYNIGDEVPLFVNKVGPLSNPSETYQYYDLPFCQPGELLPEKESLGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
             ++LY+L F  +K+  V+C KKL ++DV KFR A+ +DYY+QMY+DDLP WG++GK++ E
Sbjct  83   TNTLYQLKFGVEKDGVVLCHKKLDQNDVSKFRTAIIKDYYYQMYFDDLPFWGFVGKIEDE  142

Query  579  GKS-DPSEYKYYLFKHLHFEIFY  644
              + D    KY+LFKH+ F++ Y
Sbjct  143  LWTLDGKGPKYFLFKHVQFDVLY  165



>emb|CAN67239.1| hypothetical protein VITISV_004804 [Vitis vinifera]
Length=920

 Score =   180 bits (457),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 80/141 (57%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  225  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVH  404
            A DHRY  GD V L+ NKVGP +NPSETY Y+DLPFC P  V ++  +LGEVLNGD L +
Sbjct  28   AQDHRYNVGDHVSLFVNKVGPLNNPSETYHYYDLPFCRPDQVIRRKASLGEVLNGDCLTN  87

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGK  584
            +LY+L F  +K  E +C+KKL   +V KFR+AV+ D+YFQMYYDDLP+WG+IGKV+ E  
Sbjct  88   ALYELKFRENKIGETLCQKKLKGDEVAKFRNAVSNDFYFQMYYDDLPLWGFIGKVEDENW  147

Query  585  S-DPSEYKYYLFKHLHFEIFY  644
            + + +  KYYLFKH+ F+  Y
Sbjct  148  TVNENGPKYYLFKHVQFDALY  168



>gb|KDP33127.1| hypothetical protein JCGZ_13574 [Jatropha curcas]
Length=587

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S  +DHRY   D V L+ NK+GP HNPSETY Y+DLPFC P NV  K E LGEVLNGDRL
Sbjct  21   SSPTDHRYNVRDNVPLFVNKIGPLHNPSETYQYYDLPFCRPDNVISKKETLGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
              SLY L F  DK    +CKKKL K ++ +FR A+  D+YFQMYYDDLP+WG+IGK +++
Sbjct  81   SSSLYDLKFREDKTGVTLCKKKLEKDELLRFRDAIINDFYFQMYYDDLPLWGFIGKFEEQ  140

Query  579  GKS-DPSEYKYYLFKHLHFEIFY  644
                   + KYYLFKH+HF++ Y
Sbjct  141  SWILGEKKLKYYLFKHVHFDVLY  163



>ref|XP_002317710.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|EEE95930.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=594

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 103/142 (73%), Gaps = 6/142 (4%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD  DHRY+QGD+V  Y NKVGPFHNPSETY Y DLP+C P   ++K  +LGEVLNGDRL
Sbjct  26   SDEPDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYCLPDRAKEKRLSLGEVLNGDRL  85

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V   + ++FL +++S  VCKKKLSK DV KFR  V EDYY+QMY+DDLP W ++G VDK 
Sbjct  86   VSGPFPIEFLRERKSVPVCKKKLSKEDVAKFRAVVHEDYYYQMYFDDLPNWVFLGMVDKR  145

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
                  + +YYLF H+H  I+Y
Sbjct  146  ------QQRYYLFNHIHLNIYY  161



>ref|XP_005650990.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26446.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
Length=624

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 110/146 (75%), Gaps = 7/146 (5%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP-ANVEKKSEALGEVLNGDRLVH  404
            SDHRY   D + LYANKVGPF NPSETY Y++LPFC+P    E K+E LGEVL GDRLV+
Sbjct  52   SDHRYDMHDPIKLYANKVGPFSNPSETYQYYNLPFCTPEGGKEYKTEGLGEVLEGDRLVN  111

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK---  575
            + Y + F  DKE+E++C ++L+  D++KFR AV +DYYFQM+YDDLP+WG+IGKV+K   
Sbjct  112  TPYSIKFRVDKENEILCSRELTAKDLKKFRKAVKKDYYFQMFYDDLPIWGFIGKVEKIMS  171

Query  576  --EGKS-DPSEYKYYLFKHLHFEIFY  644
               GK+ +  + +YYLF H+HF+I Y
Sbjct  172  QPGGKTWEKHDLRYYLFTHIHFDILY  197



>ref|XP_004241321.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
Length=589

