BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF025D10

Length=675
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010506830.1|  PREDICTED: tubby-like F-box protein 3 isofor...  64.7    8e-09   
ref|XP_010506833.1|  PREDICTED: tubby-like F-box protein 3 isofor...  64.7    8e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010507835.1|  PREDICTED: tubby-like F-box protein 3 isofor...  64.7    8e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010507836.1|  PREDICTED: tubby-like F-box protein 3 isofor...  64.7    8e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010518507.1|  PREDICTED: tubby-like F-box protein 3 isofor...  62.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010518508.1|  PREDICTED: tubby-like F-box protein 3 isofor...  62.8    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002520685.1|  phosphoric diester hydrolase, putative           62.8    4e-08   
ref|NP_001189775.1|  Tubby-like F-box protein 3                       62.4    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295942.1|  hypothetical protein CARUB_v10025079mg           62.4    4e-08   Capsella rubella
ref|NP_850481.1|  Tubby-like F-box protein 3                          62.4    4e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37542.1|  hypothetical protein AALP_AA4G270500                  62.4    4e-08   Arabis alpina [alpine rockcress]
ref|XP_002882136.1|  hypothetical protein ARALYDRAFT_322431           62.4    4e-08   Arabidopsis lyrata subsp. lyrata
gb|KDP28083.1|  hypothetical protein JCGZ_13854                       61.6    9e-08   Jatropha curcas
ref|XP_006397986.1|  hypothetical protein EUTSA_v10001474mg           60.5    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006397985.1|  hypothetical protein EUTSA_v10001474mg           60.5    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_011471001.1|  PREDICTED: tubby-like F-box protein 3            60.1    2e-07   Fragaria vesca subsp. vesca
gb|KHF99338.1|  Tubby-like F-box protein 3                            60.1    3e-07   Gossypium arboreum [tree cotton]
ref|XP_007050787.1|  Tubby like protein 3 isoform 2                   59.3    5e-07   
ref|XP_007050786.1|  Tubby like protein 3 isoform 1                   59.3    5e-07   
gb|KJB41990.1|  hypothetical protein B456_007G131500                  58.5    6e-07   Gossypium raimondii
emb|CDP03548.1|  unnamed protein product                              58.5    8e-07   Coffea canephora [robusta coffee]
ref|XP_002269323.1|  PREDICTED: tubby-like F-box protein 3            58.5    1e-06   Vitis vinifera
gb|KJB41991.1|  hypothetical protein B456_007G131500                  58.2    1e-06   Gossypium raimondii
gb|KJB41989.1|  hypothetical protein B456_007G131500                  58.2    1e-06   Gossypium raimondii
ref|NP_001280806.1|  tubby-like F-box protein 3                       58.2    1e-06   Malus domestica [apple tree]
ref|XP_008386616.1|  PREDICTED: tubby-like F-box protein 3            58.2    1e-06   Malus domestica [apple tree]
ref|XP_006444230.1|  hypothetical protein CICLE_v10020468mg           57.8    1e-06   Citrus clementina [clementine]
gb|KDO87393.1|  hypothetical protein CISIN_1g015792mg                 57.8    1e-06   Citrus sinensis [apfelsine]
ref|XP_006479875.1|  PREDICTED: tubby-like F-box protein 3-like i...  57.8    2e-06   
ref|XP_008234991.1|  PREDICTED: tubby-like F-box protein 3            57.0    3e-06   Prunus mume [ume]
ref|XP_007199898.1|  hypothetical protein PRUPE_ppa006662mg           57.0    3e-06   Prunus persica
ref|XP_011082500.1|  PREDICTED: tubby-like F-box protein 3            56.6    4e-06   Sesamum indicum [beniseed]
ref|XP_009118192.1|  PREDICTED: tubby-like F-box protein 3            55.1    1e-05   Brassica rapa
emb|CDY55525.1|  BnaA04g29500D                                        55.1    1e-05   Brassica napus [oilseed rape]
ref|XP_009378902.1|  PREDICTED: tubby-like F-box protein 3            55.1    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_010545046.1|  PREDICTED: tubby-like F-box protein 3 isofor...  54.3    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_010545048.1|  PREDICTED: tubby-like F-box protein 3 isofor...  54.3    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_010245367.1|  PREDICTED: tubby-like F-box protein 3            53.5    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010523995.1|  PREDICTED: tubby-like F-box protein 3            53.1    6e-05   Tarenaya hassleriana [spider flower]
ref|XP_010921736.1|  PREDICTED: tubby-like F-box protein 3 isofor...  53.1    6e-05   Elaeis guineensis
ref|XP_010921734.1|  PREDICTED: tubby-like F-box protein 3 isofor...  53.1    6e-05   Elaeis guineensis
ref|XP_009405557.1|  PREDICTED: tubby-like F-box protein 6 isofor...  52.8    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921732.1|  PREDICTED: tubby-like F-box protein 3 isofor...  52.8    8e-05   Elaeis guineensis
ref|XP_009405579.1|  PREDICTED: tubby-like F-box protein 6 isofor...  52.8    8e-05   
ref|XP_008812302.1|  PREDICTED: tubby-like F-box protein 6 isofor...  52.8    8e-05   Phoenix dactylifera
ref|XP_008812305.1|  PREDICTED: tubby-like F-box protein 11 isofo...  52.4    9e-05   
gb|EYU46657.1|  hypothetical protein MIMGU_mgv1a007454mg              52.4    1e-04   Erythranthe guttata [common monkey flower]
ref|XP_010241159.1|  PREDICTED: tubby-like F-box protein 3            50.4    4e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009587286.1|  PREDICTED: tubby-like F-box protein 3            50.1    7e-04   Nicotiana tomentosiformis
ref|XP_009796557.1|  PREDICTED: tubby-like F-box protein 3            49.7    8e-04   Nicotiana sylvestris



