BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF025D09

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB61503.1|  hypothetical protein B456_009G362500                    387   6e-129   Gossypium raimondii
ref|XP_009590265.1|  PREDICTED: probable rhamnose biosynthetic en...    389   3e-128   Nicotiana tomentosiformis
ref|XP_009776312.1|  PREDICTED: probable rhamnose biosynthetic en...    389   4e-128   Nicotiana sylvestris
gb|KJB61502.1|  hypothetical protein B456_009G362500                    387   2e-127   Gossypium raimondii
ref|XP_010093448.1|  putative rhamnose biosynthetic enzyme 1            387   2e-127   Morus notabilis
ref|XP_007022008.1|  Rhamnose biosynthesis 1                            385   6e-127   Theobroma cacao [chocolate]
ref|XP_004244296.1|  PREDICTED: probable rhamnose biosynthetic en...    385   7e-127   Solanum lycopersicum
ref|XP_003546628.1|  PREDICTED: probable rhamnose biosynthetic en...    385   9e-127   Glycine max [soybeans]
ref|XP_009783771.1|  PREDICTED: probable rhamnose biosynthetic en...    385   1e-126   Nicotiana sylvestris
gb|KHG22077.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    384   2e-126   Gossypium arboreum [tree cotton]
ref|XP_002531238.1|  NAD dependent epimerase/dehydratase, putative      383   2e-126   
gb|ACJ11756.1|  rhamnose synthase                                       384   2e-126   Gossypium hirsutum [American cotton]
gb|KJB12934.1|  hypothetical protein B456_002G046200                    384   2e-126   Gossypium raimondii
gb|KHG29785.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    384   3e-126   Gossypium arboreum [tree cotton]
gb|ADB24773.1|  rhamnose synthase                                       384   3e-126   Gossypium hirsutum [American cotton]
ref|XP_004294169.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    384   3e-126   Fragaria vesca subsp. vesca
ref|XP_009394841.1|  PREDICTED: probable rhamnose biosynthetic en...    384   3e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006348335.1|  PREDICTED: probable rhamnose biosynthetic en...    384   4e-126   Solanum tuberosum [potatoes]
ref|XP_006360030.1|  PREDICTED: probable rhamnose biosynthetic en...    384   4e-126   Solanum tuberosum [potatoes]
ref|XP_003531412.1|  PREDICTED: probable rhamnose biosynthetic en...    383   4e-126   Glycine max [soybeans]
ref|XP_010552134.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    383   5e-126   Tarenaya hassleriana [spider flower]
ref|XP_011082806.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    383   5e-126   Sesamum indicum [beniseed]
ref|XP_010537694.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    383   5e-126   Tarenaya hassleriana [spider flower]
ref|XP_002285634.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    383   5e-126   Vitis vinifera
ref|XP_009146324.1|  PREDICTED: probable rhamnose biosynthetic en...    383   5e-126   Brassica rapa
ref|XP_010675264.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    383   5e-126   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009610279.1|  PREDICTED: probable rhamnose biosynthetic en...    383   5e-126   Nicotiana tomentosiformis
gb|KJB45830.1|  hypothetical protein B456_007G332000                    374   5e-126   Gossypium raimondii
ref|XP_007213598.1|  hypothetical protein PRUPE_ppa002453mg             383   5e-126   Prunus persica
ref|XP_011006811.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    383   6e-126   Populus euphratica
ref|XP_006585327.1|  PREDICTED: probable rhamnose biosynthetic en...    384   6e-126   
ref|XP_004248232.1|  PREDICTED: probable rhamnose biosynthetic en...    383   6e-126   Solanum lycopersicum
ref|XP_006585326.1|  PREDICTED: probable rhamnose biosynthetic en...    384   6e-126   Glycine max [soybeans]
ref|XP_008226345.1|  PREDICTED: probable rhamnose biosynthetic en...    383   8e-126   Prunus mume [ume]
ref|XP_002317559.2|  NAD-dependent epimerase/dehydratase family p...    383   8e-126   
ref|XP_010675265.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    382   1e-125   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011045548.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    382   1e-125   Populus euphratica
gb|KEH38548.1|  rhamnose biosynthetic-like enzyme                       383   1e-125   Medicago truncatula
ref|XP_010465388.1|  PREDICTED: probable rhamnose biosynthetic en...    382   1e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010502125.1|  PREDICTED: probable rhamnose biosynthetic en...    382   1e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010062770.1|  PREDICTED: probable rhamnose biosynthetic en...    382   1e-125   Eucalyptus grandis [rose gum]
ref|XP_004488984.1|  PREDICTED: probable rhamnose biosynthetic en...    382   1e-125   
ref|XP_010487282.1|  PREDICTED: probable rhamnose biosynthetic en...    382   1e-125   Camelina sativa [gold-of-pleasure]
ref|XP_006297150.1|  hypothetical protein CARUB_v10013153mg             382   1e-125   Capsella rubella
ref|XP_006370064.1|  hypothetical protein POPTR_0001s39210g             382   2e-125   Populus trichocarpa [western balsam poplar]
ref|NP_188097.1|  rhamnose biosynthetic enzyme 3                        382   2e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792282.1|  PREDICTED: probable rhamnose biosynthetic en...    382   2e-125   Phoenix dactylifera
gb|EYU38237.1|  hypothetical protein MIMGU_mgv1a002436mg                382   2e-125   Erythranthe guttata [common monkey flower]
emb|CDY25850.1|  BnaA05g14410D                                          373   3e-125   Brassica napus [oilseed rape]
ref|XP_006407044.1|  hypothetical protein EUTSA_v10020227mg             381   3e-125   
ref|XP_003543185.1|  PREDICTED: probable rhamnose biosynthetic en...    381   3e-125   Glycine max [soybeans]
ref|NP_001151455.1|  RHM1                                               381   3e-125   Zea mays [maize]
ref|XP_010273412.1|  PREDICTED: probable rhamnose biosynthetic en...    381   3e-125   Nelumbo nucifera [Indian lotus]
gb|KHN36936.1|  Putative rhamnose biosynthetic enzyme 1                 381   3e-125   Glycine soja [wild soybean]
gb|KJB12930.1|  hypothetical protein B456_002G046100                    371   3e-125   Gossypium raimondii
gb|KHN19477.1|  Putative rhamnose biosynthetic enzyme 1                 381   4e-125   Glycine soja [wild soybean]
ref|XP_003540514.1|  PREDICTED: probable rhamnose biosynthetic en...    381   4e-125   Glycine max [soybeans]
ref|XP_010535018.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    381   4e-125   Tarenaya hassleriana [spider flower]
ref|XP_006389974.1|  hypothetical protein EUTSA_v10018232mg             380   5e-125   Eutrema salsugineum [saltwater cress]
ref|XP_002882893.1|  hypothetical protein ARALYDRAFT_478892             380   6e-125   
gb|EMS45937.1|  putative rhamnose biosynthetic enzyme 1                 380   6e-125   Triticum urartu
ref|XP_004509959.1|  PREDICTED: probable rhamnose biosynthetic en...    380   6e-125   Cicer arietinum [garbanzo]
dbj|BAJ86835.1|  predicted protein                                      380   6e-125   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007149511.1|  hypothetical protein PHAVU_005G076400g             380   7e-125   Phaseolus vulgaris [French bean]
ref|XP_004137224.1|  PREDICTED: probable rhamnose biosynthetic en...    380   7e-125   Cucumis sativus [cucumbers]
ref|XP_010915435.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    380   7e-125   Elaeis guineensis
ref|XP_006301908.1|  hypothetical protein CARUB_v10022384mg             380   8e-125   Capsella rubella
ref|XP_008451740.1|  PREDICTED: probable rhamnose biosynthetic en...    380   9e-125   Cucumis melo [Oriental melon]
ref|XP_010924680.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    379   2e-124   Elaeis guineensis
ref|NP_177978.1|  UDP-L-rhamnose synthase                               379   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395981.1|  PREDICTED: probable rhamnose biosynthetic en...    379   3e-124   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH17189.1|  rhamnose biosynthetic-like enzyme                       382   3e-124   Medicago truncatula
gb|EYU26294.1|  hypothetical protein MIMGU_mgv1a002474mg                379   3e-124   Erythranthe guttata [common monkey flower]
emb|CDY35137.1|  BnaA06g11470D                                          378   5e-124   Brassica napus [oilseed rape]
ref|XP_004984748.1|  PREDICTED: probable rhamnose biosynthetic en...    378   6e-124   Setaria italica
ref|XP_009149137.1|  PREDICTED: probable rhamnose biosynthetic en...    378   6e-124   Brassica rapa
emb|CDY40003.1|  BnaC05g13120D                                          378   7e-124   Brassica napus [oilseed rape]
ref|XP_010916151.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    378   8e-124   Elaeis guineensis
ref|XP_011098163.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    377   1e-123   Sesamum indicum [beniseed]
gb|KJB45828.1|  hypothetical protein B456_007G332000                    374   1e-123   Gossypium raimondii
gb|KJB45829.1|  hypothetical protein B456_007G332000                    373   2e-123   Gossypium raimondii
ref|XP_009394163.1|  PREDICTED: probable rhamnose biosynthetic en...    377   2e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009376726.1|  PREDICTED: probable rhamnose biosynthetic en...    376   2e-123   Pyrus x bretschneideri [bai li]
ref|XP_010501002.1|  PREDICTED: probable rhamnose biosynthetic en...    376   2e-123   Camelina sativa [gold-of-pleasure]
ref|XP_006306947.1|  hypothetical protein CARUB_v10008513mg             376   3e-123   Capsella rubella
gb|KDP30504.1|  hypothetical protein JCGZ_17141                         376   3e-123   Jatropha curcas
ref|XP_006442344.1|  hypothetical protein CICLE_v10019182mg             376   4e-123   Citrus clementina [clementine]
gb|KCW47402.1|  hypothetical protein EUGRSUZ_K01196                     371   4e-123   Eucalyptus grandis [rose gum]
gb|KDO49287.1|  hypothetical protein CISIN_1g005941mg                   375   5e-123   Citrus sinensis [apfelsine]
ref|XP_006477818.1|  PREDICTED: probable rhamnose biosynthetic en...    375   5e-123   Citrus sinensis [apfelsine]
ref|XP_002468088.1|  hypothetical protein SORBIDRAFT_01g039340          375   5e-123   Sorghum bicolor [broomcorn]
ref|XP_008812156.1|  PREDICTED: probable rhamnose biosynthetic en...    375   6e-123   Phoenix dactylifera
ref|XP_008791880.1|  PREDICTED: probable rhamnose biosynthetic en...    375   6e-123   Phoenix dactylifera
gb|ABF95280.1|  rhamnose biosynthetic enzyme 1, putative, expressed     371   7e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984749.1|  PREDICTED: probable rhamnose biosynthetic en...    375   7e-123   Setaria italica
ref|XP_002887744.1|  RHM1/ROL1                                          375   8e-123   
gb|KJB45831.1|  hypothetical protein B456_007G332000                    374   1e-122   Gossypium raimondii
emb|CDX88455.1|  BnaC06g38990D                                          375   1e-122   
ref|XP_010479911.1|  PREDICTED: probable rhamnose biosynthetic en...    374   1e-122   Camelina sativa [gold-of-pleasure]
ref|XP_002894444.1|  mucilage-modified 4                                374   2e-122   
ref|XP_010462242.1|  PREDICTED: probable rhamnose biosynthetic en...    374   2e-122   Camelina sativa [gold-of-pleasure]
ref|XP_009106565.1|  PREDICTED: probable rhamnose biosynthetic en...    374   2e-122   Brassica rapa
ref|XP_009421279.1|  PREDICTED: probable rhamnose biosynthetic en...    374   2e-122   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY60210.1|  BnaCnng35880D                                          374   2e-122   Brassica napus [oilseed rape]
ref|XP_010671686.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    374   3e-122   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006649857.1|  PREDICTED: probable rhamnose biosynthetic en...    374   3e-122   Oryza brachyantha
ref|XP_006392784.1|  hypothetical protein EUTSA_v10011290mg             373   3e-122   Eutrema salsugineum [saltwater cress]
ref|XP_006647099.1|  PREDICTED: probable rhamnose biosynthetic en...    373   4e-122   Oryza brachyantha
gb|KHG07031.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    373   4e-122   Gossypium arboreum [tree cotton]
gb|EMT23371.1|  Putative rhamnose biosynthetic enzyme 1                 373   5e-122   
gb|EMS59810.1|  putative rhamnose biosynthetic enzyme 1                 373   5e-122   Triticum urartu
ref|XP_003571828.1|  PREDICTED: probable rhamnose biosynthetic en...    373   6e-122   Brachypodium distachyon [annual false brome]
gb|ADB24772.1|  rhamnose synthase                                       372   6e-122   Gossypium hirsutum [American cotton]
ref|NP_564633.2|  putative NDP-L-rhamnose synthase                      372   6e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417456.1|  PREDICTED: probable rhamnose biosynthetic en...    372   7e-122   Camelina sativa [gold-of-pleasure]
dbj|BAJ97692.1|  predicted protein                                      372   7e-122   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010035897.1|  PREDICTED: probable rhamnose biosynthetic en...    373   7e-122   Eucalyptus grandis [rose gum]
ref|XP_010429684.1|  PREDICTED: probable rhamnose biosynthetic en...    372   8e-122   
ref|XP_006845495.1|  hypothetical protein AMTR_s00019p00150410          372   1e-121   Amborella trichopoda
emb|CDP06058.1|  unnamed protein product                                371   1e-121   Coffea canephora [robusta coffee]
ref|NP_001049724.1|  Os03g0278200                                       372   1e-121   
emb|CDY45116.1|  BnaC06g06370D                                          371   2e-121   Brassica napus [oilseed rape]
ref|XP_009147602.1|  PREDICTED: probable rhamnose biosynthetic en...    371   3e-121   Brassica rapa
emb|CDY24092.1|  BnaA06g00900D                                          371   3e-121   Brassica napus [oilseed rape]
ref|XP_009144768.1|  PREDICTED: probable rhamnose biosynthetic en...    371   3e-121   Brassica rapa
ref|XP_004303854.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    371   4e-121   Fragaria vesca subsp. vesca
ref|XP_002468080.1|  hypothetical protein SORBIDRAFT_01g039220          370   6e-121   Sorghum bicolor [broomcorn]
ref|XP_007215006.1|  hypothetical protein PRUPE_ppa002417mg             369   1e-120   Prunus persica
ref|XP_007146360.1|  hypothetical protein PHAVU_006G034000g             369   2e-120   Phaseolus vulgaris [French bean]
ref|XP_009356652.1|  PREDICTED: probable rhamnose biosynthetic en...    369   2e-120   Pyrus x bretschneideri [bai li]
emb|CDP21573.1|  unnamed protein product                                354   3e-120   Coffea canephora [robusta coffee]
ref|XP_008229395.1|  PREDICTED: probable rhamnose biosynthetic en...    368   3e-120   Prunus mume [ume]
ref|XP_003551914.1|  PREDICTED: probable rhamnose biosynthetic en...    368   4e-120   Glycine max [soybeans]
ref|XP_008654228.1|  PREDICTED: probable rhamnose biosynthetic en...    368   4e-120   
gb|KHN18103.1|  Putative rhamnose biosynthetic enzyme 1                 368   4e-120   Glycine soja [wild soybean]
ref|XP_008380229.1|  PREDICTED: probable rhamnose biosynthetic en...    368   5e-120   Malus domestica [apple tree]
ref|XP_010060763.1|  PREDICTED: probable rhamnose biosynthetic en...    366   2e-119   Eucalyptus grandis [rose gum]
ref|XP_009377674.1|  PREDICTED: probable rhamnose biosynthetic en...    366   2e-119   Pyrus x bretschneideri [bai li]
gb|KHG15836.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    365   6e-119   Gossypium arboreum [tree cotton]
ref|XP_006484833.1|  PREDICTED: probable rhamnose biosynthetic en...    364   1e-118   Citrus sinensis [apfelsine]
ref|XP_008342373.1|  PREDICTED: probable rhamnose biosynthetic en...    364   2e-118   Malus domestica [apple tree]
ref|XP_001775602.1|  predicted protein                                  364   2e-118   
ref|XP_006437200.1|  hypothetical protein CICLE_v10030887mg             364   2e-118   
gb|KDO60921.1|  hypothetical protein CISIN_1g005818mg                   364   2e-118   Citrus sinensis [apfelsine]
gb|ADB24774.1|  rhamnose synthase                                       364   2e-118   Gossypium hirsutum [American cotton]
ref|XP_007048831.1|  Rhamnose biosynthesis 1 isoform 1                  365   2e-118   
emb|CDP18722.1|  unnamed protein product                                363   3e-118   Coffea canephora [robusta coffee]
ref|XP_010109352.1|  putative rhamnose biosynthetic enzyme 1            363   5e-118   Morus notabilis
gb|KJB75445.1|  hypothetical protein B456_012G042300                    361   2e-117   Gossypium raimondii
ref|XP_004960685.1|  PREDICTED: probable rhamnose biosynthetic en...    360   3e-117   Setaria italica
gb|AFW77499.1|  hypothetical protein ZEAMMB73_283149                    356   4e-117   
ref|XP_001775697.1|  predicted protein                                  359   1e-116   
gb|KHM99622.1|  Putative rhamnose biosynthetic enzyme 1                 356   2e-116   Glycine soja [wild soybean]
ref|XP_001766894.1|  predicted protein                                  358   2e-116   
gb|ACG33666.1|  RHM1                                                    357   8e-116   Zea mays [maize]
ref|NP_001130297.1|  uncharacterized protein LOC100191391               357   8e-116   Zea mays [maize]
ref|XP_002440852.1|  hypothetical protein SORBIDRAFT_09g008220          356   1e-115   
ref|XP_002964674.1|  hypothetical protein SELMODRAFT_266803             353   4e-114   Selaginella moellendorffii
ref|XP_002989472.1|  hypothetical protein SELMODRAFT_129972             353   4e-114   
ref|XP_008380346.1|  PREDICTED: probable rhamnose biosynthetic en...    353   5e-114   Malus domestica [apple tree]
ref|XP_002515360.1|  dtdp-glucose 4,6-dehydratase, putative             342   7e-114   Ricinus communis
ref|XP_001779703.1|  predicted protein                                  352   8e-114   
ref|XP_009356708.1|  PREDICTED: probable rhamnose biosynthetic en...    346   2e-111   Pyrus x bretschneideri [bai li]
gb|EMT08126.1|  Putative rhamnose biosynthetic enzyme 1                 338   2e-111   
gb|EMS55907.1|  putative rhamnose biosynthetic enzyme 3                 337   2e-110   Triticum urartu
ref|XP_004172221.1|  PREDICTED: probable rhamnose biosynthetic en...    333   3e-110   
ref|XP_008351771.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...    332   4e-110   
gb|EYU29575.1|  hypothetical protein MIMGU_mgv1a008395mg                331   2e-109   Erythranthe guttata [common monkey flower]
ref|XP_011082935.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    332   2e-109   Sesamum indicum [beniseed]
gb|AFW66842.1|  hypothetical protein ZEAMMB73_620875                    328   7e-108   
ref|XP_006450198.1|  hypothetical protein CICLE_v10010306mg             335   1e-107   
ref|XP_006483733.1|  PREDICTED: probable rhamnose biosynthetic en...    336   1e-107   
gb|KDO67325.1|  hypothetical protein CISIN_1g035631mg                   336   2e-107   Citrus sinensis [apfelsine]
emb|CAN62061.1|  hypothetical protein VITISV_001928                     333   3e-107   Vitis vinifera
ref|XP_010268536.1|  PREDICTED: probable rhamnose biosynthetic en...    334   4e-107   Nelumbo nucifera [Indian lotus]
emb|CDX98494.1|  BnaC05g38810D                                          333   6e-107   
emb|CDX97601.1|  BnaA05g24780D                                          333   6e-107   
ref|XP_008445073.1|  PREDICTED: probable rhamnose biosynthetic en...    333   9e-107   Cucumis melo [Oriental melon]
ref|XP_004138882.1|  PREDICTED: probable rhamnose biosynthetic en...    333   1e-106   
ref|XP_002271970.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    333   1e-106   Vitis vinifera
ref|XP_006382137.1|  hypothetical protein POPTR_0006s28750g             332   4e-106   Populus trichocarpa [western balsam poplar]
ref|XP_011031381.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    330   3e-105   Populus euphratica
ref|XP_007225132.1|  hypothetical protein PRUPE_ppa002547mg             329   4e-105   Prunus persica
ref|XP_007011619.1|  Rhamnose biosynthesis 1                            329   4e-105   
emb|CDY32340.1|  BnaC01g36590D                                          327   1e-104   Brassica napus [oilseed rape]
emb|CDY20084.1|  BnaA01g29180D                                          327   2e-104   Brassica napus [oilseed rape]
ref|XP_009803668.1|  PREDICTED: probable rhamnose biosynthetic en...    326   5e-104   Nicotiana sylvestris
ref|XP_008220004.1|  PREDICTED: probable rhamnose biosynthetic en...    325   1e-103   Prunus mume [ume]
ref|XP_009586858.1|  PREDICTED: probable rhamnose biosynthetic en...    324   2e-103   Nicotiana tomentosiformis
ref|XP_009363628.1|  PREDICTED: probable rhamnose biosynthetic en...    324   3e-103   Pyrus x bretschneideri [bai li]
ref|XP_006355193.1|  PREDICTED: probable rhamnose biosynthetic en...    324   3e-103   Solanum tuberosum [potatoes]
ref|XP_010325193.1|  PREDICTED: probable rhamnose biosynthetic en...    323   6e-103   
ref|XP_008393937.1|  PREDICTED: probable rhamnose biosynthetic en...    323   9e-103   
ref|XP_003545554.1|  PREDICTED: probable rhamnose biosynthetic en...    319   2e-101   Glycine max [soybeans]
ref|XP_004498563.1|  PREDICTED: probable rhamnose biosynthetic en...    312   9e-99    Cicer arietinum [garbanzo]
ref|XP_007161328.1|  hypothetical protein PHAVU_001G060400g             312   1e-98    Phaseolus vulgaris [French bean]
ref|XP_003588651.1|  Rhamnose synthase                                  311   2e-98    Medicago truncatula
ref|XP_004292875.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    311   2e-98    Fragaria vesca subsp. vesca
ref|XP_003566438.1|  PREDICTED: probable rhamnose biosynthetic en...    301   1e-97    Brachypodium distachyon [annual false brome]
gb|KHN30780.1|  Putative rhamnose biosynthetic enzyme 1                 309   2e-97    Glycine soja [wild soybean]
ref|XP_003569141.1|  PREDICTED: probable rhamnose biosynthetic en...    300   2e-97    Brachypodium distachyon [annual false brome]
ref|XP_003551160.1|  PREDICTED: probable rhamnose biosynthetic en...    308   3e-97    
gb|EPS62084.1|  hypothetical protein M569_12709                         295   3e-92    Genlisea aurea
ref|XP_010531915.1|  PREDICTED: LOW QUALITY PROTEIN: trifunctiona...    281   1e-88    Tarenaya hassleriana [spider flower]
gb|KJB27003.1|  hypothetical protein B456_004G271200                    274   7e-85    Gossypium raimondii
ref|XP_001701714.1|  NAD-dependent epimerase/dehydratase                266   2e-84    Chlamydomonas reinhardtii
ref|XP_007508076.1|  predicted protein                                  272   4e-83    Bathycoccus prasinos
ref|XP_003057320.1|  predicted protein                                  271   8e-83    Micromonas pusilla CCMP1545
ref|XP_002500589.1|  predicted protein                                  271   1e-82    Micromonas commoda
ref|XP_002953659.1|  hypothetical protein VOLCADRAFT_82358              261   2e-82    Volvox carteri f. nagariensis
ref|XP_007514013.1|  predicted protein                                  269   5e-82    Bathycoccus prasinos
ref|XP_005644844.1|  NAD(P)-binding protein                             258   6e-81    Coccomyxa subellipsoidea C-169
ref|XP_001422283.1|  putative NAD-dependent epimerase/dehydratase       258   7e-81    Ostreococcus lucimarinus CCE9901
gb|AGE60164.1|  GDP-L-fucose synthase 2                                 257   9e-81    Acanthocystis turfacea Chlorella virus WI0606
gb|AGE49559.1|  GDP-L-fucose synthase 2                                 257   1e-80    Acanthocystis turfacea Chlorella virus Can0610SP
ref|XP_005648752.1|  NAD-dependent epimerase/dehydratase                257   1e-80    Coccomyxa subellipsoidea C-169
ref|XP_001422288.1|  predicted protein                                  256   3e-80    Ostreococcus lucimarinus CCE9901
gb|AGE50238.1|  GDP-L-fucose synthase 2                                 256   3e-80    Acanthocystis turfacea Chlorella virus Canal-1
ref|YP_001427025.1|  hypothetical protein ATCV1_Z544R                   255   4e-80    Acanthocystis turfacea chlorella virus 1
gb|AGE57039.1|  GDP-L-fucose synthase 2                                 255   5e-80    Acanthocystis turfacea Chlorella virus NE-JV-3
gb|AGE59831.1|  GDP-L-fucose synthase 2                                 254   7e-80    Acanthocystis turfacea Chlorella virus TN603.4.2
gb|AGE59487.1|  GDP-L-fucose synthase 2                                 254   9e-80    Acanthocystis turfacea Chlorella virus OR0704.3
gb|AGE55724.1|  GDP-L-fucose synthase 2                                 254   1e-79    Acanthocystis turfacea Chlorella virus MN0810.1
ref|XP_011401232.1|  DEAD-box ATP-dependent RNA helicase 20             264   2e-79    Auxenochlorella protothecoides
gb|AGE53603.1|  GDP-L-fucose synthase 2                                 253   2e-79    Acanthocystis turfacea Chlorella virus GM0701.1
gb|KDD76685.1|  NAD dependent epimerase/dehydratase                     254   3e-79    Helicosporidium sp. ATCC 50920
gb|AGE56041.1|  GDP-L-fucose synthase 2                                 253   3e-79    Acanthocystis turfacea Chlorella virus MO0605SPH
gb|KDD73904.1|  NAD dependent epimerase/dehydratase                     252   1e-78    Helicosporidium sp. ATCC 50920