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +  +DHRY  GDEV L+ NKVGP  NPSETY Y+DLPFC P  +  + E+LGEVLNGDRL
Sbjct  23   ASLNDHRYNIGDEVPLFVNKVGPLSNPSETYQYYDLPFCQPGELLPEKESLGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
             ++LY+L F  +K+  V+C KKL ++DV KFR A+ +DYY+QMY+DDLP WG++GK++ E
Sbjct  83   TNTLYQLKFGVEKDGVVLCHKKLDQNDVSKFRTAIIKDYYYQMYFDDLPFWGFVGKIEDE  142

Query  579  GKS-DPSEYKYYLFKHLHFEIFY  644
              + D    KY+LFKH+ F++ Y
Sbjct  143  LWTLDGKGPKYFLFKHVQFDVLY  165



>ref|XP_007208295.1| hypothetical protein PRUPE_ppa003325mg [Prunus persica]
 gb|EMJ09494.1| hypothetical protein PRUPE_ppa003325mg [Prunus persica]
Length=585

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 104/139 (75%), Gaps = 1/139 (1%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSL  410
            D  Y  GD V L+ NKVGP +NPSETY Y+DLPFC P  V +K E++GEVLNGDRL ++L
Sbjct  24   DRSYNVGDHVPLFVNKVGPLNNPSETYQYYDLPFCCPDPVIQKKESIGEVLNGDRLANTL  83

Query  411  YKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSD  590
            Y+L+F  DK  E +C+KKL  ++V KFR A+  D+YFQMYYDDLPVWG+IGKV+ E  + 
Sbjct  84   YQLNFRQDKNGESLCQKKLKVAEVAKFRDAIVNDFYFQMYYDDLPVWGFIGKVEDESWTI  143

Query  591  PSE-YKYYLFKHLHFEIFY  644
              +  KYYLFKH+ F++FY
Sbjct  144  SDKGTKYYLFKHVLFDVFY  162



>ref|XP_002523798.1| transporter, putative [Ricinus communis]
 gb|EEF38524.1| transporter, putative [Ricinus communis]
Length=499

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S  ++HRY  GD V L+ NKVGP HNPSETY Y++ PFC P NV  K E LGEVLNGDRL
Sbjct  21   SSPANHRYNVGDHVPLFVNKVGPLHNPSETYPYYNFPFCCPDNVILKKETLGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
              +LY+ +F  DK    +CKKKL + +V +FR A+  D+YFQMYYDDLP+WG+IGKV+++
Sbjct  81   SSTLYEANFREDKTGVTLCKKKLKRDEVLRFRDAIVNDFYFQMYYDDLPLWGFIGKVEEQ  140

Query  579  G-KSDPSEYKYYLFKHLHFEIFY  644
                   +++YYLFKHL F++ Y
Sbjct  141  SWVVGERKFRYYLFKHLQFDVLY  163



>ref|XP_009779343.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=610

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 109/143 (76%), Gaps = 1/143 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +  +DHRY  GDEV L+ NKVGP +NPSETY Y+DLPFC P  +  ++E+LGEVLNGDRL
Sbjct  44   ASPNDHRYNFGDEVPLFVNKVGPLNNPSETYQYYDLPFCQPGELLPENESLGEVLNGDRL  103

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
             ++LY+L F  DK+  V+C KKL+++DV KFR+A+ +DYY+QMY+DDLP WG+ GK++ E
Sbjct  104  TNTLYRLKFGVDKDGVVLCHKKLNQNDVSKFRNAIIKDYYYQMYFDDLPFWGFFGKIEDE  163

Query  579  GKS-DPSEYKYYLFKHLHFEIFY  644
              + D    KY+LFKH+ F++ +
Sbjct  164  HWTLDGKGPKYFLFKHVQFDVLH  186



>ref|XP_006376703.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|ERP54500.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=625

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 103/142 (73%), Gaps = 6/142 (4%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD  DHRY+QGD+V  Y NKVGPFHNPSETY Y DLP+C P   ++K  +LGEVLNGDRL
Sbjct  57   SDEPDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYCLPDRAKEKRLSLGEVLNGDRL  116

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V   + ++FL +++S  VCKKKLSK DV KFR  V EDYY+QMY+DDLP W ++G VDK 
Sbjct  117  VSGPFPIEFLRERKSVPVCKKKLSKEDVAKFRAVVHEDYYYQMYFDDLPNWVFLGMVDKR  176