>ref|XP_010506830.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Camelina sativa]
 ref|XP_010506831.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Camelina sativa]
 ref|XP_010506832.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Camelina sativa]
Length=407

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGEFGSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGEFGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|XP_010506833.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Camelina sativa]
Length=406

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGEFGSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGEFGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|XP_010507835.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Camelina sativa]
Length=408

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGEFGSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGEFGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|XP_010507836.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Camelina sativa]
Length=407

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGEFGSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGEFGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|XP_010518507.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Camelina sativa]
Length=407

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGE GSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|XP_010518508.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Camelina sativa]
Length=406

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGE GSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|XP_002520685.1| phosphoric diester hydrolase, putative [Ricinus communis]
 gb|EEF41647.1| phosphoric diester hydrolase, putative [Ricinus communis]
Length=444

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSFRSI+QDMRGEFGS+SRKGFD++FG   RSRSQR VQ
Sbjct  1    MSFRSILQDMRGEFGSMSRKGFDVKFGYGMRSRSQRVVQ  39



>ref|NP_001189775.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
 gb|AAC63644.1| putative tubby protein [Arabidopsis thaliana]
 gb|AAM15124.1| putative tubby protein [Arabidopsis thaliana]
 dbj|BAH57076.1| AT2G47900 [Arabidopsis thaliana]
 gb|AEC10909.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
Length=407

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGE GSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|XP_006295942.1| hypothetical protein CARUB_v10025079mg [Capsella rubella]
 gb|EOA28840.1| hypothetical protein CARUB_v10025079mg [Capsella rubella]
Length=407

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGE GSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|NP_850481.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
 ref|NP_001031558.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
 sp|Q8VY21.1|TLP3_ARATH RecName: Full=Tubby-like F-box protein 3; Short=AtTLP3 [Arabidopsis 
thaliana]
 gb|AAL66970.1| putative tubby protein [Arabidopsis thaliana]
 gb|AAM20254.1| putative tubby protein [Arabidopsis thaliana]
 gb|AAK98802.1| tubby-like protein 3 [Arabidopsis thaliana]
 gb|AEC10907.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
 gb|AEC10908.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
Length=406

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGE GSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQ  38



>gb|KFK37542.1| hypothetical protein AALP_AA4G270500 [Arabis alpina]
Length=408

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGE GSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|XP_002882136.1| hypothetical protein ARALYDRAFT_322431 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58395.1| hypothetical protein ARALYDRAFT_322431 [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQDMRGE GSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQ  38



>gb|KDP28083.1| hypothetical protein JCGZ_13854 [Jatropha curcas]
Length=406

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SI+QDMRGEFGS+SRKGFD++FG   RSRSQR VQ
Sbjct  1    MSFKSILQDMRGEFGSMSRKGFDVKFGYGMRSRSQRVVQ  39



>ref|XP_006397986.1| hypothetical protein EUTSA_v10001474mg [Eutrema salsugineum]
 gb|ESQ39439.1| hypothetical protein EUTSA_v10001474mg [Eutrema salsugineum]
Length=403