gb|AGE57735.1|  GDP-L-fucose synthase 2                                 251   2e-78    Acanthocystis turfacea Chlorella virus NTS-1
gb|AGE56705.1|  GDP-L-fucose synthase 2                                 250   3e-78    Acanthocystis turfacea Chlorella virus NE-JV-2
gb|AGE49233.1|  GDP-L-fucose synthase 2                                 249   8e-78    Acanthocystis turfacea Chlorella virus Br0604L
emb|CBN76510.1|  conserved unknown protein                              249   1e-77    Ectocarpus siliculosus
ref|XP_005854661.1|  dTDP-glucose 4,6-dehydratase                       249   2e-77    Nannochloropsis gaditana CCMP526
ref|XP_002181238.1|  predicted protein                                  251   2e-77    Phaeodactylum tricornutum CCAP 1055/1
gb|EWM28017.1|  rhamnose biosynthetic enzyme expressed                  249   5e-77    Nannochloropsis gaditana
ref|XP_002291084.1|  dtdp-glucose 4,6-dehydratase                       247   6e-77    Thalassiosira pseudonana CCMP1335
gb|EWM30544.1|  dTDP-glucose 4,6-dehydratase                            247   5e-76    Nannochloropsis gaditana
emb|CEG01892.1|  NAD-dependent epimerase/dehydratase                    253   5e-76    Ostreococcus tauri
ref|XP_003084264.1|  UDP-glucose 4-epimerase/UDP-sulfoquinovose s...    253   1e-75    
ref|XP_005850348.1|  hypothetical protein CHLNCDRAFT_142172             243   4e-75    Chlorella variabilis
ref|XP_005845105.1|  hypothetical protein CHLNCDRAFT_7301               241   9e-75    Chlorella variabilis
ref|XP_011401987.1|  putative rhamnose biosynthetic enzyme 3            240   5e-74    Auxenochlorella protothecoides
ref|XP_004336227.1|  dTDPD-glucose 4,6-dehydratase                      239   1e-73    Acanthamoeba castellanii str. Neff
ref|XP_005778340.1|  hypothetical protein EMIHUDRAFT_367182             236   2e-72    Emiliania huxleyi CCMP1516
gb|EJK47833.1|  hypothetical protein THAOC_33424                        236   3e-72    Thalassiosira oceanica
ref|XP_005757838.1|  hypothetical protein EMIHUDRAFT_433184             236   3e-72    Emiliania huxleyi CCMP1516
ref|XP_004256510.1|  DTDP-glucose 4,6-dehydratase, putative             234   3e-72    Entamoeba invadens IP1
ref|XP_005537192.1|  dTDP-glucose 4,6-dehydratase                       234   2e-71    Cyanidioschyzon merolae strain 10D
ref|XP_005536953.1|  dTDP-glucose 4,6-dehydratase                       233   2e-71    Cyanidioschyzon merolae strain 10D
ref|XP_005535008.1|  dTDP-glucose 4,6-dehydratase                       233   2e-71    Cyanidioschyzon merolae strain 10D
ref|XP_006675185.1|  hypothetical protein BATDEDRAFT_18531              229   8e-70    Batrachochytrium dendrobatidis JAM81
ref|XP_004184621.1|  DTDP-glucose 4,6-dehydratase, putative             228   1e-69    Entamoeba invadens IP1
ref|XP_001737366.1|  DTDP-glucose 4,6-dehydratase                       228   1e-69    Entamoeba dispar SAW760
ref|XP_004253556.1|  DTDP-glucose 4,6-dehydratase, putative             228   1e-69    Entamoeba invadens IP1
emb|CBK22816.2|  unnamed protein product                                231   2e-69    Blastocystis hominis
ref|XP_001297395.1|  NAD dependent epimerase/dehydratase family p...    226   6e-69    Trichomonas vaginalis G3
ref|XP_005710308.1|  dTDP-glucose 4,6-dehydratase                       227   7e-69    Chondrus crispus [carageen]
ref|XP_009035289.1|  hypothetical protein AURANDRAFT_23143              223   1e-67    Aureococcus anophagefferens
ref|XP_005707656.1|  dTDP-glucose 4,6-dehydratase                       223   2e-67    Galdieria sulphuraria
ref|XP_001741245.1|  DTDP-glucose 4,6-dehydratase                       221   4e-67    Entamoeba dispar SAW760
ref|XP_656509.1|  dTDP-D-glucose 4,6-dehydratase                        221   4e-67    Entamoeba histolytica HM-1:IMSS
emb|CDH53780.1|  dtdp-glucose-dehydratase                               219   2e-65    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS02810.1|  hypothetical protein LRAMOSA00214                      218   2e-65    Lichtheimia ramosa
gb|AGM32522.1|  NAD dependent epimerase/dehydratase family protein      216   3e-65    Coptotermes formosanus
ref|XP_652489.1|  dTDP-D-glucose 4,6-dehydratase                        217   3e-65    Entamoeba histolytica HM-1:IMSS
gb|EPB88805.1|  dTDP-glucose 4,6-dehydratase                            218   4e-65    Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN06126.1|  DTDPD-glucose 4,6-dehydratase                          218   5e-65    Mucor ambiguus
gb|KHN29165.1|  Putative rhamnose biosynthetic enzyme 1                 222   6e-65    Glycine soja [wild soybean]
ref|XP_005781167.1|  hypothetical protein EMIHUDRAFT_442934             216   1e-64    Emiliania huxleyi CCMP1516
gb|ERZ94801.1|  hypothetical protein GLOINDRAFT_72734                   214   3e-64    
gb|EXX68145.1|  bifunctional UDP-glucose 4-epimerase/aldose 1-epi...    215   4e-64    Rhizophagus irregularis DAOM 197198w
ref|XP_002839554.1|  hypothetical protein                               214   8e-64    Tuber melanosporum Mel28
ref|XP_005704072.1|  dTDP-glucose 4,6-dehydratase                       212   3e-63    Galdieria sulphuraria
ref|XP_004346522.1|  rhamnose biosynthetic enzyme 3, putative           212   1e-62    Acanthamoeba castellanii str. Neff
ref|XP_009031751.1|  hypothetical protein HELRODRAFT_104422             209   5e-62    Helobdella robusta
gb|EXL51746.1|  dTDP-glucose 4,6-dehydratase                            207   5e-61    Fusarium oxysporum f. sp. radicis-lycopersici 26381
ref|XP_001267087.1|  dtdp-glucose 4,6-dehydratase                       207   5e-61    Aspergillus fischeri NRRL 181
ref|XP_001628519.1|  predicted protein                                  206   1e-60    Nematostella vectensis
gb|EXA35093.1|  dTDP-glucose 4,6-dehydratase                            205   3e-60    Fusarium oxysporum f. sp. pisi HDV247
ref|XP_005818916.1|  hypothetical protein GUITHDRAFT_98705              203   4e-60    
gb|EXK35799.1|  dTDP-glucose 4,6-dehydratase                            204   8e-60    
gb|EWZ30418.1|  dTDP-glucose 4,6-dehydratase                            204   9e-60    
ref|XP_007677510.1|  hypothetical protein BAUCODRAFT_48602              203   1e-59    
ref|XP_001746636.1|  hypothetical protein                               201   2e-59    
gb|EWY82941.1|  dTDP-glucose 4,6-dehydratase                            203   2e-59    
gb|EPY35950.1|  dTDP-glucose 4,6-dehydratase                            202   3e-59    
ref|XP_008595173.1|  dTDP-D-glucose 4,6-dehydratase                     203   4e-59    
gb|KGQ08679.1|  putative rhamnose biosynthetic enzyme 2                 203   4e-59    
gb|ENH75981.1|  Putative rhamnose biosynthetic enzyme 1                 201   4e-59    
dbj|GAM29125.1|  hypothetical protein SAMD00019534_123010               202   5e-59    
gb|EGU75304.1|  hypothetical protein FOXB_14183                         201   9e-59    
emb|CEJ87410.1|  Putative dTDP-D-glucose 4,6-dehydratase                204   9e-59    
ref|XP_007689960.1|  hypothetical protein COCMIDRAFT_100591             201   2e-58    
ref|XP_011106233.1|  hypothetical protein H072_241                      201   2e-58    
ref|XP_007586615.1|  putative dtdp-d-glucose -dehydratase protein       200   2e-58    
gb|EQL02570.1|  dTDP-D-glucose 4,6-dehydratase                          200   2e-58    
gb|EMD93896.1|  hypothetical protein COCHEDRAFT_1129846                 201   3e-58    
emb|CCG81052.1|  Dtdp-glucose 4,6-dehydratase                           199   4e-58    
emb|CEJ93891.1|  Putative dTDP-D-glucose 4,6-dehydratase                199   6e-58    
gb|EKG22293.1|  hypothetical protein MPH_00360                          206   8e-58    
dbj|GAD98335.1|  dTDP-D-glucose 4,6-dehydratase-like protein            199   8e-58    
ref|XP_007715776.1|  hypothetical protein COCCADRAFT_39769              199   1e-57    
ref|XP_003839159.1|  hypothetical protein LEMA_P028320.1                199   1e-57    
gb|AEH41993.1|  UDP-glucose-4,6-dehydratase                             199   2e-57    
ref|XP_003717261.1|  dTDP-D-glucose 4,6-dehydratase                     199   2e-57    
ref|XP_007701224.1|  hypothetical protein COCSADRAFT_119751             199   2e-57    
ref|XP_004355810.1|  putative dTDP-D-glucose 4,6-dehydratase            194   2e-57    
ref|XP_001938042.1|  dTDP-D-glucose 4,6-dehydratase                     198   2e-57    
gb|ELT91052.1|  hypothetical protein CAPTEDRAFT_223439                  197   2e-57    
ref|XP_006692796.1|  dtdp-glucose 4,6-dehydratase-like protein          199   3e-57    
gb|KFY70636.1|  hypothetical protein V499_09028                         198   3e-57    
ref|XP_001908195.1|  hypothetical protein                               193   3e-57    
ref|XP_009225668.1|  dTDP-D-glucose 4,6-dehydratase                     198   3e-57    
gb|EGZ71579.1|  NAD(P)-binding protein                                  202   3e-57    
ref|XP_003852374.1|  hypothetical protein MYCGRDRAFT_93541              198   3e-57    
gb|KDB17974.1|  dtdp-glucose 4,6-dehydratase                            199   4e-57    
gb|KIM94721.1|  hypothetical protein OIDMADRAFT_45648                   197   4e-57    
dbj|BAB27693.1|  unnamed protein product                                196   4e-57    
ref|XP_011393834.1|  dTDP-D-glucose 4,6-dehydratase, variant 1          201   5e-57    
ref|XP_007599732.1|  dTDP-glucose 4,6-dehydratase                       197   5e-57    
gb|EWG55513.1|  dTDP-glucose 4,6-dehydratase                            196   5e-57    
gb|EDL00564.1|  TDP-glucose 4,6-dehydratase, isoform CRA_a              196   6e-57    
ref|XP_008083851.1|  NAD(P)-binding Rossmann-fold containing protein    197   6e-57    
gb|KEY69402.1|  hypothetical protein S7711_05716                        197   6e-57    
ref|NP_083854.3|  dTDP-D-glucose 4,6-dehydratase                        196   6e-57    
gb|AAH21419.1|  TDP-glucose 4,6-dehydratase                             195   7e-57    
gb|EDL00567.1|  TDP-glucose 4,6-dehydratase, isoform CRA_d              195   7e-57    
ref|XP_011126737.1|  hypothetical protein AOL_s00188g187                196   8e-57    
gb|KHJ33395.1|  putative dtdp-d-glucose -dehydratase                    197   8e-57    
gb|EXK77722.1|  dTDP-glucose 4,6-dehydratase                            196   9e-57    
emb|CEF98153.1|  NAD-dependent epimerase/dehydratase                    196   1e-56    
ref|XP_001598557.1|  conserved hypothetical protein                     197   1e-56    
ref|XP_011393833.1|  dTDP-D-glucose 4,6-dehydratase                     201   1e-56    
gb|EDM02523.1|  TDP-glucose 4,6-dehydratase (predicted), isoform ...    191   1e-56    
ref|XP_009653544.1|  dTDP-D-glucose 4,6-dehydratase                     196   1e-56    
gb|ESZ93043.1|  dTDP-D-glucose 4,6-dehydratase                          197   1e-56    
gb|KFY20012.1|  hypothetical protein V493_07767                         196   1e-56    
gb|KFZ04490.1|  hypothetical protein V502_10111                         196   1e-56    
ref|XP_003003224.1|  dTDP-D-glucose 4,6-dehydratase                     196   1e-56    
gb|KFY82818.1|  hypothetical protein V500_10312                         196   1e-56    
gb|KFA63530.1|  hypothetical protein S40285_00334                       196   2e-56    
ref|XP_007296149.1|  dTDP-glucose 4,6-dehydratase                       196   2e-56    
gb|EDM02522.1|  TDP-glucose 4,6-dehydratase (predicted), isoform ...    191   2e-56    
ref|XP_007912472.1|  putative dtdp-d-glucose -dehydratase protein       196   2e-56    
emb|CCC10630.1|  unnamed protein product                                199   2e-56    
ref|XP_009311908.1|  GDP-mannose 4,6 dehydratase                        195   2e-56    
gb|ELR02481.1|  dTDP-glucose 4,6-dehydratase                            196   2e-56    
gb|EWC48070.1|  hypothetical protein DRE_02649                          195   2e-56    
ref|XP_008023470.1|  hypothetical protein SETTUDRAFT_168049             196   2e-56    
ref|XP_003044521.1|  hypothetical protein NECHADRAFT_45636              195   3e-56    
gb|EFX02603.1|  dtdp-glucose -dehydratase                               195   3e-56    
gb|KFX91512.1|  hypothetical protein O988_07719                         196   3e-56    
ref|XP_001512139.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          193   5e-56    
ref|XP_007275549.1|  dtdp-glucose -dehydratase                          195   5e-56    
gb|KDB11057.1|  dtdp-glucose 4,6-dehydratase                            195   6e-56    
gb|KFY39353.1|  hypothetical protein V495_06000                         195   6e-56    
dbj|GAM86455.1|  hypothetical protein ANO11243_044690                   194   6e-56    
gb|KFH41770.1|  rhamnose biosynthetic enzyme-like protein               194   9e-56    
emb|CCD44816.1|  hypothetical protein BofuT4_P051650.1                  195   9e-56    
ref|XP_001554971.1|  conserved hypothetical protein                     194   9e-56    
ref|XP_007834293.1|  hypothetical protein PFICI_07521                   194   9e-56    
gb|EFQ25012.1|  dTDP-glucose 4,6-dehydratase                            195   9e-56    
emb|CCF46206.1|  dTDP-glucose 4,6-dehydratase                           194   1e-55    
gb|EPE08996.1|  dtdp-d-glucose -dehydratase                             193   1e-55    
gb|EGU73825.1|  hypothetical protein FOXB_15665                         193   1e-55    
ref|XP_816514.1|  GDP-mannose 4,6 dehydratase                           193   1e-55    
gb|ENH81005.1|  dtdp-glucose -dehydratase                               194   1e-55    
dbj|GAM88310.1|  hypothetical protein ANO11243_063430                   192   1e-55    
gb|KIM94915.1|  hypothetical protein OIDMADRAFT_206707                  194   1e-55    
gb|KDN69228.1|  putative dTDP-glucose 4,6-dehydratase                   194   2e-55    
ref|XP_004884841.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-55    
ref|XP_005355717.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          192   2e-55    
ref|XP_010587692.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    190   2e-55    
ref|XP_003131096.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    191   2e-55    
ref|XP_006156670.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    190   2e-55    
ref|XP_004371454.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          191   2e-55    
ref|XP_006191479.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          191   2e-55    
ref|XP_006639064.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase-like     191   2e-55    
ref|XP_007101813.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   3e-55    
ref|XP_005882453.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   3e-55    
ref|XP_001377580.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    191   3e-55    
ref|XP_006089900.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   3e-55    
emb|CDP32340.1|  Putative rhamnose biosynthetic enzyme                  193   4e-55    
ref|XP_005317101.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          191   4e-55    
ref|XP_008825221.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    191   4e-55    
ref|XP_007795374.1|  putative dtdp-glucose -dehydratase protein         192   4e-55    
gb|KID73157.1|  dTDP-D-glucose 4,6-dehydratase                          193   4e-55    
gb|KFG80826.1|  dTDP-D-glucose 4,6-dehydratase                          193   4e-55    
gb|KIE00314.1|  dTDP-D-glucose 4,6-dehydratase                          193   5e-55    
gb|KID89209.1|  dTDP-D-glucose 4,6-dehydratase                          193   5e-55    
ref|XP_002713048.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    191   6e-55    
ref|XP_004313346.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...    190   6e-55    
ref|XP_006927417.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    188   7e-55    
gb|AAH05284.1|  TGDS protein                                            189   7e-55    
ref|XP_003765842.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          190   7e-55    
gb|EGU76750.1|  hypothetical protein FOXB_12771                         192   7e-55    
ref|XP_807120.1|  GDP-mannose 4,6 dehydratase                           191   7e-55    
ref|XP_005037773.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          190   7e-55    
ref|XP_008057635.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          190   8e-55    
ref|XP_010957996.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    190   8e-55    
ref|XP_003477586.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          190   8e-55    
gb|EPQ61968.1|  UDP-glucose-4-epimerase                                 193   8e-55    
ref|XP_006211070.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          190   9e-55    
ref|XP_007819737.1|  dTDP-D-glucose 4,6-dehydratase                     192   1e-54    
gb|KHO00791.1|  dTDP-D-glucose 4,6-dehydratase                          192   1e-54    
ref|XP_008154704.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          190   1e-54    
ref|XP_005079467.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          190   1e-54    
ref|XP_003409363.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    190   1e-54    
gb|ERS98048.1|  dTDP-glucose 4,6-dehydratase                            191   1e-54    
ref|XP_003297172.1|  hypothetical protein PTT_07488                     196   1e-54    
ref|XP_005516855.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          190   1e-54    
ref|XP_010957995.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    190   1e-54    
emb|CCU76670.1|  putative dTDP-D-glucose 4,6-dehydratase                192   1e-54    
ref|XP_007456437.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   1e-54    
ref|XP_006978807.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   1e-54    
emb|CEP11333.1|  hypothetical protein                                   191   1e-54    
ref|XP_004884840.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   1e-54    
ref|XP_003789623.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   1e-54    
ref|XP_007811389.1|  dtdp-glucose 4,6-dehydratase                       190   2e-54    
ref|XP_006156669.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-54    
ref|XP_009002779.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-54    
ref|XP_005882452.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-54    
ref|XP_003928247.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   2e-54    
ref|NP_055120.1|  dTDP-D-glucose 4,6-dehydratase isoform 1              189   2e-54    
ref|XP_522697.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase isofo...    189   2e-54    
ref|XP_003832071.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-54    
ref|XP_002742523.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-54    
ref|XP_007101807.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-54    
ref|XP_007196913.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-54    
ref|XP_005305067.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    187   2e-54    
ref|XP_006089899.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-54    
ref|XP_005374168.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-54    
ref|XP_010809203.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   2e-54    
gb|KEZ42904.1|  hypothetical protein SAPIO_CDS5343                      191   2e-54    
ref|XP_005909299.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   2e-54    
ref|XP_004054696.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   2e-54    
ref|XP_004423167.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   2e-54    
emb|CCE32211.1|  related to dTDP-glucose 4,6-dehydratase                191   2e-54    
ref|XP_005687758.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   2e-54    
ref|XP_004709829.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   2e-54    
gb|EWY86757.1|  dTDP-glucose 4,6-dehydratase                            191   2e-54    
ref|XP_007942199.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   2e-54    
ref|XP_003257436.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   2e-54    
gb|EXK94947.1|  dTDP-glucose 4,6-dehydratase                            191   3e-54    
ref|XP_006080395.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   3e-54    
ref|XP_008683235.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   3e-54    
ref|XP_002824410.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   3e-54    
gb|EXA38893.1|  dTDP-glucose 4,6-dehydratase                            191   3e-54    
ref|NP_001094629.1|  dTDP-D-glucose 4,6-dehydratase                     189   3e-54    
ref|XP_006769641.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          189   3e-54    
gb|EWG46674.1|  dTDP-glucose 4,6-dehydratase                            191   3e-54    
gb|ENH73142.1|  Putative rhamnose biosynthetic enzyme 2                 191   3e-54    
ref|XP_009254933.1|  hypothetical protein FPSE_03539                    191   3e-54    
ref|XP_011324006.1|  hypothetical protein FGSG_05467                    191   3e-54    
emb|CCT71341.1|  related to dTDP-glucose 4,6-dehydratase                191   3e-54    
gb|ESS64487.1|  GDP-mannose 4,6 dehydratase                             193   3e-54    
ref|XP_002918693.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   3e-54    
ref|XP_001491790.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   3e-54    
gb|EMF10917.1|  NAD(P)-binding protein                                  191   3e-54    
ref|XP_010628984.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   3e-54    
gb|EHH58661.1|  dTDP-D-glucose 4,6-dehydratase                          188   3e-54    
ref|XP_004457791.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          187   3e-54    
ref|NP_001270865.1|  uncharacterized protein LOC101926513               188   3e-54    
ref|XP_006879634.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          188   4e-54    
ref|XP_003655256.1|  hypothetical protein THITE_2118740                 191   4e-54    
ref|XP_001229786.1|  hypothetical protein CHGG_03270                    191   4e-54    
ref|XP_009190350.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    188   4e-54    
ref|XP_007526909.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          188   4e-54    
ref|XP_010357203.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    188   5e-54    
ref|XP_006743512.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          188   5e-54    
gb|EHK18741.1|  hypothetical protein TRIVIDRAFT_44345                   189   5e-54    
ref|XP_416988.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase isofo...    188   5e-54    
gb|KEQ63328.1|  NAD(P)-binding protein                                  189   5e-54    
ref|XP_003980524.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    188   5e-54    
ref|XP_542640.3|  PREDICTED: dTDP-D-glucose 4,6-dehydratase             188   5e-54    
ref|XP_002196929.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          188   6e-54    
ref|XP_008569757.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          188   6e-54    
ref|XP_005970989.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          188   6e-54    
ref|XP_004408787.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          188   6e-54    
gb|EMT70262.1|  Putative rhamnose biosynthetic enzyme 2                 190   6e-54    
ref|XP_003663287.1|  hypothetical protein MYCTH_2305021                 190   7e-54    
ref|XP_006913872.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          187   7e-54    
ref|XP_011353793.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          187   7e-54    
ref|XP_010628976.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    189   7e-54    
ref|XP_009899796.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          187   8e-54    
ref|XP_004273708.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...    187   9e-54    
gb|EQL01657.1|  dTDP-D-glucose 4,6-dehydratase                          189   1e-53    
ref|XP_003663943.1|  dTDP-D-glucose 4,6-dehydratase-like protein        189   1e-53    
ref|XP_641641.1|  hypothetical protein DDB_G0279465                     189   1e-53    
ref|XP_006666289.1|  dtdp-glucose 4,6-dehydratase                       189   1e-53    
ref|XP_003079576.1|  GDP-mannose 4,6 dehydratase (ISS)                  189   1e-53    
ref|XP_005487541.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          187   1e-53    
gb|KFQ37860.1|  dTDP-D-glucose 4,6-dehydratase                          187   1e-53    
ref|XP_008714320.1|  dTDP-glucose 4,6-dehydratase                       190   1e-53    
ref|XP_005014901.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          187   2e-53    
gb|KEQ60949.1|  dTDP-glucose 4,6-dehydratase                            189   2e-53    
ref|XP_005144815.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          187   2e-53    
ref|XP_010185292.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          186   2e-53    
ref|XP_005305066.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    187   2e-53    
ref|XP_006270243.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          186   2e-53    