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
                  + +YYLF H+H  I+Y
Sbjct  177  ------QQRYYLFNHIHLNIYY  192



>ref|XP_010045209.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW87373.1| hypothetical protein EUGRSUZ_B03852 [Eucalyptus grandis]
Length=594

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 103/144 (72%), Gaps = 3/144 (2%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +   DHRY  GD V L+AN+VGP  NPSETY YHD PFC P  +  K  +LGEVLNGDRL
Sbjct  28   ASPEDHRYNVGDPVPLFANRVGPLRNPSETYEYHDFPFCRPDPLIWKKGSLGEVLNGDRL  87

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
             +SLY L F   K+ E++C+KKL  SDV + R+AV ED+YFQMYYDDLP+WG+IGKV+  
Sbjct  88   TNSLYNLKFREVKDGEILCEKKLKISDVARLRNAVNEDFYFQMYYDDLPMWGFIGKVENS  147

Query  579  GKSDPSEY--KYYLFKHLHFEIFY  644
              S P E   +YYLFKH+ F+ FY
Sbjct  148  SWS-PVEKGPRYYLFKHVQFDAFY  170



>gb|EPS73142.1| hypothetical protein M569_01612 [Genlisea aurea]
Length=540

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 3/114 (3%)
 Frame = +3

Query  303  ETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKSDV  482
            ETY Y DLPFCSP +V+ KSEALGEVLNGDRLV + YKL+FL DK+SEV+C KKLSK +V
Sbjct  3    ETYRYFDLPFCSPGDVKDKSEALGEVLNGDRLVSAPYKLEFLVDKDSEVICTKKLSKKEV  62

Query  483  EKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFY  644
             +FR AVA+DYYFQMYYDDLPVWG++GKVD    +DP++ KYYLFKHLHFEI Y
Sbjct  63   SEFRTAVAKDYYFQMYYDDLPVWGFLGKVD---TTDPADNKYYLFKHLHFEILY  113



>ref|XP_001699211.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO98851.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=594

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 106/141 (75%), Gaps = 3/141 (2%)
 Frame = +3

Query  225  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANV-EKKSEALGEVLNGDRLV  401
             SDH++K G ++ LYANKVGPF NP+ETY Y++LPFC P +  E K+E LGEVL GDRLV
Sbjct  29   GSDHKFKPGSDIMLYANKVGPFQNPTETYQYYNLPFCQPTDGKEYKTEFLGEVLEGDRLV  88

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKL F  D E+ V+CK+ L+  D++KFR AV +DYYFQM+YDDLPVWG+IGKV+K  
Sbjct  89   TTPYKLQFRTDVENAVLCKRTLTAGDLKKFRDAVKQDYYFQMFYDDLPVWGFIGKVEKIV  148

Query  582  KSDPSEYKYYLFKHLHFEIFY  644
            +     +KY+LF H HF++ Y
Sbjct  149  QQ--GTHKYFLFTHFHFDLSY  167



>ref|XP_003059958.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55910.1| predicted protein [Micromonas pusilla CCMP1545]
Length=614

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPAN-VEKKSEALGEVLNGD  392
            R  AS H Y   D+V LYANKVGPFHNPSETY Y+DLPFC PA+    K E LGEVL GD
Sbjct  44   RLLASSHSYLVRDDVPLYANKVGPFHNPSETYQYYDLPFCEPADGAVSKREDLGEVLEGD  103

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            R+  + Y++ F  D+E+E +C++ LS +D++KFR AV +DYYFQMYYDDLP+WG++GK++
Sbjct  104  RMSSTPYQVPFRVDRENESLCERTLSANDLKKFRRAVKDDYYFQMYYDDLPIWGFVGKIE  163

Query  573  KEGKSDPSEYKYYLFKHLHFEIFY  644
            K       E +YYLF H+HF++ Y
Sbjct  164  KILNPGAPELRYYLFTHVHFDVAY  187



>emb|CDX95066.1| BnaC05g06050D [Brassica napus]
Length=585

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 99/143 (69%), Gaps = 2/143 (1%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
              S  RY  GD V L+ NKVGP HNPSETY Y+DLPFC P  V +K E LGEVLNGDR +
Sbjct  18   SGSSTRYNAGDHVPLFVNKVGPLHNPSETYQYYDLPFCRPEPVIEKQETLGEVLNGDRFM  77