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQ+MRGE GSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQEMRGELGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|XP_006397985.1| hypothetical protein EUTSA_v10001474mg [Eutrema salsugineum]
 gb|ESQ39438.1| hypothetical protein EUTSA_v10001474mg [Eutrema salsugineum]
Length=402

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+S+IQ+MRGE GSISRKGFD+RF  GRSRSQR VQ
Sbjct  1    MSFKSLIQEMRGELGSISRKGFDVRFGYGRSRSQRVVQ  38



>ref|XP_011471001.1| PREDICTED: tubby-like F-box protein 3 [Fragaria vesca subsp. 
vesca]
Length=404

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG-RSRSQRTVQ  675
            MSF+SI+QDM+GEFGSISRKGFD++FG +SRS R VQ
Sbjct  1    MSFKSILQDMKGEFGSISRKGFDVKFGMKSRSHRVVQ  37



>gb|KHF99338.1| Tubby-like F-box protein 3 [Gossypium arboreum]
Length=405

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SIIQDM+GEFGSISR+GFD++FG   RSRS R VQ
Sbjct  1    MSFKSIIQDMKGEFGSISRRGFDVKFGYGMRSRSHRVVQ  39



>ref|XP_007050787.1| Tubby like protein 3 isoform 2 [Theobroma cacao]
 gb|EOX94944.1| Tubby like protein 3 isoform 2 [Theobroma cacao]
Length=402

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SIIQDM+GE GSISRKGFD++FG   RSRS R VQ
Sbjct  1    MSFKSIIQDMKGELGSISRKGFDVKFGYGMRSRSHRVVQ  39



>ref|XP_007050786.1| Tubby like protein 3 isoform 1 [Theobroma cacao]
 ref|XP_007050788.1| Tubby like protein 3 isoform 1 [Theobroma cacao]
 gb|EOX94943.1| Tubby like protein 3 isoform 1 [Theobroma cacao]
 gb|EOX94945.1| Tubby like protein 3 isoform 1 [Theobroma cacao]
Length=405

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SIIQDM+GE GSISRKGFD++FG   RSRS R VQ
Sbjct  1    MSFKSIIQDMKGELGSISRKGFDVKFGYGMRSRSHRVVQ  39



>gb|KJB41990.1| hypothetical protein B456_007G131500 [Gossypium raimondii]
Length=265

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SIIQ+M+GEFGSISR+GFD++FG   RSRS R VQ
Sbjct  1    MSFKSIIQEMKGEFGSISRRGFDVKFGYGMRSRSHRVVQ  39



>emb|CDP03548.1| unnamed protein product [Coffea canephora]
Length=407

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSFRSI+QDMRGEFGSISRKGF++R     RSRSQR VQ
Sbjct  1    MSFRSILQDMRGEFGSISRKGFEMRLPNGLRSRSQRVVQ  39



>ref|XP_002269323.1| PREDICTED: tubby-like F-box protein 3 [Vitis vinifera]
Length=405

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SIIQDMRGEFGSISRKGF+++F    RSRS R VQ
Sbjct  1    MSFKSIIQDMRGEFGSISRKGFEVKFNYGLRSRSHRVVQ  39



>gb|KJB41991.1| hypothetical protein B456_007G131500 [Gossypium raimondii]
Length=375

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SIIQ+M+GEFGSISR+GFD++FG   RSRS R VQ
Sbjct  1    MSFKSIIQEMKGEFGSISRRGFDVKFGYGMRSRSHRVVQ  39



>gb|KJB41989.1| hypothetical protein B456_007G131500 [Gossypium raimondii]
 gb|KJB41992.1| hypothetical protein B456_007G131500 [Gossypium raimondii]
Length=405

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SIIQ+M+GEFGSISR+GFD++FG   RSRS R VQ
Sbjct  1    MSFKSIIQEMKGEFGSISRRGFDVKFGYGMRSRSHRVVQ  39



>ref|NP_001280806.1| tubby-like F-box protein 3 [Malus domestica]
 gb|ADL36841.1| TLP domain class transcription factor [Malus domestica]
Length=401

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG-RSRSQRTVQ  675
            MSF+S+IQDM+GE GSISRK FD++FG RSRSQR VQ
Sbjct  1    MSFKSMIQDMKGELGSISRKSFDVKFGMRSRSQRVVQ  37



>ref|XP_008386616.1| PREDICTED: tubby-like F-box protein 3 [Malus domestica]
Length=402

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG-RSRSQRTVQ  675
            MSF+S+IQDM+GE GSISRK FD++FG RSRSQR VQ
Sbjct  1    MSFKSMIQDMKGELGSISRKSFDVKFGMRSRSQRVVQ  37