>gb|KJB61503.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=535

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLIPSQSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009590265.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009590274.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=671

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M+TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009776312.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=671

 Score =   389 bits (998),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M+TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KJB61502.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=667

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLIPSQSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010093448.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXB54072.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=671

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_007022008.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY13533.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=667

 Score =   385 bits (990),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_004244296.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=674

 Score =   385 bits (990),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M+ YTPKNILITGAAGFIASHVANRLVRSYPDY IVVLDKLDYCSNLKNL+PSRSSPNFK
Sbjct  1    MSNYTPKNILITGAAGFIASHVANRLVRSYPDYNIVVLDKLDYCSNLKNLSPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAY RSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYARSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006597976.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
 ref|XP_006597977.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=668

 Score =   385 bits (989),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009783771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=674

 Score =   385 bits (989),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M+TYTPKNILITGAAGFIA HVANRLVRSYPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KHG22077.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_002531238.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF31135.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=622

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY+PKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYSPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|ACJ11756.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KJB12934.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12935.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12936.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
Length=667

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KHG29785.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   384 bits (986),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SS NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSQSSRNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|ADB24773.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   384 bits (985),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SS NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSQSSRNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_004294169.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
 ref|XP_011460833.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
Length=671

 Score =   384 bits (985),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRLVRS+P+YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009394841.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394842.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   384 bits (985),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MAAYNPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006348335.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=674

 Score =   384 bits (985),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M+ YTPKNILITGAAGFIASHVANRLVRSYP+Y IVVLDKLDYCSNLKNL+PSRSSPNFK
Sbjct  1    MSNYTPKNILITGAAGFIASHVANRLVRSYPEYNIVVLDKLDYCSNLKNLSPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLMTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            +GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  SGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            +ITTRGNNVY
Sbjct  181  IITTRGNNVY  190



>ref|XP_006360030.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006360031.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Solanum tuberosum]
Length=674

 Score =   384 bits (985),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M+TYTPKNILITGAAGFIA HVANRLVRSYPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006585328.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X4 [Glycine max]
 ref|XP_006585329.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X5 [Glycine max]
 ref|XP_006585330.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X6 [Glycine max]
Length=668

 Score =   383 bits (984),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCS+LKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010552134.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Tarenaya hassleriana]
Length=668

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVAN+LVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANKLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_011082806.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Sesamum indicum]
Length=671

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M T+TPKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS +SPNFK
Sbjct  1    MTTFTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSNASPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010537694.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=670

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_002285634.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=675

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009146324.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Brassica 
rapa]
Length=665

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010675264.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M++YTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLRPSQSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009610279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=674

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M+TYTPKNILITGAAGFIA HVANRLVRSYPDYKIVVLDKLDYCSNLKNL PSR SPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRPSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KJB45830.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=403

 Score =   374 bits (961),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_007213598.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 ref|XP_007213599.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14797.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14798.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
Length=671

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M +YTPKNILITGAAGFIASHVANRL+RSYPDY IVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MGSYTPKNILITGAAGFIASHVANRLIRSYPDYNIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_011006811.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
 ref|XP_011006812.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=670

 Score =   383 bits (984),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=690

 Score =   384 bits (985),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCS+LKNL PS+SSPNFK
Sbjct  23   MASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNFK  82

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  83   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  142

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  143  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  202

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  203  VITTRGNNVY  212



>ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
 ref|XP_010327108.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
Length=674

 Score =   383 bits (984),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M+TYTPKNILITGAAGFIA HVANRLVRSYPDYKIVVLDKLDYCS+LKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSSLKNLIPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=691

 Score =   384 bits (985),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCS+LKNL PS+SSPNFK
Sbjct  24   MASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNFK  83

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  84   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  143

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  144  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  203

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  204  VITTRGNNVY  213



>ref|XP_008226345.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=671

 Score =   383 bits (983),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M +YTPKNILITGAAGFIASHVANRL+RSYPDY IVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MGSYTPKNILITGAAGFIASHVANRLIRSYPDYNIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_002317559.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
 gb|EEE98171.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
Length=670

 Score =   383 bits (983),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010675265.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675266.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675267.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M +YTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MPSYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLRPSQSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_011045548.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Populus euphratica]
Length=670

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGD+GSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDVGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KEH38548.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=682

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  13   MATHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  72

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  73   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  132

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  133  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  192

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  193  VITTRGNNVY  202



>ref|XP_010465388.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010502125.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010062770.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 ref|XP_010062771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW69901.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
 gb|KCW69902.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
Length=671

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA YTPKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL+PS+SSPNFK
Sbjct  1    MANYTPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLSPSQSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_004488984.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004488985.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=670

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010487282.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006297150.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
 gb|EOA30048.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
Length=664

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006370064.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
 gb|ERP66633.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
Length=670

 Score =   382 bits (981),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGD+GSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDVGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|NP_188097.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
 sp|Q9LH76.1|RHM3_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3; AltName: Full=Probable rhamnose biosynthetic 
enzyme 3; Short=AtRHM3; Includes: RecName: Full=UDP-glucose 
4,6-dehydratase; Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose 4-keto-reductase 
[Arabidopsis thaliana]
 dbj|BAB02645.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL84958.1| AT3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AAM98324.1| At3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AEE75567.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
Length=664

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_008792282.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+Y PKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MASYEPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGS DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSVDLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|EYU38237.1| hypothetical protein MIMGU_mgv1a002436mg [Erythranthe guttata]
Length=675

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M+T+TPKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PS SSPNFK
Sbjct  1    MSTFTPKNILITGAAGFIASHVANRLVRTYPGYKIVVLDKLDYCSNLKNLLPSNSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FV+GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVQGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>emb|CDY25850.1| BnaA05g14410D [Brassica napus]
Length=428