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             SLY L F  DK   V+C K+L+ S+V +FR  +A+D+YFQMYYDDLP+WG++GKV+++ 
Sbjct  78   SSLYDLKFKEDKTDSVLCHKRLTSSEVARFRDTIAQDFYFQMYYDDLPLWGFVGKVERDY  137

Query  582  KSDPSE--YKYYLFKHLHFEIFY  644
                 E   KYYLF HL F + Y
Sbjct  138  SVHGGEENAKYYLFSHLSFNVLY  160



>gb|AAF22904.1|AC006932_21 T27G7.5 [Arabidopsis thaliana]
Length=536

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S +S+H Y  GD V L+ NKVGP HNPSETY Y+DLPFC    V +K E LGEVLNGDRL
Sbjct  23   SGSSNH-YNAGDHVPLFVNKVGPLHNPSETYQYYDLPFCRRGPVIEKQETLGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            + SLYKL F  DK   V+C+K+L+ SD+ +FR  +A+DYYFQMYYDDLP+WG++GKV+ +
Sbjct  82   MSSLYKLKFREDKTHFVLCRKRLTSSDIARFRDIIAQDYYFQMYYDDLPLWGFVGKVEGD  141

Query  579  --GKSDPSEYKYYLFKHLHFEIFY  644
              G+ +    KYY+F HL F + Y
Sbjct  142  YFGQGE-KHTKYYIFSHLKFNVLY  164



>ref|XP_008228600.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
Length=592

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 102/139 (73%), Gaps = 1/139 (1%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSL  410
            D  Y  GD V LY NKVGP +NPSETY Y+DLPFC P  + +K E++GEVLNGDRL ++L
Sbjct  31   DRSYNVGDHVPLYVNKVGPLNNPSETYQYYDLPFCCPDPIIQKKESIGEVLNGDRLANTL  90

Query  411  YKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSD  590
            Y+L+F  DK  E +C+KKL  ++V KFR  +  D+YFQMYYDDLP WG+IGKV+ E  + 
Sbjct  91   YQLNFRQDKNGESLCQKKLKVAEVAKFRDVIVNDFYFQMYYDDLPAWGFIGKVEDESWTI  150

Query  591  PSE-YKYYLFKHLHFEIFY  644
              +  KYYLFKH+ F++FY
Sbjct  151  SDKGTKYYLFKHVLFDVFY  169



>emb|CDP05443.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 103/142 (73%), Gaps = 3/142 (2%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDA DH+Y +GD V LY NKVGP+HNPSETY Y+D PFC P   ++K E+LGEVLNGD L
Sbjct  23   SDAFDHKYNKGDPVPLYVNKVGPYHNPSETYPYYDFPFCPPDLWQEKEESLGEVLNGDHL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y L+F  D+ES VVC++ L++ +V  FR AV++DYY QMYYDDLP+W +IG     
Sbjct  83   VSAPYNLNFRLDRESHVVCRRNLTRKEVALFRTAVSKDYYLQMYYDDLPIWQFIGAAQ--  140

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
              +D   + YYLF  +HF+IFY
Sbjct  141  -TNDVDTFNYYLFTKVHFDIFY  161



>ref|NP_001077489.1| endomembrane protein 70 [Arabidopsis thaliana]
 sp|F4HW17.1|TMN5_ARATH RecName: Full=Transmembrane 9 superfamily member 5; AltName: 
Full=Endomembrane protein 11; AltName: Full=Transmembrane nine 
protein 5; Short=AtTMN5; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE28280.1| syntaxin of plant 111 [Arabidopsis thaliana]
Length=589

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S +S+H Y  GD V L+ NKVGP HNPSETY Y+DLPFC    V +K E LGEVLNGDRL
Sbjct  23   SGSSNH-YNAGDHVPLFVNKVGPLHNPSETYQYYDLPFCRRGPVIEKQETLGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            + SLYKL F  DK   V+C+K+L+ SD+ +FR  +A+DYYFQMYYDDLP+WG++GKV+ +
Sbjct  82   MSSLYKLKFREDKTHFVLCRKRLTSSDIARFRDIIAQDYYFQMYYDDLPLWGFVGKVEGD  141

Query  579  --GKSDPSEYKYYLFKHLHFEIFY  644
              G+ +    KYY+F HL F + Y
Sbjct  142  YFGQGEKHT-KYYIFSHLKFNVLY  164



>ref|XP_007045412.1| Endomembrane protein 70 protein family isoform 2, partial [Theobroma 
cacao]
 gb|EOY01244.1| Endomembrane protein 70 protein family isoform 2, partial [Theobroma 
cacao]
Length=383