>ref|XP_006444230.1| hypothetical protein CICLE_v10020468mg [Citrus clementina]
 ref|XP_006444231.1| hypothetical protein CICLE_v10020468mg [Citrus clementina]
 gb|ESR57470.1| hypothetical protein CICLE_v10020468mg [Citrus clementina]
 gb|ESR57471.1| hypothetical protein CICLE_v10020468mg [Citrus clementina]
 gb|KDO87394.1| hypothetical protein CISIN_1g015792mg [Citrus sinensis]
 gb|KDO87395.1| hypothetical protein CISIN_1g015792mg [Citrus sinensis]
Length=400

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+SI+QD++GE GSISRKGFD+RF  GRSRS R VQ
Sbjct  1    MSFKSILQDVKGELGSISRKGFDVRFGYGRSRSHRVVQ  38



>gb|KDO87393.1| hypothetical protein CISIN_1g015792mg [Citrus sinensis]
Length=398

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+SI+QD++GE GSISRKGFD+RF  GRSRS R VQ
Sbjct  1    MSFKSILQDVKGELGSISRKGFDVRFGYGRSRSHRVVQ  38



>ref|XP_006479875.1| PREDICTED: tubby-like F-box protein 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006479876.1| PREDICTED: tubby-like F-box protein 3-like isoform X2 [Citrus 
sinensis]
Length=400

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 2/38 (5%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRF--GRSRSQRTVQ  675
            MSF+SI+QD++GE GSISRKGFD+RF  GRSRS R VQ
Sbjct  1    MSFKSILQDVKGELGSISRKGFDVRFGYGRSRSHRVVQ  38



>ref|XP_008234991.1| PREDICTED: tubby-like F-box protein 3 [Prunus mume]
Length=401

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG-RSRSQRTVQ  675
            MS +SI QDM+GEFGSISRK FD++FG RSRSQR VQ
Sbjct  1    MSLKSIFQDMKGEFGSISRKSFDVKFGIRSRSQRVVQ  37



>ref|XP_007199898.1| hypothetical protein PRUPE_ppa006662mg [Prunus persica]
 gb|EMJ01097.1| hypothetical protein PRUPE_ppa006662mg [Prunus persica]
Length=401

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG-RSRSQRTVQ  675
            MS +SI QDM+GEFGSISRK FD++FG RSRSQR VQ
Sbjct  1    MSLKSIFQDMKGEFGSISRKSFDVKFGIRSRSQRVVQ  37



>ref|XP_011082500.1| PREDICTED: tubby-like F-box protein 3 [Sesamum indicum]
Length=406

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SIIQDM+GEFGSISRKGF+ RFG   RSRS R V+
Sbjct  1    MSFKSIIQDMKGEFGSISRKGFEGRFGYGMRSRSHRVVE  39



>ref|XP_009118192.1| PREDICTED: tubby-like F-box protein 3 [Brassica rapa]
Length=402

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 2/36 (6%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFGRSRSQRTVQ  675
            MSF+S+IQ+MRGE GSISRKGF   FGRSRSQR VQ
Sbjct  1    MSFKSLIQEMRGELGSISRKGFG--FGRSRSQRVVQ  34



>emb|CDY55525.1| BnaA04g29500D [Brassica napus]
Length=402

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 2/36 (6%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFGRSRSQRTVQ  675
            MSF+S+IQ+MRGE GSISRKGF   FGRSRSQR VQ
Sbjct  1    MSFKSLIQEMRGELGSISRKGFG--FGRSRSQRVVQ  34



>ref|XP_009378902.1| PREDICTED: tubby-like F-box protein 3 [Pyrus x bretschneideri]
Length=401

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG-RSRSQRTVQ  675
            MSF+S+IQDM+GE  SISRK FD++FG RSRSQR VQ
Sbjct  1    MSFKSMIQDMKGELESISRKSFDVKFGMRSRSQRVVQ  37



>ref|XP_010545046.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010545047.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Tarenaya hassleriana]
Length=406

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            M F+S+IQDMR E GSISR+GFD+RFG   RSRS R VQ
Sbjct  1    MPFKSLIQDMREELGSISRRGFDVRFGYGTRSRSHRVVQ  39



>ref|XP_010545048.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Tarenaya hassleriana]
Length=405

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            M F+S+IQDMR E GSISR+GFD+RFG   RSRS R VQ
Sbjct  1    MPFKSLIQDMREELGSISRRGFDVRFGYGTRSRSHRVVQ  39