 Score =   373 bits (958),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  4    TYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKFV  63

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S DLV+YLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  64   KGDIASDDLVSYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  123

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  124  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  183

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  184  TTRGNNVY  191



>ref|XP_006407044.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 ref|XP_006407045.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48497.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48498.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
Length=664

 Score =   381 bits (979),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYG SYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGSSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006594709.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   381 bits (979),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|NP_001151455.1| RHM1 [Zea mays]
 ref|XP_008658705.1| PREDICTED: RHM1 isoform X1 [Zea mays]
 gb|ACG42927.1| RHM1 [Zea mays]
 gb|ACN32027.1| unknown [Zea mays]
 gb|AFW88805.1| RHM1 isoform 1 [Zea mays]
 gb|AFW88806.1| RHM1 isoform 2 [Zea mays]
Length=672

 Score =   381 bits (979),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDK+DYCSNLKNL PSRSSPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPQYKIVVLDKIDYCSNLKNLNPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010273412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=676

 Score =   381 bits (979),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KHN36936.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   381 bits (978),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KJB12930.1| hypothetical protein B456_002G046100 [Gossypium raimondii]
Length=371

 Score =   371 bits (953),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY P+NILITGAAGFIASHV NRL+R+YP YKIV LDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPRNILITGAAGFIASHVTNRLIRNYPSYKIVALDKLDYCSNLKNLHPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FV+GDIGSADLVNYLL TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVEGDIGSADLVNYLLFTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP+NPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPSNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KHN19477.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   381 bits (978),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006592951.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   381 bits (978),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010535018.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Tarenaya hassleriana]
Length=667

 Score =   381 bits (978),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNIL+TGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCS+LKNL PS+SSPNFK
Sbjct  1    MATYKPKNILVTGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FV+GDI SADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVEGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006389974.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
 gb|ESQ27260.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
Length=669

 Score =   380 bits (977),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKQSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_002882893.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59152.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
Length=664

 Score =   380 bits (977),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVRSYP+YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPEYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|EMS45937.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=675

 Score =   380 bits (977),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRL+RSYP YKIVVLDK+DYCSNLKNL PSR SPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLIRSYPHYKIVVLDKIDYCSNLKNLNPSRPSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_004509959.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cicer 
arietinum]
Length=667

 Score =   380 bits (977),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRLVRS+P+YKIVVLDKLDYCSNLKNL PS+SS NFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKSSSNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAIVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>dbj|BAJ86835.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=675

 Score =   380 bits (977),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRL+RSYP YKIVVLDK+DYCSNLKNL PSR SPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLIRSYPHYKIVVLDKIDYCSNLKNLNPSRPSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_007149511.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
 gb|ESW21505.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
Length=669

 Score =   380 bits (976),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAIVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 ref|XP_004156513.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN53576.1| hypothetical protein Csa_4G083510 [Cucumis sativus]
Length=670

 Score =   380 bits (976),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLVRNYPGYKIVVLDKLDYCSNLKNLLPSKPSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010915435.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915436.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915438.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
Length=678

 Score =   380 bits (977),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATFTPKNILITGAAGFIASHVANRLIRNYPNYKIVVLDKLDYCSNLKNLLPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006301908.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
 gb|EOA34806.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
Length=669

 Score =   380 bits (976),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKQSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_008451740.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451741.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451742.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
Length=670

 Score =   380 bits (976),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MAT+TPKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLVRNYPGYKIVVLDKLDYCSNLKNLLPSKPSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010924680.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Elaeis guineensis]
Length=673

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGA GFIASHVAN L+R+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATYKPKNILITGAGGFIASHVANCLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|NP_177978.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9SYM5.1|RHM1_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1; AltName: Full=Protein REPRESSOR OF LRX1 1; AltName: 
Full=Rhamnose biosynthetic enzyme 1; Short=AtRHM1; Includes: 
RecName: Full=UDP-glucose 4,6-dehydratase; Includes: 
RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAD30579.1|AC007260_10 Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAK68773.1| Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAM10033.1| similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AEE36122.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=669

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009395981.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   379 bits (973),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PSRS PNF+
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPKYKIVVLDKLDYCSNLKNLNPSRSCPNFR  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQ+RRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQVRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KEH17189.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=798

 Score =   382 bits (982),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRLVRS+P+YKIVVLDKLDYCSNLKNL PS++SPNFK
Sbjct  131  MASYTPKNILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKASPNFK  190

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  191  FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  250

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  251  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  310

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  311  VITTRGNNVY  320



>gb|EYU26294.1| hypothetical protein MIMGU_mgv1a002474mg [Erythranthe guttata]
Length=669

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M+T+TPKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL PS++S NFK
Sbjct  1    MSTFTPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLLPSKASANFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>emb|CDY35137.1| BnaA06g11470D [Brassica napus]
Length=670

 Score =   378 bits (971),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            ++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+ SPNFKF
Sbjct  3    SSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKF  62

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            VKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNYLLITERIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  182

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  183  ITTRGNNVY  191



>ref|XP_004984748.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=673

 Score =   378 bits (970),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PSR SPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSNLKNLNPSRPSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009149137.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=672

 Score =   378 bits (970),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            ++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+ SPNFKF
Sbjct  3    SSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKF  62

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            VKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNYLLITERIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  182

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  183  ITTRGNNVY  191



>emb|CDY40003.1| BnaC05g13120D [Brassica napus]
Length=670

 Score =   378 bits (970),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            ++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+ SPNFKF
Sbjct  3    SSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKF  62

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            VKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  182

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  183  ITTRGNNVY  191



>ref|XP_010916151.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Elaeis guineensis]
Length=673

 Score =   378 bits (970),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FV GDI SAD+VNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVNGDIASADVVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_011098163.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
 ref|XP_011098164.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
Length=675

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M T+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MTTFTPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIDSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAY RSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYARSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KJB45828.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=564

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KJB45829.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=546

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009394163.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=675

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLV +YP+YKIVVLDKLDYCSNLKNL  SRSSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVWNYPEYKIVVLDKLDYCSNLKNLNLSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009376726.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009376727.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Pyrus x bretschneideri]
Length=668

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M +YTPKNILITGAAGFIASHVANRL+RSYP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MGSYTPKNILITGAAGFIASHVANRLIRSYPGYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNS EFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010501002.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TYTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  6    TYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  66   KGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  125

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  126  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  185

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  186  TTRGNNVY  193



>ref|XP_006306947.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
 gb|EOA39845.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
Length=668

 Score =   376 bits (965),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TYTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  6    TYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  66   KGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  125

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  126  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  185

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  186  TTRGNNVY  193



>gb|KDP30504.1| hypothetical protein JCGZ_17141 [Jatropha curcas]
Length=671

 Score =   376 bits (965),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+ S NFK
Sbjct  1    MATYKPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKLSANFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006442344.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442345.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442346.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55584.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55585.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55586.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
Length=668

 Score =   376 bits (965),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PS++S NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KCW47402.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=530

 Score =   371 bits (953),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 186/191 (97%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT YTPKNILITGAAGFIASHV NRL+R+YP YKIVVLDKLDYCSNLKNL PSRSSPNF
Sbjct  1    MATAYTPKNILITGAAGFIASHVCNRLIRNYPGYKIVVLDKLDYCSNLKNLLPSRSSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KF+KGDI SADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDIASADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>gb|KDO49287.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
 gb|KDO49288.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
Length=668

 Score =   375 bits (964),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PS++S NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006477818.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477819.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Citrus sinensis]
Length=668

 Score =   375 bits (964),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PS++S NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_002468088.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
 gb|EER95086.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
Length=672

 Score =   375 bits (964),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCS+LKNL PSR+SPN K
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASPNLK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLVTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_008812156.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score =   375 bits (964),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHV NRL+R+YP+YKIVVLD+LDYCSNLKNL PS SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVTNRLIRNYPEYKIVVLDRLDYCSNLKNLNPSSSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_008791880.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
 ref|XP_008791888.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=682

 Score =   375 bits (964),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA +TPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNL N  PSRSSPNFK
Sbjct  1    MAAHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLNNFLPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK+
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKL  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|ABF95280.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
Length=545

 Score =   371 bits (953),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA Y PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCS+L NL PSR SPNFK
Sbjct  1    MAAYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLSNLNPSRPSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLL TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLTTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_004984749.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=672

 Score =   375 bits (963),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCS+LKNL PSRSSPN K
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSSLKNLNPSRSSPNLK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64003.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   375 bits (963),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRL+RSYP Y IVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPHYNIVVLDKLDYCSNLKNLNPSKQSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KJB45831.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=667

 Score =   374 bits (961),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>emb|CDX88455.1| BnaC06g38990D [Brassica napus]
Length=707

 Score =   375 bits (964),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 195/206 (95%), Gaps = 2/206 (1%)
 Frame = +3

Query  51   YGVILIRIAQ*EISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYC  230
            + +I+ +I +  I  +MA+YTPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYC
Sbjct  24   WPLIVTKIPK--ILREMASYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYC  81

Query  231  SNLKNLTPSRSSPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFT  410
            SNLKNL PS++SP+FKFVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFT
Sbjct  82   SNLKNLNPSKNSPSFKFVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFT  141

Query  411  KNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKA  590
            KNNIYGTHVLLEACKVTGQ+RRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKA
Sbjct  142  KNNIYGTHVLLEACKVTGQVRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKA  201

Query  591  GAEMLVMAYGRSYGLPVITTRGNNVY  668
            GAEMLVMAYGRSYGLPVITTRGNNVY
Sbjct  202  GAEMLVMAYGRSYGLPVITTRGNNVY  227



>ref|XP_010479911.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   374 bits (961),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TYTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  6    TYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  66   KGDIASDDLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  125

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  126  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  185

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  186  TTRGNNVY  193



>ref|XP_002894444.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70703.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
Length=668

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  6    TYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  66   KGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  125

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  126  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  185

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  186  TTRGNNVY  193



>ref|XP_010462242.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TYTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  6    TYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  66   KGDIASDDLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  125

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  126  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  185

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  186  TTRGNNVY  193



>ref|XP_009106565.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
 ref|XP_009106567.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=670

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS++SP+FK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSKNSPSFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQ+RRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQVRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009421279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=678

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+YTPKNILITGAAGFIASHVANRLVR+YPDYK+VVLDKLDYCSNLKNL PS  SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRNYPDYKVVVLDKLDYCSNLKNLHPSLCSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLV++LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVHFLLLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>emb|CDY60210.1| BnaCnng35880D [Brassica napus]
Length=668

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  4    TYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKFV  63

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S DLV+YLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  64   KGDIASDDLVSYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  123

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  124  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  183

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  184  TTRGNNVY  191



>ref|XP_010671686.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=675

 Score =   374 bits (959),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCS LKNL PS+SS NFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSELKNLLPSQSSANFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI+RFIHVSTDEVYGET+EDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIKRFIHVSTDEVYGETEEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza 
brachyantha]
Length=673

 Score =   374 bits (959),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA Y PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCS+LKNL PSR SPN K
Sbjct  1    MAAYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRPSPNLK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006392784.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
 gb|ESQ30070.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
Length=667

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNF+FV
Sbjct  4    TYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFRFV  63

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  64   KGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  123

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  124  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  183

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  184  TTRGNNVY  191



>ref|XP_006647099.1| PREDICTED: probable rhamnose biosynthetic enzyme 3-like [Oryza 
brachyantha]
Length=667

 Score =   373 bits (958),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/187 (95%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHV NR+VRSYPDYKIVVLDKLDYCSNLKNL P+ SSPNFKFVK
Sbjct  5    YKPKNILITGAAGFIASHVTNRIVRSYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKFVK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  185  TRGNNVY  191



>gb|KHG07031.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   373 bits (958),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SP+FK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPSFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|EMT23371.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=667

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 186/191 (97%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT YTPK+ILITGAAGFIASHV NR+VR+YPDYKIVVLDKLDYCSNLKNL P+ SSPNF
Sbjct  1    MATPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KFVKGDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFVKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>gb|EMS59810.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=667

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 186/191 (97%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT YTPK+ILITGAAGFIASHV NR+VR+YPDYKIVVLDKLDYCSNLKNL P+ SSPNF
Sbjct  1    MATPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KFVKGDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFVKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>ref|XP_003571828.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
 ref|XP_010234080.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
Length=667

 Score =   373 bits (957),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 186/191 (97%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT YTPK+ILITGAAGFIASHV NR+VR+YPDYKIVVLDKLDYCSNLKNL P+ SSPNF
Sbjct  1    MATPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KFVKGDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFVKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>gb|ADB24772.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   372 bits (956),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SP+FK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLFPSKLSPSFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|NP_564633.2| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9LPG6.1|RHM2_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2; AltName: Full=NDP-rhamnose synthase; AltName: 
Full=Protein MUCILAGE-MODIFIED 4; AltName: Full=Protein RHAMNOSE 
BIOSYNTHESIS 2; AltName: Full=Rhamnose biosynthetic enzyme 
2; Short=AtRHM2; AltName: Full=UDP-L-rhamnose synthase 
MUM4; Includes: RecName: Full=UDP-glucose 4,6-dehydratase; 
Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAF78439.1|AC018748_18 Contains similarity to dTPD-D-glucose-4,6-dehydratase from Sphingomonas 
sp.S88 gb|U51197 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain [Arabidopsis thaliana]
 gb|AAG51981.1|AC024260_19 dTDP-D-glucose 4,6-dehydratase, putative; 102946-105028 [Arabidopsis 
thaliana]
 emb|CAD92667.1| putative NDP-rhamnose synthase [Arabidopsis thaliana]
 gb|AAP93963.1| putative UDP-L-rhamnose synthase MUM4 [Arabidopsis thaliana]
 gb|AEE32949.1| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=667

 Score =   372 bits (956),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  5    TYKPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  64

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  65   KGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  124

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  125  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  184

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  185  TTRGNNVY  192



>ref|XP_010417456.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Camelina sativa]
 ref|XP_010417457.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Camelina sativa]
 ref|XP_010417458.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X3 
[Camelina sativa]
Length=671

 Score =   372 bits (956),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M++YTPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PSR SPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSRHSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI RFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQITRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>dbj|BAJ97692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   372 bits (956),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 186/191 (97%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT YTPK+ILITGAAGFIASHV NR+VR+YPDYKIVVLDKLDYCSNLKNL P+ SSPNF
Sbjct  1    MATPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KFVKGDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFVKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>ref|XP_010035897.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW47401.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=674

 Score =   373 bits (957),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 186/191 (97%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT YTPKNILITGAAGFIASHV NRL+R+YP YKIVVLDKLDYCSNLKNL PSRSSPNF
Sbjct  1    MATAYTPKNILITGAAGFIASHVCNRLIRNYPGYKIVVLDKLDYCSNLKNLLPSRSSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KF+KGDI SADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDIASADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>ref|XP_010429684.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472689.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472690.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=670

 Score =   372 bits (956),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M++YTPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PSR SPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSRHSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQI RFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQITRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_006845495.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
 gb|ERN07170.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
Length=681

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/187 (95%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFKFVK
Sbjct  14   YTPKNILITGAAGFIASHVANRLIRNYPNYKIVVLDKLDYCSNLKNLLPSRSSPNFKFVK  73

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  74   GDIASADLVNFLLITEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  133

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            + RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  134  VTRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  193

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  194  TRGNNVY  200



>emb|CDP06058.1| unnamed protein product [Coffea canephora]
Length=653

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA Y P+NILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSN+KNL PS+SSP +K
Sbjct  1    MAPYKPQNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNMKNLLPSQSSPKYK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            +G +RRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  SGGVRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|NP_001049724.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|ABF95277.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95278.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95279.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11638.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|EEC74971.1| hypothetical protein OsI_10998 [Oryza sativa Indica Group]
 gb|EEE58799.1| hypothetical protein OsJ_10344 [Oryza sativa Japonica Group]
 gb|AJB98437.1| NAD-dependent epimerase/dehydratase family domain containing 
protein, partial [Oryza sativa]
Length=675

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MA Y PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCS+L NL PSR SPNFK
Sbjct  1    MAAYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLSNLNPSRPSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNYLL TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLTTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>emb|CDY45116.1| BnaC06g06370D [Brassica napus]
Length=665

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT Y PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNF
Sbjct  1    MATEYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            +FVKGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   RFVKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQI+RFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIKRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>ref|XP_009147602.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=665

 Score =   371 bits (952),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT Y PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNF
Sbjct  1    MATEYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            +FVKGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   RFVKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQI+RFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIKRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>emb|CDY24092.1| BnaA06g00900D [Brassica napus]
Length=665

 Score =   371 bits (952),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT Y PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNF
Sbjct  1    MATEYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            +FVKGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   RFVKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQI+RFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIKRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>ref|XP_009144768.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
 ref|XP_009144769.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=668

 Score =   371 bits (952),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/188 (95%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  4    TYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKFV  63

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S DLV+YLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT 
Sbjct  64   KGDIASDDLVSYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTR  123

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  124  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  183

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  184  TTRGNNVY  191



>ref|XP_004303854.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Fragaria vesca subsp. vesca]
Length=679

 Score =   371 bits (952),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/188 (93%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHV NRL+R+YP+Y IVVLDKLDYCSNLKNL PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRLIRNYPEYNIVVLDKLDYCSNLKNLHPSRSSPNFKFI  63

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDIGSADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  64   KGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  123

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI
Sbjct  124  QIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  183

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  184  TTRGNNVY  191



>ref|XP_002468080.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
 gb|EER95078.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
Length=672

 Score =   370 bits (950),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCS+LKNL PSR+S N K
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASQNLK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLVTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_007215006.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
 gb|EMJ16205.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
Length=675

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 186/191 (97%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT Y PKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSS NF
Sbjct  1    MATAYKPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLHPSRSSSNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KF+KGDIGSADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>ref|XP_007146360.1| hypothetical protein PHAVU_006G034000g [Phaseolus vulgaris]
 gb|ESW18354.1| hypothetical protein PHAVU_006G034000g [Phaseolus vulgaris]
Length=666

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHV NR+VR+YPDYKIVVLDKLDYCSNLKNL PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVRNYPDYKIVVLDKLDYCSNLKNLMPSRSSPNFKFI  63

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  461
            KGDIGSADLVNY+L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSG  123

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  183

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  184  ITTRGNNVY  192



>ref|XP_009356652.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNIL+TGAAGFIASHV NRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFKF+K
Sbjct  5    YKPKNILLTGAAGFIASHVCNRLIRNYPAYKIVVLDKLDYCSNLKNLHPSKSSPNFKFIK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDIGSADLVN++L+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  185  TRGNNVY  191