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  294  NPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSK  473
             P   Y Y DLPFCSP ++++K EALGEVLNGDRLV++ YKL+F  +++S VVCK KLSK
Sbjct  29   TPXXXYRYFDLPFCSPDHLKEKKEALGEVLNGDRLVNAPYKLNFREERDSYVVCKTKLSK  88

Query  474  SDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFY  644
             +V  FR AV +DYYFQMYYDDLP+WG+IGKVDKEGK+DPSEYKY+L+KH+ F+I Y
Sbjct  89   DEVAIFRKAVDKDYYFQMYYDDLPIWGFIGKVDKEGKADPSEYKYFLYKHIQFDILY  145



>gb|KHG11801.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 107/147 (73%), Gaps = 4/147 (3%)
 Frame = +3

Query  216  RSDAS---DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLN  386
            RS AS   +HRY  GD V L+ NKVGP +NPSETY Y++LPFC P  V KK E+LGEVL+
Sbjct  22   RSIASSPHNHRYNVGDHVPLFVNKVGPLNNPSETYQYYELPFCGPDPVVKKEESLGEVLS  81

Query  387  GDRLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGK  566
            GDRL  +LYKL+F  +K +E +C KKL   DV KFR AV  D+YFQMYYDDLP WG++GK
Sbjct  82   GDRLTTALYKLNFRENKVAETLCHKKLEGDDVAKFRDAVINDFYFQMYYDDLPFWGFVGK  141

Query  567  VDKEGKS-DPSEYKYYLFKHLHFEIFY  644
            ++++  + +    KY+LFKH+ F++ Y
Sbjct  142  IEEDSWTLEKKSLKYFLFKHVQFDVLY  168



>ref|XP_008382598.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=583

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            + ASDH Y  GD V L+ NKVGP +NPSETY Y+DLPFC P  V +K E++GEVLNGDRL
Sbjct  20   ASASDHSYNVGDHVPLFVNKVGPLNNPSETYHYYDLPFCHPDPVIQKKESIGEVLNGDRL  79

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
             +SLY+L+F   K  E +C+KKL   ++ KFR  ++ ++YFQMYYDDLPVWGYIGKV+ E
Sbjct  80   ANSLYQLNFRQYKAGESLCQKKLKVVEIVKFRDVISNEFYFQMYYDDLPVWGYIGKVEDE  139

Query  579  GKSDPSEYKYYLFKHLHFEIFY  644
              S     KYYLF HL F++ Y
Sbjct  140  --SWEKRTKYYLFTHLSFDVLY  159



>emb|CDX93569.1| BnaA06g04790D [Brassica napus]
Length=608

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
              S  RY  GD V L+ NKVGP HNPSETY Y+DLPFC P  V +K E LGEVLNGDRL+
Sbjct  41   SGSSTRYNAGDHVPLFVNKVGPLHNPSETYQYYDLPFCRPEPVIEKQETLGEVLNGDRLM  100

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             SLY+L F  DK   V+C K+L+ S++ +FR  +A+D+YFQMYYDDLP+WG++GKV+++ 
Sbjct  101  SSLYELKFKEDKTHSVLCHKRLTSSEIARFRDTIAQDFYFQMYYDDLPLWGFVGKVERDY  160

Query  582  KSDPSE--YKYYLFKHLHFEIFY  644
                 E   KYY+F HL+F + +
Sbjct  161  SVHGGEENAKYYIFSHLNFNVLH  183



>ref|XP_009148094.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Brassica 
rapa]
Length=584

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
              S  RY  GD V  + NKVGP HNPSETY Y+DLPFC P  V +K E LGEVLNGDRL+
Sbjct  18   SGSSTRYNAGDHVPFFVNKVGPLHNPSETYQYYDLPFCRPEPVIEKQETLGEVLNGDRLM  77

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             SLY+L F  DK   V+C K+L+ S++ +FR  +A+D+YFQMYYDDLP+WG++GKV+++ 
Sbjct  78   SSLYELKFKEDKTHSVLCHKRLTSSEIARFRDTIAQDFYFQMYYDDLPLWGFVGKVERDY  137

Query  582  KSDPSE--YKYYLFKHLHFEIFY  644
                 E   KYYLF HL+F + +
Sbjct  138  SVHGGEENAKYYLFSHLNFNVLH  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000