>ref|XP_010245367.1| PREDICTED: tubby-like F-box protein 3 [Nelumbo nucifera]
Length=405

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MS +SIIQDM+GE GSISRKGF+++ G   RSRS R VQ
Sbjct  1    MSLKSIIQDMKGEIGSISRKGFEVKLGYGLRSRSHRVVQ  39



>ref|XP_010523995.1| PREDICTED: tubby-like F-box protein 3 [Tarenaya hassleriana]
Length=403

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+S+ QDMR E GSISRKG D+RFG   RSRS R VQ
Sbjct  1    MSFKSLFQDMREELGSISRKGLDVRFGYGMRSRSHRVVQ  39



>ref|XP_010921736.1| PREDICTED: tubby-like F-box protein 3 isoform X3 [Elaeis guineensis]
Length=377

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MS +S+IQDMRGE GSISRKGF++R G   RSRS R V 
Sbjct  1    MSLKSLIQDMRGEIGSISRKGFEVRLGYGLRSRSHRVVH  39



>ref|XP_010921734.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Elaeis guineensis]
 ref|XP_010921735.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Elaeis guineensis]
Length=378

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MS +S+IQDMRGE GSISRKGF++R G   RSRS R V 
Sbjct  1    MSLKSLIQDMRGEIGSISRKGFEVRLGYGLRSRSHRVVH  39



>ref|XP_009405557.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405565.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405571.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=406

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSFRSIIQD+R E GSISRKGF+L+ G   RSRS R V 
Sbjct  1    MSFRSIIQDLRDELGSISRKGFELKMGHGLRSRSHRVVH  39



>ref|XP_010921732.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010921733.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Elaeis guineensis]
Length=406

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MS +S+IQDMRGE GSISRKGF++R G   RSRS R V 
Sbjct  1    MSLKSLIQDMRGEIGSISRKGFEVRLGYGLRSRSHRVVH  39



>ref|XP_009405579.1| PREDICTED: tubby-like F-box protein 6 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=346

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSFRSIIQD+R E GSISRKGF+L+ G   RSRS R V 
Sbjct  1    MSFRSIIQDLRDELGSISRKGFELKMGHGLRSRSHRVVH  39



>ref|XP_008812302.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Phoenix dactylifera]
 ref|XP_008812303.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Phoenix dactylifera]
Length=406

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SIIQDMR E GSISRKGF++R G   RSRS R V 
Sbjct  1    MSFKSIIQDMRDEIGSISRKGFEVRLGYGLRSRSHRVVH  39



>ref|XP_008812305.1| PREDICTED: tubby-like F-box protein 11 isoform X2 [Phoenix dactylifera]
Length=346

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+SIIQDMR E GSISRKGF++R G   RSRS R V 
Sbjct  1    MSFKSIIQDMRDEIGSISRKGFEVRLGYGLRSRSHRVVH  39



>gb|EYU46657.1| hypothetical protein MIMGU_mgv1a007454mg [Erythranthe guttata]
Length=407

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MSF+S+IQDM+GE GSISR+GF+ RFG   +SRSQR V+
Sbjct  1    MSFKSMIQDMKGELGSISRRGFEGRFGYGMKSRSQRVVE  39



>ref|XP_010241159.1| PREDICTED: tubby-like F-box protein 3 [Nelumbo nucifera]
Length=405

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 3/39 (8%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFG---RSRSQRTVQ  675
            MS +SIIQDM+GE G+ISRKGF+++ G   RSRS R VQ
Sbjct  1    MSLKSIIQDMKGEIGNISRKGFEMKRGYGLRSRSHRVVQ  39



>ref|XP_009587286.1| PREDICTED: tubby-like F-box protein 3 [Nicotiana tomentosiformis]
Length=396

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 5/36 (14%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFGRSRSQRTVQ  675
            MSF+S+IQ+MRGEFGSISRKGF     RSRS R VQ
Sbjct  1    MSFKSMIQEMRGEFGSISRKGF-----RSRSHRVVQ  31



>ref|XP_009796557.1| PREDICTED: tubby-like F-box protein 3 [Nicotiana sylvestris]
Length=396

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 5/36 (14%)
 Frame = +1

Query  568  MSFRSIIQDMRGEFGSISRKGFDLRFGRSRSQRTVQ  675
            MSF+S+IQ+MRGEFGSISRKGF     RSRS R VQ
Sbjct  1    MSFKSMIQEMRGEFGSISRKGF-----RSRSHRVVQ  31



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420