>emb|CDP21573.1| unnamed protein product, partial [Coffea canephora]
Length=247

 Score =   354 bits (908),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY P+NILITGAAGF+ASHVANRL+R+YP YKIVVLDKLDYCSN KNL PSRSSPNFK
Sbjct  1    MATYKPENILITGAAGFVASHVANRLIRNYPSYKIVVLDKLDYCSNEKNLNPSRSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN++L+TE+IDT+MHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHILLTESIDTLMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
             G I+RFIHVSTD+VYG TD DAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  AGNIKRFIHVSTDDVYGGTDGDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGN VY
Sbjct  181  VITTRGNKVY  190



>ref|XP_008229395.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=669

 Score =   368 bits (945),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 186/191 (97%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT Y PKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSS NF
Sbjct  1    MATAYKPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLHPSRSSSNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KF+KGDIGSADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFT+NNIYGTHVLLEACK
Sbjct  61   KFIKGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTRNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>ref|XP_003551914.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006602243.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=660

 Score =   368 bits (944),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHV NR+VR+YPDYKI+VLDKLDYCSNLKNL PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVRNYPDYKIIVLDKLDYCSNLKNLIPSRSSPNFKFI  63

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  461
            KGDIGSADLVNY+L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSK  123

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  183

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  184  ITTRGNNVY  192



>ref|XP_008654228.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654237.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654239.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654245.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 tpg|DAA44692.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44693.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44694.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
Length=672

 Score =   368 bits (945),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHV N LVR+YP YKIVVLDKLDYCS+LKNL PSR+SPN K
Sbjct  1    MATYEPKNILITGAAGFIASHVTNCLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASPNLK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLVTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>gb|KHN18103.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=660

 Score =   368 bits (944),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHV NR+VR+YPDYKI+VLDKLDYCSNLKNL PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVRNYPDYKIIVLDKLDYCSNLKNLIPSRSSPNFKFI  63

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  461
            KGDIGSADLVNY+L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSK  123

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  183

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  184  ITTRGNNVY  192



>ref|XP_008380229.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score =   368 bits (945),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNIL+TGAAGFIASHV NRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSP FKF+K
Sbjct  5    YKPKNILLTGAAGFIASHVCNRLIRNYPAYKIVVLDKLDYCSNLKNLNPSKSSPKFKFIK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDIGSADLVN++L+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  185  TRGNNVY  191



>ref|XP_010060763.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW67616.1| hypothetical protein EUGRSUZ_F01369 [Eucalyptus grandis]
Length=666

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M +YTPKNILITGAAGFIA HVANRL R++ +YKIVVLDKLDYCSNLKNL PS+S+PNFK
Sbjct  1    MTSYTPKNILITGAAGFIACHVANRLTRNFTEYKIVVLDKLDYCSNLKNLLPSKSAPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FV+GDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+V
Sbjct  61   FVQGDIASADLVNHLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_009377674.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNIL+TGAAGFIASHV NRL+++YP YKIVVLDKLDYCSNLKNL PS+SSPNFKF+K
Sbjct  5    YKPKNILLTGAAGFIASHVCNRLIQNYPGYKIVVLDKLDYCSNLKNLNPSKSSPNFKFIK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDIGSADLVN++L+TENIDTIMHFAAQTHVDNSFGNSFEFT+NNIYGTHVLLEACKVTGQ
Sbjct  65   GDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTQNNIYGTHVLLEACKVTGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  185  TRGNNVY  191



>gb|KHG15836.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=681

 Score =   365 bits (937),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCS+LKNL PSRSSPNFKF+K
Sbjct  5    YTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDPSRSSPNFKFIK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLV+++L TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVHFILQTEFIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  185  TRGNNVY  191



>ref|XP_006484833.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=676

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT YTPKNILITGAAGFIASHV NRL+ +YP+YKIVVLDKLDYCSNLKNL PSR SPNF
Sbjct  1    MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KF+KGD+ SADLV+++L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            +TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  ITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>ref|XP_008342373.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNIL+TGAAGFIASHV NRL+++YP YKIVVLDKLDYCSNLKNL PS+SSPN KF+K
Sbjct  5    YKPKNILLTGAAGFIASHVCNRLIQNYPGYKIVVLDKLDYCSNLKNLNPSKSSPNLKFIK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDIGSADLVN++L+TENIDTIMHFAAQTHVDNSFGNSFEFT+NNIYGTHVLLEACKVTGQ
Sbjct  65   GDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTQNNIYGTHVLLEACKVTGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  185  TRGNNVY  191



>ref|XP_001775602.1| predicted protein [Physcomitrella patens]
 gb|EDQ59549.1| predicted protein [Physcomitrella patens]
Length=679

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  96   KMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            K+  Y PKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS++S NF
Sbjct  6    KVDAYVPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLFPSKASKNF  65

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KFVKGDIGSADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  66   KFVKGDIGSADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  125

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQI+RFIHVSTDEVYGET+ +A+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  126  VTGQIKRFIHVSTDEVYGETEAEAIVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  185

Query  636  PVITTRGNNVY  668
            P ITTRGNNVY
Sbjct  186  PCITTRGNNVY  196



>ref|XP_006437200.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
 gb|ESR50440.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
Length=676

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT YTPKNILITGAAGFIASHV NRL+ +YP+YKIVVLDKLDYCSNLKNL PSR SPNF
Sbjct  1    MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KF+KGD+ SADLV+++L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            +TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  ITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>gb|KDO60921.1| hypothetical protein CISIN_1g005818mg [Citrus sinensis]
Length=676

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT YTPKNILITGAAGFIASHV NRL+ +YP+YKIVVLDKLDYCSNLKNL PSR SPNF
Sbjct  1    MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KF+KGD+ SADLV+++L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            +TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  ITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>gb|ADB24774.1| rhamnose synthase [Gossypium hirsutum]
Length=681

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCS+LKNL PSRSSPNFKF+K
Sbjct  5    YTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDPSRSSPNFKFIK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLV+++L TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVHFILQTEFIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFIHVSTDEVYGETDEDAMVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  185  TRGNNVY  191



>ref|XP_007048831.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007048832.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92988.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92989.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
Length=732

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 185/191 (97%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT YTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCS+LKNL P+R SPNF
Sbjct  1    MATRYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLNPARLSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KF+KGDI SADLV ++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDIASADLVQFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQ++RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQVKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>emb|CDP18722.1| unnamed protein product [Coffea canephora]
Length=676

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY P+NILITGAAGFIA HVANRL+R+YP YKIVVLDKLDYCSN KNL PS SSPNFK
Sbjct  1    MATYKPENILITGAAGFIACHVANRLIRNYPRYKIVVLDKLDYCSNKKNLDPSCSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TG I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  121  TGNIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  181  VITTRGNNVY  190



>ref|XP_010109352.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXC21996.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=673

 Score =   363 bits (931),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT Y PKNILITGAAGFIASHV NRL+R+YP+Y IVVLDKLDYCSNLKNL PSRSS N 
Sbjct  1    MATAYKPKNILITGAAGFIASHVCNRLIRNYPEYNIVVLDKLDYCSNLKNLLPSRSSLNI  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KF+KGDIGSADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            VTGQI+RFIHVSTDEVYGET+EDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  121  VTGQIKRFIHVSTDEVYGETEEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>gb|KJB75445.1| hypothetical protein B456_012G042300 [Gossypium raimondii]
Length=681

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCS+LKNL  SRSSPNFKF+K
Sbjct  5    YTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDRSRSSPNFKFIK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLV+++L TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVHFILQTEFIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  185  TRGNNVY  191



>ref|XP_004960685.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=666

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = +3

Query  99   MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  275
            MAT Y PKNILITGAAGFIASHVA R+ + YPDYKIVVLDKLDYCSNLKNL P  SSPNF
Sbjct  1    MATAYKPKNILITGAAGFIASHVAIRITKKYPDYKIVVLDKLDYCSNLKNLLPVSSSPNF  60

Query  276  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  455
            KFVKGDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFVKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  456  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            +TGQI+RFIHVSTDEVYGETDEDAVVGN EASQLLPTNPY+ATKAGAEMLVMAYGRSYGL
Sbjct  121  ITGQIKRFIHVSTDEVYGETDEDAVVGNKEASQLLPTNPYAATKAGAEMLVMAYGRSYGL  180

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  181  PVITTRGNNVY  191



>gb|AFW77499.1| hypothetical protein ZEAMMB73_283149 [Zea mays]
Length=529

 Score =   356 bits (913),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHVA R+ + YPDYKI+VLDKLDYCSNLKNL P  SSPNFKFVK
Sbjct  15   YKPKNILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFVK  74

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+++GQ
Sbjct  75   GDIASVDLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRISGQ  134

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPY+ATKAGAEMLVMAYGRSYGLPVIT
Sbjct  135  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYAATKAGAEMLVMAYGRSYGLPVIT  194

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  195  TRGNNVY  201



>ref|XP_001775697.1| predicted protein [Physcomitrella patens]
 gb|EDQ59500.1| predicted protein [Physcomitrella patens]
Length=669

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PSR+S NFKFVK
Sbjct  6    YEPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLFPSRASKNFKFVK  65

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDIGSADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  66   GDIGSADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  125

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGET+ +A+VGNHEASQLLPTNPYSATKAGAEMLVMAY +SYGLP IT
Sbjct  126  IKRFIHVSTDEVYGETEAEAIVGNHEASQLLPTNPYSATKAGAEMLVMAYAKSYGLPCIT  185

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  186  TRGNNVY  192



>gb|KHM99622.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=582

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 182/189 (96%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TY PKNILITGAAGFIASHV NR+V++YPDYKI+VLDKLDYCSNLKNL    SSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVQNYPDYKIIVLDKLDYCSNLKNLIHLCSSPNFKFI  63

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  461
            KGDIGSADLVNY+L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSK  123

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  183

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  184  ITTRGNNVY  192



>ref|XP_001766894.1| predicted protein [Physcomitrella patens]
 gb|EDQ68296.1| predicted protein [Physcomitrella patens]
Length=677

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS++S NFKFVK
Sbjct  10   YVPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLFPSKASKNFKFVK  69

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  70   GDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  129

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGET+ +A+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP IT
Sbjct  130  IKRFIHVSTDEVYGETEAEAIVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPCIT  189

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  190  TRGNNVY  196



>gb|ACG33666.1| RHM1 [Zea mays]
Length=666

 Score =   357 bits (915),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHVA R+ + YPDYKI+VLDKLDYCSNLKNL P  SSPNFKFVK
Sbjct  5    YKPKNILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFVK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+++GQ
Sbjct  65   GDIASVDLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRISGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPY+ATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYAATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  185  TRGNNVY  191



>ref|NP_001130297.1| uncharacterized protein LOC100191391 [Zea mays]
 gb|ACF78472.1| unknown [Zea mays]
 gb|AFW77498.1| RHM1 [Zea mays]
Length=676

 Score =   357 bits (916),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHVA R+ + YPDYKI+VLDKLDYCSNLKNL P  SSPNFKFVK
Sbjct  15   YKPKNILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFVK  74

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+++GQ
Sbjct  75   GDIASVDLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRISGQ  134

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPY+ATKAGAEMLVMAYGRSYGLPVIT
Sbjct  135  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYAATKAGAEMLVMAYGRSYGLPVIT  194

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  195  TRGNNVY  201



>ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
 gb|EES19282.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
Length=666

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHVA R+ + YPDYKIVVLDKLDYCSNLKNL P  SSPNFKFVK
Sbjct  5    YKPKNILITGAAGFIASHVAIRVTKKYPDYKIVVLDKLDYCSNLKNLLPVSSSPNFKFVK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLVN+LL+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC++TGQ
Sbjct  65   GDIASADLVNFLLVTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRITGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPY+ATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYAATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            +RGNNV+
Sbjct  185  SRGNNVF  191



>ref|XP_002964674.1| hypothetical protein SELMODRAFT_266803 [Selaginella moellendorffii]
 gb|EFJ35007.1| hypothetical protein SELMODRAFT_266803 [Selaginella moellendorffii]
Length=676

 Score =   353 bits (905),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTP+NILITGAAGFIASHVANRLVRSYP YKIVVLDKLDYCSNLKNL  S+ S NFKFVK
Sbjct  14   YTPRNILITGAAGFIASHVANRLVRSYPGYKIVVLDKLDYCSNLKNLYQSKESANFKFVK  73

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNS EFTKNNIYGTHVLLEACKV G 
Sbjct  74   GDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLEACKVAGT  133

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            IRRFIHVSTDEVYGET+ DA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP IT
Sbjct  134  IRRFIHVSTDEVYGETEADAIVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPFIT  193

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  194  TRGNNVY  200



>ref|XP_002989472.1| hypothetical protein SELMODRAFT_129972 [Selaginella moellendorffii]
 gb|EFJ09348.1| hypothetical protein SELMODRAFT_129972 [Selaginella moellendorffii]
Length=675

 Score =   353 bits (905),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTP+NILITGAAGFIASHVANRLVRSYP YKIVVLDKLDYCSNLKNL  S+ S NFKFVK
Sbjct  14   YTPRNILITGAAGFIASHVANRLVRSYPGYKIVVLDKLDYCSNLKNLYQSKESANFKFVK  73

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNS EFTKNNIYGTHVLLEACKV G 
Sbjct  74   GDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLEACKVAGT  133

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            IRRFIHVSTDEVYGET+ DA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP IT
Sbjct  134  IRRFIHVSTDEVYGETEADAIVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPFIT  193

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  194  TRGNNVY  200



>ref|XP_008380346.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
 ref|XP_008358039.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
Length=688

 Score =   353 bits (905),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNIL+TGAAGFIASHV NRL+R+YPDY IVVLDKLDYCSNLKNL PS SSPNFKF+K
Sbjct  5    YKPKNILLTGAAGFIASHVCNRLIRNYPDYNIVVLDKLDYCSNLKNLHPSMSSPNFKFIK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GD GSAD VN++L+TENIDTIMHFAAQTHVDNSFGNSF FTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDKGSADFVNFILLTENIDTIMHFAAQTHVDNSFGNSFGFTKNNIYGTHVLLEACKVTGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RF+HVSTDEVYGET+E AVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFVHVSTDEVYGETNEGAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRG+NVY
Sbjct  185  TRGHNVY  191



>ref|XP_002515360.1| dtdp-glucose 4,6-dehydratase, putative [Ricinus communis]
 gb|EEF46809.1| dtdp-glucose 4,6-dehydratase, putative [Ricinus communis]
Length=369

 Score =   342 bits (878),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  87   ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  266
            +S   A Y PK ILITGAAGFIASHV NRL+R+YPDYKIV LDKLDYCS+L+NLTP RSS
Sbjct  1    MSSNHAPYEPKKILITGAAGFIASHVTNRLIRNYPDYKIVALDKLDYCSSLRNLTPCRSS  60

Query  267  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  446
            PNFKFVKGDI SADLVN+LLI E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKGDIASADLVNHLLIAEDIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLE  120

Query  447  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRS  626
            ACKVT +I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RS
Sbjct  121  ACKVTKKIKRFIHVSTDEVYGETDMETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRS  180

Query  627  YGLPVITTRGNNVY  668
            YGLP ITTRGNNVY
Sbjct  181  YGLPTITTRGNNVY  194



>ref|XP_001779703.1| predicted protein [Physcomitrella patens]
 gb|EDQ55499.1| predicted protein [Physcomitrella patens]
Length=666

 Score =   352 bits (902),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            + PKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+ S NFKFVK
Sbjct  2    HEPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLFPSKGSKNFKFVK  61

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  62   GDIASADLVNFLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  121

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGET+ +A+VGNHEASQLLPTNPYSATKAGAEMLVMAY +SYGLP IT
Sbjct  122  IKRFIHVSTDEVYGETEVEAIVGNHEASQLLPTNPYSATKAGAEMLVMAYAKSYGLPCIT  181

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  182  TRGNNVY  188



>ref|XP_009356708.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Pyrus x bretschneideri]
Length=689

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PK+IL+TGAAGFIASHV NRL+R+YPDY IVVLDKLDYCSNLKNL PS SS NFKF+K
Sbjct  5    YKPKSILLTGAAGFIASHVCNRLIRNYPDYNIVVLDKLDYCSNLKNLHPSMSSANFKFIK  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDIGSAD VN++L+TENIDTIMHFAAQTHVDNSFGNSF FTKNNI GTHVLLEAC VTGQ
Sbjct  65   GDIGSADFVNFILLTENIDTIMHFAAQTHVDNSFGNSFGFTKNNICGTHVLLEACNVTGQ  124

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RF+HVSTDEVYGET+EDAVVGN EASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct  125  IKRFVHVSTDEVYGETNEDAVVGNPEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  184

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  185  TRGNNVY  191



>gb|EMT08126.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=433

 Score =   338 bits (867),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 178/192 (93%), Gaps = 1/192 (1%)
 Frame = +3

Query  93   VKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPN  272
            ++MATY PKNILITGAAGFIASHVANRLVR+YP Y IV+LD++DYCS+L+NL PSR SPN
Sbjct  64   LQMATYEPKNILITGAAGFIASHVANRLVRNYPRYNIVILDRVDYCSSLRNLDPSRGSPN  123

Query  273  FKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  452
            FKFV+GDI SADLVN+LL+TE+IDT+MHFAAQTHVDNSF +SFEFTKNN+YGTHVLLEAC
Sbjct  124  FKFVRGDIASADLVNHLLVTESIDTVMHFAAQTHVDNSFSSSFEFTKNNVYGTHVLLEAC  183

Query  453  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYG  632
            K   +IRRFIHVSTDEVYGETD +AVVGNHE S+LLPTNPYSATKAGAEMLVMAY RSY 
Sbjct  184  KQV-KIRRFIHVSTDEVYGETDLNAVVGNHEESRLLPTNPYSATKAGAEMLVMAYARSYN  242

Query  633  LPVITTRGNNVY  668
            LPVITTRGNNVY
Sbjct  243  LPVITTRGNNVY  254



>gb|EMS55907.1| putative rhamnose biosynthetic enzyme 3 [Triticum urartu]
Length=492

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 177/192 (92%), Gaps = 1/192 (1%)
 Frame = +3

Query  93   VKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPN  272
            ++MATY PKNILITGAAGFIASHVANRLVR+YP Y IV+LD++DYCS+L+NL PSR SPN
Sbjct  90   LQMATYEPKNILITGAAGFIASHVANRLVRNYPRYNIVILDRVDYCSSLRNLDPSRGSPN  149

Query  273  FKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  452
            FKFV+GDI SADLVN+LL+TE+IDT+MHFAAQTHVDNSF  SFEFTKNN+YGTH+LLEAC
Sbjct  150  FKFVRGDIASADLVNHLLVTESIDTVMHFAAQTHVDNSFSCSFEFTKNNVYGTHILLEAC  209

Query  453  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYG  632
            K   +IRRFIHVSTDEVYGETD +AVVGNHE S+LLPTNPYSATKAGAEMLVMAY RSY 
Sbjct  210  KQV-KIRRFIHVSTDEVYGETDVNAVVGNHEESRLLPTNPYSATKAGAEMLVMAYARSYN  268

Query  633  LPVITTRGNNVY  668
            LPVITTRGNNVY
Sbjct  269  LPVITTRGNNVY  280



>ref|XP_004172221.1| PREDICTED: probable rhamnose biosynthetic enzyme 2-like, partial 
[Cucumis sativus]
Length=354

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHV NRL+++YP YKIV LDKLDYCSN+KNL PS++SPNF+F+K
Sbjct  9    YAPKNILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFIK  68

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADL+NYLL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  69   GDIVSADLINYLLVAEEIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTQR  128

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP IT
Sbjct  129  IKRFIHVSTDEVYGETDLETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPTIT  188

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  189  TRGNNVY  195



>ref|XP_008351771.1| PREDICTED: LOW QUALITY PROTEIN: probable rhamnose biosynthetic 
enzyme 1, partial [Malus domestica]
Length=340

 Score =   332 bits (850),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +3

Query  123  ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVKGDIGS  302
            ILITGAAGFI  HV N+L+R+YP+YKI+VLDKLDYCSNLKNL PS SSPN KF+KGDI S
Sbjct  1    ILITGAAGFIGXHVVNQLMRNYPEYKILVLDKLDYCSNLKNLHPSHSSPNLKFIKGDICS  60

Query  303  ADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFI  482
            AD VN +L+ E+IDTIMHFAAQTHVDNSFGNSFEFTKNN+YGT VLLEACKVTGQI+RFI
Sbjct  61   ADFVNSILLNESIDTIMHFAAQTHVDNSFGNSFEFTKNNVYGTQVLLEACKVTGQIKRFI  120

Query  483  HVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNN  662
            HVSTDEVYGETDE+AVVGNHEASQLLPT PYSATKAG+EMLVMAYGRSYGLPVITTRGNN
Sbjct  121  HVSTDEVYGETDENAVVGNHEASQLLPTKPYSATKAGSEMLVMAYGRSYGLPVITTRGNN  180

Query  663  VY  668
            VY
Sbjct  181  VY  182



>gb|EYU29575.1| hypothetical protein MIMGU_mgv1a008395mg [Erythranthe guttata]
Length=375

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M  Y PKNILITG AGFIASHV+N L R+Y  Y IVVLDKLDYCSNLKNL  SRS PNFK
Sbjct  1    MEKYKPKNILITGGAGFIASHVSNWLTRNYSQYIIVVLDKLDYCSNLKNLDSSRSFPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADLVNY+L+TE+IDT+MHFAAQTHVDNSFGNSFEF KNN+YGT VLLEACK 
Sbjct  61   FVKGDICSADLVNYILVTESIDTVMHFAAQTHVDNSFGNSFEFIKNNVYGTCVLLEACKA  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            + +I+RF+HVSTDEVYGETDE+A VGNHEASQLLPTNPYSA+KAGAEMLVMAYGRSYGLP
Sbjct  121  SNRIKRFVHVSTDEVYGETDENAAVGNHEASQLLPTNPYSASKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VI TRGNNVY
Sbjct  181  VIITRGNNVY  190



>ref|XP_011082935.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Sesamum indicum]
Length=384

 Score =   332 bits (850),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M  Y P+NILITGAAGFIASHVAN L R+Y +Y+I+VLDKLDYCSNLKNL PS+S  NFK
Sbjct  1    MDKYKPRNILITGAAGFIASHVANWLTRNYSEYRIIVLDKLDYCSNLKNLDPSQSHHNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGD+ SADLVNY+L TE+IDT+MHFAAQTHVDNSFGNSFEF KNN+YGT VLLEACK 
Sbjct  61   FVKGDVCSADLVNYILATEDIDTVMHFAAQTHVDNSFGNSFEFIKNNVYGTCVLLEACKS  120

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
             G I+RFIHVSTDEVYGETDE+A VGNHEASQLLPTNPY+A+KAGAEMLVMAYGRSYGLP
Sbjct  121  FGHIKRFIHVSTDEVYGETDENATVGNHEASQLLPTNPYAASKAGAEMLVMAYGRSYGLP  180

Query  639  VITTRGNNVY  668
            VI TRGNNVY
Sbjct  181  VIITRGNNVY  190



>gb|AFW66842.1| hypothetical protein ZEAMMB73_620875 [Zea mays]
Length=407

 Score =   328 bits (841),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSP--NFKF  281
            Y PK ILITGAAGFIASHVA R+V  YP+YK+VVLDKLDYCSNLKNL P   S   NFKF
Sbjct  7    YKPKRILITGAAGFIASHVAIRIVNRYPEYKVVVLDKLDYCSNLKNLLPVMGSGGNNFKF  66

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            VKGDI SADLV+++L TE IDT+MHFAAQTHVDNSFGNS EFTKNNIYGTHVLLE+C+  
Sbjct  67   VKGDIASADLVSFILATEGIDTVMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLESCRTA  126

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
             QIRRFIHVSTDEVYGETD DAVVGNHEASQLLPTNPY+ATKAGAEMLVMAYGRSYGLPV
Sbjct  127  AQIRRFIHVSTDEVYGETDGDAVVGNHEASQLLPTNPYAATKAGAEMLVMAYGRSYGLPV  186

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  187  ITTRGNNVY  195



>ref|XP_006450198.1| hypothetical protein CICLE_v10010306mg [Citrus clementina]
 gb|ESR63438.1| hypothetical protein CICLE_v10010306mg [Citrus clementina]
Length=661

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            A+Y PK ILITGAAGFI SHV NRL+++YPDY+IV LDKLDYCS+LKNL PSR+SPNFKF
Sbjct  8    ASYKPKKILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKF  67

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            +KGDI  ADL+NYLL++E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T
Sbjct  68   LKGDITCADLMNYLLVSEGIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKLT  127

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            GQ++RFIHVSTDEVYGETD ++ +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP 
Sbjct  128  GQVKRFIHVSTDEVYGETDMESDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPT  187

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  188  ITTRGNNVY  196



>ref|XP_006483733.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=681

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            A+Y PK ILITGAAGFI SHV NRL+++YPDY+IV LDKLDYCS+LKNL PSR+SPNFKF
Sbjct  28   ASYKPKKILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKF  87

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            +KGDI  ADL+NYLL++E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T
Sbjct  88   LKGDITCADLMNYLLVSEGIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKLT  147

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            GQ++RFIHVSTDEVYGETD ++ +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP 
Sbjct  148  GQVKRFIHVSTDEVYGETDMESDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPT  207

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  208  ITTRGNNVY  216



>gb|KDO67325.1| hypothetical protein CISIN_1g035631mg [Citrus sinensis]
Length=684

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            A+Y PK ILITGAAGFI SHV NRL+++YPDY+IV LDKLDYCS+LKNL PSR+SPNFKF
Sbjct  8    ASYKPKKILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKF  67

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            +KGDI  ADL+NYLL++E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T
Sbjct  68   LKGDITCADLMNYLLVSEGIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKLT  127

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            GQ++RFIHVSTDEVYGETD ++ +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP 
Sbjct  128  GQVKRFIHVSTDEVYGETDMESDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPT  187

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  188  ITTRGNNVY  196



>emb|CAN62061.1| hypothetical protein VITISV_001928 [Vitis vinifera]
Length=619

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            A Y P+NILITGAAGFIASHV NRLV+++PDY+IV LDKLDYCSN+KNL PSRSS NFKF
Sbjct  6    APYVPRNILITGAAGFIASHVTNRLVKNHPDYRIVALDKLDYCSNVKNLGPSRSSSNFKF  65

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            VKGDI  ADLVN+LL+ E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT
Sbjct  66   VKGDIVCADLVNHLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVT  125

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
             +I+RFIHVSTDEVYGETD D  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP 
Sbjct  126  KRIKRFIHVSTDEVYGETDLDTDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPT  185

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  186  ITTRGNNVY  194



>ref|XP_010268536.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Nelumbo nucifera]
Length=665

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            TYTPKNIL+TGAAGFIASHV NRL+++YP+Y IV LDKLDYCS++KNL PS+SSPNFKFV
Sbjct  8    TYTPKNILLTGAAGFIASHVTNRLIKNYPNYNIVALDKLDYCSSIKNLLPSQSSPNFKFV  67

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  464
            KGDI S+DLVN+LL+ E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT 
Sbjct  68   KGDIMSSDLVNHLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTR  127

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            QI+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP I
Sbjct  128  QIKRFIHVSTDEVYGETDAETDIGNCEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPTI  187

Query  645  TTRGNNVY  668
            TTRGNNVY
Sbjct  188  TTRGNNVY  195



>emb|CDX98494.1| BnaC05g38810D [Brassica napus]
Length=646

 Score =   333 bits (855),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 167/190 (88%), Gaps = 19/190 (10%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  102  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  161

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  162  VITTRGNNVY  171



>emb|CDX97601.1| BnaA05g24780D [Brassica napus]
Length=646

 Score =   333 bits (854),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 167/190 (88%), Gaps = 19/190 (10%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SADL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  102  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  161

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  162  VITTRGNNVY  171



>ref|XP_008445073.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Cucumis melo]
Length=667

 Score =   333 bits (855),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHV NRL+++YP YKIV LDKLDYCSN+KNL PS++SPNF+F+K
Sbjct  8    YAPKNILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFIK  67

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADL+NYLL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  68   GDIVSADLINYLLVAEEIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTQR  127

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP IT
Sbjct  128  IKRFIHVSTDEVYGETDLETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPTIT  187

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  188  TRGNNVY  194



>ref|XP_004138882.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN62859.1| hypothetical protein Csa_2G377950 [Cucumis sativus]
Length=668

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHV NRL+++YP YKIV LDKLDYCSN+KNL PS++SPNF+F+K
Sbjct  9    YAPKNILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFIK  68

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADL+NYLL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  69   GDIVSADLINYLLVAEEIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTQR  128

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP IT
Sbjct  129  IKRFIHVSTDEVYGETDLETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPTIT  188

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  189  TRGNNVY  195



>ref|XP_002271970.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
 ref|XP_010648843.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=657

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            A Y P+NILITGAAGFIASHV NRLV+++PDY+IV LDKLDYCSN+KNL PSRSS NFKF
Sbjct  6    APYVPRNILITGAAGFIASHVTNRLVKNHPDYRIVALDKLDYCSNVKNLGPSRSSSNFKF  65

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            VKGDI  ADLVN+LL+ E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT
Sbjct  66   VKGDIVCADLVNHLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVT  125

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
             +I+RFIHVSTDEVYGETD D  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP 
Sbjct  126  KRIKRFIHVSTDEVYGETDLDTDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPT  185

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  186  ITTRGNNVY  194



>ref|XP_006382137.1| hypothetical protein POPTR_0006s28750g [Populus trichocarpa]
 gb|ERP59934.1| hypothetical protein POPTR_0006s28750g [Populus trichocarpa]
Length=660

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = +3

Query  87   ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  266
            +S   A Y P+ ILITGAAGFIASHV  RL++ YPDYKIV LDKLDYCSNLKNL   R S
Sbjct  1    MSSDPAPYAPRKILITGAAGFIASHVIRRLIKDYPDYKIVALDKLDYCSNLKNLATCRGS  60

Query  267  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  446
            PNFKFVKGDI  ADLVN+LLI E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKGDIACADLVNHLLIAEDIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLE  120

Query  447  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRS  626
            ACKVT +I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RS
Sbjct  121  ACKVTKKIKRFIHVSTDEVYGETDMETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRS  180

Query  627  YGLPVITTRGNNVY  668
            YGLP+ITTRGNNVY
Sbjct  181  YGLPIITTRGNNVY  194



>ref|XP_011031381.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=660

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  87   ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  266
            +S   A Y P+ ILITGAAGFIASHV  RL++ YPDYKIV LDKLDYCSNLKNL   R S
Sbjct  1    MSSDPAPYAPRKILITGAAGFIASHVTRRLIKDYPDYKIVALDKLDYCSNLKNLAKCRGS  60

Query  267  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  446
            PNFKFVKGDI  ADLVN+LLI E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKGDIACADLVNHLLIAEDIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLE  120

Query  447  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRS  626
            ACKVT +I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY  S
Sbjct  121  ACKVTKKIKRFIHVSTDEVYGETDMETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHTS  180

Query  627  YGLPVITTRGNNVY  668
            YGLP+ITTRGNNVY
Sbjct  181  YGLPIITTRGNNVY  194



>ref|XP_007225132.1| hypothetical protein PRUPE_ppa002547mg [Prunus persica]
 gb|EMJ26331.1| hypothetical protein PRUPE_ppa002547mg [Prunus persica]
Length=660

 Score =   329 bits (843),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFI SHV NRL+++YP YKIV LDKLDYCS+ KNL PSR+SPNFKFVK
Sbjct  8    YAPKNILITGAAGFIGSHVTNRLIKNYPSYKIVALDKLDYCSSFKNLRPSRASPNFKFVK  67

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI  ADLVN+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT Q
Sbjct  68   GDIACADLVNHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVTQQ  127

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP IT
Sbjct  128  IKRFIHVSTDEVYGETDMETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPTIT  187

Query  648  TRGNNVY  668
            TR NNVY
Sbjct  188  TRSNNVY  194



>ref|XP_007011619.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY29238.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=659

 Score =   329 bits (843),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = +3

Query  87   ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  266
            +S + A Y PK ILITGAAGFIASHV +RL+ +YP+YKIV LDKLDYCS+LKNL P  SS
Sbjct  1    MSSEPAPYAPKKILITGAAGFIASHVTSRLINNYPEYKIVALDKLDYCSSLKNLQPCFSS  60

Query  267  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  446
            PNFKFVKGDI   DL+NYLL+ E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKGDIICTDLLNYLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLE  120

Query  447  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRS  626
            ACKV+ QI+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RS
Sbjct  121  ACKVSKQIKRFIHVSTDEVYGETDMETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRS  180

Query  627  YGLPVITTRGNNVY  668
            YGLP+ITTRGNNVY
Sbjct  181  YGLPIITTRGNNVY  194



>emb|CDY32340.1| BnaC01g36590D [Brassica napus]
Length=643

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 165/190 (87%), Gaps = 19/190 (10%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPHYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI S DL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASDDL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct  102  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  161

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  162  VITTRGNNVY  171



>emb|CDY20084.1| BnaA01g29180D [Brassica napus]
Length=644

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 166/191 (87%), Gaps = 20/191 (10%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATY PKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI S DL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASDDL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  459  TGQ-IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
            TGQ IRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct  102  TGQQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  161

Query  636  PVITTRGNNVY  668
            PVITTRGNNVY
Sbjct  162  PVITTRGNNVY  172



>ref|XP_009803668.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=653

 Score =   326 bits (835),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            A Y PKNILITGAAGFI SHV NRL + YPDY+IV LDKLDYCS+LKNL PS SSPNFKF
Sbjct  5    APYVPKNILITGAAGFIPSHVTNRLTKLYPDYRIVALDKLDYCSSLKNLEPSYSSPNFKF  64

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            VK DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T
Sbjct  65   VKADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLEACKLT  124

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
              I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP 
Sbjct  125  KSIKRFIHVSTDEVYGETDLETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPT  184

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  185  ITTRGNNVY  193



>ref|XP_008220004.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=660

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFI SHV N+L+++YP Y IV LDKLDYCS+ KNL PSR+SPNFKFVK
Sbjct  8    YAPKNILITGAAGFIGSHVTNQLIKNYPSYNIVALDKLDYCSSFKNLRPSRASPNFKFVK  67

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI  ADLVN+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT Q
Sbjct  68   GDIACADLVNHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVTQQ  127

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP IT
Sbjct  128  IKRFIHVSTDEVYGETDMETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPTIT  187

Query  648  TRGNNVY  668
            TR NNVY
Sbjct  188  TRSNNVY  194



>ref|XP_009586858.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586859.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586860.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=653

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFI SHV NRL + YPDY+IV LDKLDYCS+LKNL PS SSPNFKFVK
Sbjct  7    YVPKNILITGAAGFIPSHVTNRLTKLYPDYRIVALDKLDYCSSLKNLEPSYSSPNFKFVK  66

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
             DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T  
Sbjct  67   ADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLEACKLTKS  126

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP IT
Sbjct  127  IKRFIHVSTDEVYGETDLETDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPTIT  186

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  187  TRGNNVY  193



>ref|XP_009363628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
 ref|XP_009367987.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=660

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFI SHV NRL+++YP YKIV LDK+DYCS+ KNL P RSSPNFKFVK
Sbjct  8    YAPKNILITGAAGFIGSHVTNRLIKNYPSYKIVALDKIDYCSSFKNLRPCRSSPNFKFVK  67

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI  ADL+N+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT +
Sbjct  68   GDIACADLINHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVTQR  127

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP IT
Sbjct  128  VKRFIHVSTDEVYGETDMETNIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPTIT  187

Query  648  TRGNNVY  668
            TR NNVY
Sbjct  188  TRSNNVY  194



>ref|XP_006355193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=654

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  87   ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  266
            +S + A Y PKN+LITGAAGFI SHV NRL + YP+Y+IV LDKLDYCS+LKNL PS S 
Sbjct  1    MSSEPAPYVPKNVLITGAAGFIPSHVTNRLTKLYPNYRIVALDKLDYCSSLKNLEPSYSC  60

Query  267  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  446
            PNFKFVK DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLE  120

Query  447  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRS  626
            ACK+T  I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RS
Sbjct  121  ACKLTKSIKRFIHVSTDEVYGETDLETDIGNPEASQLLPTNPYSATKAGAEMLVMAYNRS  180

Query  627  YGLPVITTRGNNVY  668
            YGLP ITTRGNNVY
Sbjct  181  YGLPTITTRGNNVY  194



>ref|XP_010325193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=651

 Score =   323 bits (828),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +3

Query  87   ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  266
            +S + A Y PKN+LITGAAGFI SHV NRL + YP+Y+IV LDKLDYCS+LKNL PS S 
Sbjct  1    MSSEPAPYVPKNVLITGAAGFIPSHVTNRLTKLYPNYRIVALDKLDYCSSLKNLEPSYSC  60

Query  267  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  446
            PNFKFVK DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLE  120

Query  447  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRS  626
            ACK+T  I+RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RS
Sbjct  121  ACKLTKCIKRFIHVSTDEVYGETDLETDIGNPEASQLLPTNPYSATKAGAEMLVMAYNRS  180

Query  627  YGLPVITTRGNNVY  668
            YGLP ITTRGNNVY
Sbjct  181  YGLPTITTRGNNVY  194



>ref|XP_008393937.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=660

 Score =   323 bits (827),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PK+ILITGAAGFI SHV NRL+++YP YKIV LDK+DYCS+ KNL P RSSPNFKFVK
Sbjct  8    YAPKSILITGAAGFIGSHVTNRLIKNYPSYKIVALDKIDYCSSFKNLRPCRSSPNFKFVK  67

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI  ADL+N+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT +
Sbjct  68   GDIACADLINHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVTQR  127

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFIHVSTDEVYGETD +  +GN EASQLLPTNPYSATKAGAEMLVMAY RSYGLP IT
Sbjct  128  VKRFIHVSTDEVYGETDMETNIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPTIT  187

Query  648  TRGNNVY  668
            TR NNVY
Sbjct  188  TRSNNVY  194



>ref|XP_003545554.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
 gb|KHN14574.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=655

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHV  RL+ SYP YKIV LDK+DYCS  KNL    SSPNFKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRLIDSYPSYKIVALDKVDYCSTFKNLQSCASSPNFKFIK  61

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI +AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHILIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTNC  121

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFIHVSTDEVYGETD +A +GNHEASQLLPTNPYSATKAGAEMLVMAY RSYGLP+IT
Sbjct  122  VKRFIHVSTDEVYGETDLEADIGNHEASQLLPTNPYSATKAGAEMLVMAYHRSYGLPIIT  181

Query  648  TRGNNVY  668
            +RGNNVY
Sbjct  182  SRGNNVY  188



>ref|XP_004498563.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498564.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=655

 Score =   312 bits (800),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHV  RL+  YP YKIV LDKLDYCS  KNL P  SS  FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTKRLINKYPSYKIVALDKLDYCSTFKNLEPCTSSQKFKFIK  61

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SAD+VN+LLI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+ T  
Sbjct  62   GDIASADIVNHLLIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRATNC  121

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFIHVSTDEVYGETD D  +GN E SQLLPTNPYSATKAGAEMLVMAY RSYGLP+IT
Sbjct  122  VKRFIHVSTDEVYGETDLDTDIGNIETSQLLPTNPYSATKAGAEMLVMAYHRSYGLPIIT  181

Query  648  TRGNNVY  668
            +RGNNVY
Sbjct  182  SRGNNVY  188



>ref|XP_007161328.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
 gb|ESW33322.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
Length=655

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHV  +L+  YP YKIV LDKLDYCS  +NL    SSPNFKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTKLINKYPSYKIVALDKLDYCSTFRNLKSCISSPNFKFIK  61

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI +AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHVLIEEKIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTDC  121

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFIHVSTDEVYGETD +  +GNHEAS+LLPTNPYSATKAGAEMLVMAY RSYGLPVIT
Sbjct  122  VKRFIHVSTDEVYGETDLEDDIGNHEASRLLPTNPYSATKAGAEMLVMAYHRSYGLPVIT  181

Query  648  TRGNNVY  668
            +RGNNVY
Sbjct  182  SRGNNVY  188



>ref|XP_003588651.1| Rhamnose synthase [Medicago truncatula]
 gb|AES58902.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=655

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHV  R++  YP YKIV LDKLDYCS  KNL    SSP FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRIINKYPSYKIVALDKLDYCSTFKNLQSCTSSPKFKFIK  61

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S D+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+ T  
Sbjct  62   GDIASVDIVNHVLIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRATNC  121

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFIHVSTDEVYGETD DA +GNHE SQLLPTNPYSATKAGAEMLVMAY RSY LP+IT
Sbjct  122  VKRFIHVSTDEVYGETDLDANIGNHETSQLLPTNPYSATKAGAEMLVMAYHRSYDLPIIT  181

Query  648  TRGNNVY  668
            +RGNNVY
Sbjct  182  SRGNNVY  188



>ref|XP_004292875.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Fragaria vesca subsp. vesca]
 ref|XP_011459027.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Fragaria vesca subsp. vesca]
Length=660

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFI SHV +RL+++YP+Y IV LDKLDYCS+ KNL   ++S NFKF+K
Sbjct  8    YAPKNILITGAAGFIGSHVTSRLIKNYPNYNIVALDKLDYCSSFKNLHACKASHNFKFIK  67

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI  ADLVN+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT +
Sbjct  68   GDIACADLVNHLLMVEEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVTKR  127

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            I+RFIHVSTDEVYGETD  + +GN EASQLLPTNPYSATKAGAEMLVMAY RSY LP IT
Sbjct  128  IKRFIHVSTDEVYGETDMGSDIGNPEASQLLPTNPYSATKAGAEMLVMAYHRSYDLPTIT  187

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  188  TRGNNVY  194



>ref|XP_003566438.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brachypodium 
distachyon]
Length=370

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 163/191 (85%), Gaps = 6/191 (3%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            A Y PKNILITGAAGFIASHVANRLVR YP Y+I+ LDKLDYC++L NL P+ +SPNF+F
Sbjct  16   AEYVPKNILITGAAGFIASHVANRLVRDYPWYRILALDKLDYCASLNNLAPALASPNFRF  75

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            V+ D+ SADLV +LL  E IDT+MHFAAQTHVD    NSFEFTKNN+ GTHVLLEAC+  
Sbjct  76   VRADVASADLVLHLLNGERIDTVMHFAAQTHVD----NSFEFTKNNVLGTHVLLEACRRA  131

Query  462  --GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL  635
              G +RRF+HVSTDEVYGETD+DA VGNHEASQLLP+NPYSA+KA AEMLVMAY RS+GL
Sbjct  132  GPGAVRRFVHVSTDEVYGETDKDAAVGNHEASQLLPSNPYSASKAAAEMLVMAYARSHGL  191

Query  636  PVITTRGNNVY  668
            P ITTRGNNVY
Sbjct  192  PAITTRGNNVY  202



>gb|KHN30780.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=655

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHV  RL+  YP YKIV LDKLDYCS  KNL    SS  FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRLIDRYPSYKIVALDKLDYCSTFKNLLSCSSSSKFKFIK  61

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI +AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHILIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTNC  121

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFIHVSTDEVYGETD DA +GNHEASQLLPTNPYSATKAGAEMLVMAY RSY LP+IT
Sbjct  122  VKRFIHVSTDEVYGETDLDADIGNHEASQLLPTNPYSATKAGAEMLVMAYHRSYDLPIIT  181

Query  648  TRGNNVY  668
            +RGNNVY
Sbjct  182  SRGNNVY  188



>ref|XP_003569141.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brachypodium 
distachyon]
Length=361

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  284
            +Y PKNILITGAAGFI SHVANRLVRSYP Y ++VLDK+DYCS+LKNL PSR SPNFKFV
Sbjct  4    SYEPKNILITGAAGFIGSHVANRLVRSYPHYNVLVLDKMDYCSSLKNLDPSRGSPNFKFV  63

Query  285  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGN-SFEFTKNNIYGTHVLLEACKVT  461
            +GDI S  LV  LL+  +IDT+MHFAAQTHVD+SFG+ S EFTKNN++ THVLLEACK  
Sbjct  64   EGDIASPGLVRRLLVDNSIDTVMHFAAQTHVDSSFGDGSLEFTKNNVHCTHVLLEACKQV  123

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
             +I+RFIHVSTDEVYGE++ DAV G  E S+LLPTNPYSA+KAGAEMLVMAYG SYGLPV
Sbjct  124  -KIKRFIHVSTDEVYGESEADAVAGKREDSRLLPTNPYSASKAGAEMLVMAYGASYGLPV  182

Query  642  ITTRGNNVY  668
            ITTRGNNVY
Sbjct  183  ITTRGNNVY  191



>ref|XP_003551160.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
Length=655

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITGAAGFIASHV  RL+  YP YKIV LDKLDYCS  KNL    SS  FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRLIDRYPSYKIVALDKLDYCSTFKNLLSCSSSSKFKFIK  61

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI +AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHILIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTNC  121

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFIHVSTDEVYGETD DA +GNHEASQLLPTNPYSATKAGAEMLVMAY RSY LP+IT
Sbjct  122  VKRFIHVSTDEVYGETDLDADIGNHEASQLLPTNPYSATKAGAEMLVMAYHRSYDLPIIT  181

Query  648  TRGNNVY  668
            +RGNNVY
Sbjct  182  SRGNNVY  188



>gb|EPS62084.1| hypothetical protein M569_12709, partial [Genlisea aurea]
Length=617

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/144 (98%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +3

Query  237  LKNLTPSRSSPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKN  416
            LKNL PS++SPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKN
Sbjct  1    LKNLIPSKASPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKN  60

Query  417  NIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGA  596
            NIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGA
Sbjct  61   NIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGA  120

Query  597  EMLVMAYGRSYGLPVITTRGNNVY  668
            EMLVMAYGRSYGLPVITTRGNNVY
Sbjct  121  EMLVMAYGRSYGLPVITTRGNNVY  144



>ref|XP_010531915.1| PREDICTED: LOW QUALITY PROTEIN: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=487

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 154/183 (84%), Gaps = 8/183 (4%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            M  YTPK ILI GAAGFIASHVANRL+R     K VVL+KLD C NL    PS+SS NFK
Sbjct  1    MVFYTPKTILIIGAAGFIASHVANRLIRIT---KTVVLEKLDSCLNL---NPSKSSSNFK  54

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHV--DNSFGNSFEFTKNNIYGTHVLLEAC  452
            FVKGDI SADLVNYLLITE IDTIMHFAAQTH   DNSFGNSF+ TK+NIYGTHVLLEAC
Sbjct  55   FVKGDIASADLVNYLLITEGIDTIMHFAAQTHATGDNSFGNSFQLTKDNIYGTHVLLEAC  114

Query  453  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYG  632
            K+T +IRR IHVSTDEVYG+TDEDA+VGNHEASQLLPTNPY+ATKA A MLVMAY RSY 
Sbjct  115  KMTDRIRRSIHVSTDEVYGQTDEDAIVGNHEASQLLPTNPYTATKAAAXMLVMAYDRSYS  174

Query  633  LPV  641
            LPV
Sbjct  175  LPV  177



>gb|KJB27003.1| hypothetical protein B456_004G271200 [Gossypium raimondii]
Length=571

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 148/190 (78%), Gaps = 31/190 (16%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            MATYTPKNILIT  A FIASHVANRL+R+Y  YKIV                     NFK
Sbjct  1    MATYTPKNILITRVARFIASHVANRLIRNYLSYKIV---------------------NFK  39

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
            FVKGDI SA LVNYLL+ E+IDTIMHFAAQTH          FTKNNIYGTHVLLEACKV
Sbjct  40   FVKGDISSAGLVNYLLVAESIDTIMHFAAQTH----------FTKNNIYGTHVLLEACKV  89

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            TGQIRRFIHVS DEVYG+TDEDA+VGNHEA QLLPTNPYSATKAGAEMLVMAY RSYGLP
Sbjct  90   TGQIRRFIHVSIDEVYGDTDEDAIVGNHEAFQLLPTNPYSATKAGAEMLVMAYNRSYGLP  149

Query  639  VITTRGNNVY  668
            VITTRGNNVY
Sbjct  150  VITTRGNNVY  159



>ref|XP_001701714.1| NAD-dependent epimerase/dehydratase [Chlamydomonas reinhardtii]
 gb|EDP06689.1| NAD-dependent epimerase/dehydratase [Chlamydomonas reinhardtii]
Length=328

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITG AGFIASHV  R+ ++YP YK+VVLDKLDYC++LKNL    + PNF+F+K
Sbjct  15   YEPKNILITGGAGFIASHVVIRITKNYPQYKVVVLDKLDYCASLKNLGSVANLPNFRFIK  74

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL++Y+L TE IDT+MHFAAQTHVDNSFGNS  FT NN YGTHVLLEA ++ G+
Sbjct  75   GDIQSMDLISYILKTEEIDTVMHFAAQTHVDNSFGNSLAFTLNNTYGTHVLLEAARMHGR  134

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            IRRFI+VSTDEVYGET      G  E+S L PTNPYSA KAGAE++  AY  SY LPVI 
Sbjct  135  IRRFINVSTDEVYGETSLGKTTGLVESSHLDPTNPYSAAKAGAELIARAYITSYKLPVII  194

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  195  TRGNNVY  201



>ref|XP_007508076.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20795.1| predicted protein [Bathycoccus prasinos]
Length=667

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 152/188 (81%), Gaps = 1/188 (1%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNILITG AGFIASH A  L + YP  KIVVLDKLDYC+N+K+L+      NFKF+ 
Sbjct  3    YEPKNILITGGAGFIASHAAILLAKKYPHCKIVVLDKLDYCANVKHLSELSHLLNFKFIM  62

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLV+Y+L  ENIDTIMHFAAQTHVDNSFGNSF FTKNNI GTHVLLE+CK+ G 
Sbjct  63   GDIQSADLVSYILRNENIDTIMHFAAQTHVDNSFGNSFAFTKNNILGTHVLLESCKMLGT  122

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL-PTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            I+RF+HVSTDEVYGE+  +    N E + LL PTNPYSATKAGAEMLVMAYGRSY LP +
Sbjct  123  IKRFLHVSTDEVYGESSYELNASNTEHASLLEPTNPYSATKAGAEMLVMAYGRSYDLPYL  182

Query  645  TTRGNNVY  668
             TRGNNVY
Sbjct  183  ITRGNNVY  190



>ref|XP_003057320.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58965.1| predicted protein [Micromonas pusilla CCMP1545]
Length=691

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 152/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y P+N+LITG AGFIASHVA R  + YP Y +VV+DKLDYC+NL NL    + PNFKFVK
Sbjct  23   YVPQNVLITGGAGFIASHVALRFAKRYPRYNVVVVDKLDYCANLNNLREIAALPNFKFVK  82

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG-  464
             D+GSADL+ Y++  E IDT+MHFAAQTHVDNSFGNSFEFT+NNI GTHVLLE  K  G 
Sbjct  83   ADVGSADLMTYVMREEQIDTVMHFAAQTHVDNSFGNSFEFTENNIRGTHVLLETVKSLGD  142

Query  465  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLL-PTNPYSATKAGAEMLVMAYGRSYGLPV  641
            QI+RF+HVSTDEVYGE+  +    N EA+ LL PTNPYSATKAGAEMLVMAYGRSY LP 
Sbjct  143  QIKRFLHVSTDEVYGESSYELDKANVEAASLLEPTNPYSATKAGAEMLVMAYGRSYNLPY  202

Query  642  ITTRGNNVY  668
            + TRGNNVY
Sbjct  203  LITRGNNVY  211



>ref|XP_002500589.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61847.1| predicted protein [Micromonas sp. RCC299]
Length=682

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y  KN+LITG AGFIASHVA    + YP YK+VV+DKLDYC+NL NL       NFKFVK
Sbjct  12   YEAKNVLITGGAGFIASHVAILFAKKYPQYKVVVVDKLDYCANLNNLRSIAGLLNFKFVK  71

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GD+GSADL+ Y++ +E IDT+MHFAAQTHVDNSFGNSFEFT+NNI GTHVLLE  K  G 
Sbjct  72   GDVGSADLMTYVMRSEEIDTVMHFAAQTHVDNSFGNSFEFTENNIRGTHVLLETVKTLGT  131

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL-PTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            I+RF+HVSTDEVYGE+  +    N EA+ LL PTNPYSATKAGAEMLVMAYGRSY LP I
Sbjct  132  IKRFLHVSTDEVYGESSYEKDEANVEAASLLEPTNPYSATKAGAEMLVMAYGRSYNLPYI  191

Query  645  TTRGNNVY  668
             TRGNNVY
Sbjct  192  ITRGNNVY  199



>ref|XP_002953659.1| hypothetical protein VOLCADRAFT_82358 [Volvox carteri f. nagariensis]
 gb|EFJ45283.1| hypothetical protein VOLCADRAFT_82358 [Volvox carteri f. nagariensis]
Length=366

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPKNILITG AGFIASHV  R+   YP+YK+VVLDKLDYC+++ NL+     PNF+ +K
Sbjct  14   YTPKNILITGGAGFIASHVVIRIATRYPEYKVVVLDKLDYCASVNNLSCLADKPNFRLIK  73

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL++Y+L TE IDT+MHFAAQTHVDNSFGNS  FT NN YGTHVLLEA ++ G 
Sbjct  74   GDIQSMDLISYILKTEEIDTVMHFAAQTHVDNSFGNSLAFTLNNTYGTHVLLEASRMAGT  133

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            IRRFI+VSTDEVYGET      G  E+S L PTNPYSA KAGAE++  AY  SY +PVI 
Sbjct  134  IRRFINVSTDEVYGETSLGKTTGLVESSHLDPTNPYSAAKAGAELIARAYITSYKMPVII  193

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  194  TRGNNVY  200



>ref|XP_007514013.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15450.1| predicted protein [Bathycoccus prasinos]
Length=667

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 151/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKN+LITG AGFIASHVA    + YP  K++VLDKLDYC+N+K+L+      NFKF+ 
Sbjct  3    YEPKNVLITGGAGFIASHVAILFAKKYPHCKVIVLDKLDYCANVKHLSELSHLLNFKFIM  62

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADLV+Y+L  ENIDTIMHFAAQTHVDNSFGNSF FT+NNI GTHVLLE+CK  G 
Sbjct  63   GDIQSADLVSYILRNENIDTIMHFAAQTHVDNSFGNSFAFTENNILGTHVLLESCKTLGT  122

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHE-ASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            I+RF+HVSTDEVYGE+  +    N E AS L PTNPYSATKAGAEMLVMAYGRSY LP +
Sbjct  123  IKRFLHVSTDEVYGESSYELNASNTEHASLLEPTNPYSATKAGAEMLVMAYGRSYDLPYL  182

Query  645  TTRGNNVY  668
             TRGNNVY
Sbjct  183  ITRGNNVY  190



>ref|XP_005644844.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20300.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=361

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            + PK IL+TG AGFI SHVA  L R YP YK++V DKLDYC   KNL     +PNFKF+K
Sbjct  8    FVPKVILVTGGAGFIGSHVAVCLTRKYPQYKVIVFDKLDYCGTQKNLASLMDAPNFKFIK  67

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GD+ S DL+NY+L  EN+DT++HFAAQTHVDNSFGNS  FT NN YGTHVLLEAC++ G 
Sbjct  68   GDLQSGDLLNYILRRENVDTVLHFAAQTHVDNSFGNSLAFTVNNTYGTHVLLEACRMFGG  127

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            IRRF++VSTDEVYGE+      G  E S L PTNPYSA KAGAEM+  AY  SY LPVIT
Sbjct  128  IRRFVNVSTDEVYGESSYGKDKGVGEDSTLEPTNPYSAAKAGAEMIAKAYLTSYKLPVIT  187

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  188  TRGNNVY  194



>ref|XP_001422283.1| putative NAD-dependent epimerase/dehydratase [Ostreococcus lucimarinus 
CCE9901]
 ref|XP_001422349.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00600.1| putative NAD-dependent epimerase/dehydratase [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00666.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  123  ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVKGDIGS  302
            IL+TG AGFI SHVA RL   +P+Y IV+LDKLDYCS+LKNL  ++   N +FVKGD+ S
Sbjct  3    ILLTGGAGFIGSHVAERLASRHPEYTIVILDKLDYCSSLKNLERAKECANVRFVKGDVRS  62

Query  303  ADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC--KVTGQIRR  476
             DL++Y+L +E IDT+MHFAAQ+HVDNSFGNS+EFTKNNI GTH LLEAC      +IRR
Sbjct  63   FDLLSYVLQSERIDTVMHFAAQSHVDNSFGNSYEFTKNNIEGTHALLEACVRAQKTEIRR  122

Query  477  FIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRG  656
            F+HVSTDEVYGE   D+      AS L PTNPY+ATKAGAEMLVMAYGRSYGLP I TRG
Sbjct  123  FLHVSTDEVYGENLMDS--NTEHASLLTPTNPYAATKAGAEMLVMAYGRSYGLPYIITRG  180

Query  657  NNVY  668
            NNVY
Sbjct  181  NNVY  184



>gb|AGE60164.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
WI0606]
Length=350

 Score =   257 bits (656),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            +RRFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  126  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  185

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  186  TRGNNVY  192



>gb|AGE49559.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Can0610SP]
Length=350

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            +RRFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  126  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  185

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  186  TRGNNVY  192



>ref|XP_005648752.1| NAD-dependent epimerase/dehydratase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24208.1| NAD-dependent epimerase/dehydratase [Coccomyxa subellipsoidea 
C-169]
Length=363

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PK+IL+TG AGFIASHV  RL   YP+ K+VVLDKLDYC+++ NL   +  PNFKFVK
Sbjct  25   YVPKSILLTGGAGFIASHVVIRLCSRYPNTKVVVLDKLDYCASMHNLDAVKDLPNFKFVK  84

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADL++++L  +NIDT+MHFAAQTHVDNSFGNS  FT NN +GTHVLLEA +V G 
Sbjct  85   GDIQSADLISFVLKEDNIDTVMHFAAQTHVDNSFGNSLAFTMNNTHGTHVLLEAARVYGG  144

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            IRRFI VSTDEVYGET      G  E S L PTNPYSA KAGAEM+V AY  SY LP I 
Sbjct  145  IRRFIAVSTDEVYGETSVGRDSGCTETSTLEPTNPYSAAKAGAEMMVKAYMTSYKLPCII  204

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  205  TRGNNVY  211



>ref|XP_001422288.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00605.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  123  ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVKGDIGS  302
            IL+TG AGFI SHVA RL   +P+Y IVVLDKLDYCS+LKNL  ++   N +FVKGD+ S
Sbjct  3    ILLTGGAGFIGSHVAERLASRHPEYTIVVLDKLDYCSSLKNLERAKECANVRFVKGDVRS  62

Query  303  ADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC--KVTGQIRR  476
             DL++Y+L +E IDT++HFAAQ+HVDNSFGNS+EFTKNNI GTH LLEAC    T +IRR
Sbjct  63   FDLLSYVLQSERIDTVVHFAAQSHVDNSFGNSYEFTKNNIEGTHALLEACVRAQTTEIRR  122

Query  477  FIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRG  656
            F+HVSTDEVYGE   D+      A+ L PTNPY+ATKAGAEMLVMAYGRSYGLP I TRG
Sbjct  123  FLHVSTDEVYGENLMDS--NTEHAALLTPTNPYAATKAGAEMLVMAYGRSYGLPYIITRG  180

Query  657  NNVY  668
            NNVY
Sbjct  181  NNVY  184



>gb|AGE50238.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Canal-1]
Length=359

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PK++LITG AGFIAS V  +LVR YP+ K+VVLDKLDYC+ L NL   R +PNFKF+K
Sbjct  15   YQPKSVLITGGAGFIASWVTIKLVRRYPECKVVVLDKLDYCATLNNLATIRDAPNFKFIK  74

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S+DL+ ++L  E +DTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  75   GDIQSSDLITHILQQEEVDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLHGG  134

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  135  VQRFINVSTDEVYGESSLGKTEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  194

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  195  TRGNNVY  201



>ref|YP_001427025.1| hypothetical protein ATCV1_Z544R [Acanthocystis turfacea Chlorella 
virus 1]
 gb|ABT16678.1| hypothetical protein ATCV1_Z544R [Acanthocystis turfacea Chlorella 
virus 1]
Length=350

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  126  VQRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  185

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  186  TRGNNVY  192



>gb|AGE57039.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NE-JV-3]
Length=350

 Score =   255 bits (651),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  126  VQRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  185

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  186  TRGNNVY  192



>gb|AGE59831.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
TN603.4.2]
Length=347

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPK++L+TG AGFI SHV  +LV  YP+ K+VV+DK+DYC+ L NL   R +PNFKFVK
Sbjct  3    YTPKSVLVTGGAGFIGSHVVMKLVHRYPECKVVVIDKMDYCATLNNLATVRDAPNFKFVK  62

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  63   GDIQSPDLLAHVLKQEEIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  122

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            +RRFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  123  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  182

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  183  TRGNNVY  189



>gb|AGE59487.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
OR0704.3]
Length=350

 Score =   254 bits (649),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTP ++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPTSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            +RRFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  126  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYRLPVIV  185

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  186  TRGNNVY  192



>gb|AGE55724.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
MN0810.1]
Length=353

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTP ++LITG AGFIAS V  +LV+ YP+ K+VVLDKLDYC+ L NL   R +PNFKFVK
Sbjct  7    YTPTSVLITGGAGFIASWVTIKLVKRYPECKVVVLDKLDYCATLNNLAAVRDAPNFKFVK  66

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI SADL+ ++L  ENIDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++   
Sbjct  67   GDIQSADLITHVLEQENIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYVG  126

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  127  VQRFINVSTDEVYGESSLGKAEGLDEHSSLEPTNPYAAAKAGAEMMARAYYTSYKLPVIV  186

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  187  TRGNNVY  193



>ref|XP_011401232.1| DEAD-box ATP-dependent RNA helicase 20 [Auxenochlorella protothecoides]
 gb|KFM28219.1| DEAD-box ATP-dependent RNA helicase 20 [Auxenochlorella protothecoides]
Length=746

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = +3

Query  87   ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  266
            +++ +  Y P++ILITG AGFIASHV  +LV+ YP  K+VVLDKLDYC+ L+NL   R  
Sbjct  390  VAMAVEEYVPRSILITGGAGFIASHVTIKLVKRYPHVKVVVLDKLDYCATLENLKSIRDC  449

Query  267  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  446
            PNFKFVKG+I S DL+ ++L TE IDT+MHFAAQTHVDNSFGNS  FT NN YGTHVLLE
Sbjct  450  PNFKFVKGEIQSTDLIVHILETEEIDTVMHFAAQTHVDNSFGNSLAFTMNNTYGTHVLLE  509

Query  447  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRS  626
            + ++ G+IRRF++VSTDEVYGET      G  EAS L PTNPYSA KAGAEM+  AY  S
Sbjct  510  SARLYGKIRRFLNVSTDEVYGETSLGKAEGLSEASALEPTNPYSAAKAGAEMMARAYHTS  569

Query  627  YGLPVITTRGNNVY  668
            Y LPVI TRGNNVY
Sbjct  570  YKLPVIVTRGNNVY  583



>gb|AGE53603.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
GM0701.1]
Length=347

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YT K++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  3    YTLKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  62

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  63   GDIQSPDLLAHVLKQEEIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  122

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            IRRFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  123  IRRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  182

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  183  TRGNNVY  189



>gb|KDD76685.1| NAD dependent epimerase/dehydratase [Helicosporidium sp. ATCC 
50920]
Length=376

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
             +Y P+NIL+TG AGFI SHV   L+R +P Y+++VLDKLDYC++L NL     +P+FKF
Sbjct  19   GSYIPRNILVTGGAGFIGSHVVRYLLRHHPTYRVIVLDKLDYCASLFNLEELEGNPSFKF  78

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            +KGDI S DL+ Y+L TENIDTI+HFAAQTHVDNSFGNS  FT NNI GTHVLLEA +  
Sbjct  79   IKGDILSGDLLIYILATENIDTILHFAAQTHVDNSFGNSLAFTMNNICGTHVLLEAARTY  138

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            G +RR I+VSTDEVYGET      G  E+S + PTNPY+A KAGAE++ +AY  SYGLP+
Sbjct  139  GLVRRLINVSTDEVYGETSVGLAQGLPESSPMAPTNPYAAAKAGAELMALAYHVSYGLPI  198

Query  642  ITTRGNNVY  668
            I TRGNNVY
Sbjct  199  IVTRGNNVY  207



>gb|AGE56041.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
MO0605SPH]
Length=350

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTP ++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPTSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  126  VQRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  185

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  186  TRGNNVY  192



>gb|KDD73904.1| NAD dependent epimerase/dehydratase [Helicosporidium sp. ATCC 
50920]
Length=365

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 145/197 (74%), Gaps = 10/197 (5%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PK+IL+TG AGFIASHV  +LV+ YP  KIVVLDKLDYC+ L NLT  +   NFKFVK
Sbjct  6    YNPKSILVTGGAGFIASHVTIKLVQQYPGCKIVVLDKLDYCATLNNLTSVKDCSNFKFVK  65

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNI----------YGTHV  437
            GDI SADL+ ++L  E IDT+MHFAAQTHVDNSFGNS  FT NN           YGTHV
Sbjct  66   GDIQSADLLVHILEQEEIDTVMHFAAQTHVDNSFGNSLAFTMNNTYVVGHVERVEYGTHV  125

Query  438  LLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAY  617
            LLE+C++ G+IRRF++VSTDEVYGE+      G  E S L PTNPYSA KAGAEM+  AY
Sbjct  126  LLESCRLYGRIRRFVNVSTDEVYGESSLGKEEGLQETSPLEPTNPYSAAKAGAEMMARAY  185

Query  618  GRSYGLPVITTRGNNVY  668
              SY LPVI TRGNNVY
Sbjct  186  HTSYRLPVIVTRGNNVY  202



>gb|AGE57735.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NTS-1]
Length=350

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAA THVDNSFGNS  FT NN YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAATTHVDNSFGNSLAFTMNNTYGTHVLLECARLYGG  125

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  126  VQRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  185

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  186  TRGNNVY  192



>gb|AGE56705.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NE-JV-2]
Length=347

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  3    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  62

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAA THVDNSFGNS  FT NN YGTHVLLE  ++ G 
Sbjct  63   GDIQSPDLLAHVLKQEEIDTIMHFAATTHVDNSFGNSLAFTMNNTYGTHVLLECARLYGG  122

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            +RRFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  123  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  182

Query  648  TRGNNVY  668
             RGNNVY
Sbjct  183  MRGNNVY  189



>gb|AGE49233.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Br0604L]
Length=350

 Score =   249 bits (636),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTP ++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPTSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ ++L  E IDTIMHFAA THVDNSFGNS  FT NN YGTHVLLE  ++ G 
Sbjct  66   GDIRSPDLLAHVLKQEEIDTIMHFAATTHVDNSFGNSLAFTMNNTYGTHVLLECARLYGG  125

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            +RRFI+VSTDEVYGE+      G  E S L PTNPY+A KAGAEM+  AY  SY LPVI 
Sbjct  126  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEPTNPYAAAKAGAEMMARAYHTSYKLPVIV  185

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  186  TRGNNVY  192



>emb|CBN76510.1| conserved unknown protein [Ectocarpus siliculosus]
Length=381

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = +3

Query  102  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  281
            A YTP+NILITG AGFIASH+   LV  YP Y IVV D+LDYC+ L+NL      PN+KF
Sbjct  19   AHYTPQNILITGGAGFIASHLVILLVEKYPQYNIVVFDRLDYCACLENLDCIAQKPNYKF  78

Query  282  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  461
            VKG+I S+D+V Y+L  E IDTI+HFAAQTHVDNSFGNSF+FT+NNIYGTHVLLE+ K  
Sbjct  79   VKGNICSSDMVTYVLREEKIDTILHFAAQTHVDNSFGNSFQFTQNNIYGTHVLLESAKKV  138

Query  462  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            G I+RF+HVSTDEVYGE + D      E + L PTNPY+ATKAGAE +  AY RS+ LPV
Sbjct  139  G-IKRFVHVSTDEVYGEGEHDQEP-MFEDNVLEPTNPYAATKAGAEFIAKAYFRSFNLPV  196

Query  642  ITTRGNNVY  668
            I TRGNNVY
Sbjct  197  IITRGNNVY  205



>ref|XP_005854661.1| dTDP-glucose 4,6-dehydratase [Nannochloropsis gaditana CCMP526]
 gb|EKU21695.1| dTDP-glucose 4,6-dehydratase [Nannochloropsis gaditana CCMP526]
Length=358

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 149/195 (76%), Gaps = 6/195 (3%)
 Frame = +3

Query  90   SVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSP  269
            S   A YTPKNIL+TG AGFIASHV   LV+ +P YKIV LD+LDYCS L+NL   +   
Sbjct  10   SAPEAEYTPKNILVTGGAGFIASHVVLLLVKKFPKYKIVNLDRLDYCSCLENLDEIKYYK  69

Query  270  NFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEA  449
            N+KFVKG+I S+DLVNY+L  E IDTIMHFAAQTHVDNSFGNSF FT+NNI GTHVLLE+
Sbjct  70   NYKFVKGNICSSDLVNYVLEEEEIDTIMHFAAQTHVDNSFGNSFSFTQNNILGTHVLLES  129

Query  450  CKVTGQIRRFIHVSTDEVYGE--TDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGR  623
             KV   I+RFIHVSTDEVYGE   D++ +    E   L PTNPY+ATKAGAE +  +Y R
Sbjct  130  AKVH-NIKRFIHVSTDEVYGEGAADQEPMF---EDQVLEPTNPYAATKAGAEFIAKSYSR  185

Query  624  SYGLPVITTRGNNVY  668
            S+ LP+I TRGNNVY
Sbjct  186  SFNLPLIITRGNNVY  200



>ref|XP_002181238.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47161.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=437

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTP+NIL+TG AGFIASHVA  L + YP YKIVV D LDYC+ L NL      PNFKFVK
Sbjct  78   YTPENILVTGGAGFIASHVAILLCKKYPQYKIVVYDCLDYCACLANLQELFDLPNFKFVK  137

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DLV+Y+L  E IDTI+HFAAQTHVDNSFGNSF FT+ NIYGTHVLLE+ K    
Sbjct  138  GDIASPDLVSYVLREEKIDTILHFAAQTHVDNSFGNSFAFTQTNIYGTHVLLESAKCCDT  197

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            +RRF+HVSTDEVYGE ++       E   L PTNPY+ATKAGAE LV +Y RS+ LP + 
Sbjct  198  LRRFVHVSTDEVYGEGEDFETDPMSEEHVLEPTNPYAATKAGAEFLVKSYFRSFQLPCLI  257

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  258  TRGNNVY  264



>gb|EWM28017.1| rhamnose biosynthetic enzyme expressed [Nannochloropsis gaditana]
Length=403

 Score =   249 bits (635),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 149/195 (76%), Gaps = 6/195 (3%)
 Frame = +3

Query  90   SVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSP  269
            S   A YTPKNIL+TG AGFIASHV   LV+ +P YKIV LD+LDYCS L+NL   +   
Sbjct  55   SAPEAEYTPKNILVTGGAGFIASHVVLLLVKKFPKYKIVNLDRLDYCSCLENLDEIKYYK  114

Query  270  NFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEA  449
            N+KFVKG+I S+DLVNY+L  E IDTIMHFAAQTHVDNSFGNSF FT+NNI GTHVLLE+
Sbjct  115  NYKFVKGNICSSDLVNYVLEEEEIDTIMHFAAQTHVDNSFGNSFSFTQNNILGTHVLLES  174

Query  450  CKVTGQIRRFIHVSTDEVYGE--TDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGR  623
             KV   I+RFIHVSTDEVYGE   D++ +    E   L PTNPY+ATKAGAE +  +Y R
Sbjct  175  AKVH-NIKRFIHVSTDEVYGEGAADQEPMF---EDQVLEPTNPYAATKAGAEFIAKSYSR  230

Query  624  SYGLPVITTRGNNVY  668
            S+ LP+I TRGNNVY
Sbjct  231  SFNLPLIITRGNNVY  245



>ref|XP_002291084.1| dtdp-glucose 4,6-dehydratase [Thalassiosira pseudonana CCMP1335]
 gb|EED91191.1| dtdp-glucose 4,6-dehydratase [Thalassiosira pseudonana CCMP1335]
Length=361

 Score =   247 bits (631),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 140/187 (75%), Gaps = 0/187 (0%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PKNIL+TG AGFI SHVA  L + YP Y IVV DKLDYCS L NL       NFKFVK
Sbjct  11   YIPKNILLTGGAGFIGSHVAILLAKKYPHYNIVVYDKLDYCSCLANLDEVSRLKNFKFVK  70

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DLV+Y+++ E+IDT+MHFAAQTHVDNSFGNSF FT++NIYGTHV+LEA K    
Sbjct  71   GDITSPDLVSYVMVEEDIDTVMHFAAQTHVDNSFGNSFNFTQSNIYGTHVMLEAAKCHRG  130

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT  647
            ++RFIHVSTDEVYGE +        E   L PTNPY+ATKAGAE LV +Y RS+ LP + 
Sbjct  131  MKRFIHVSTDEVYGEGETFETEAMKEEHVLEPTNPYAATKAGAEFLVKSYHRSFKLPCVI  190

Query  648  TRGNNVY  668
            TRGNNVY
Sbjct  191  TRGNNVY  197



>gb|EWM30544.1| dTDP-glucose 4,6-dehydratase [Nannochloropsis gaditana]
Length=423

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 144/190 (76%), Gaps = 8/190 (4%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTPKNIL+TG AGFI SHVA  L   YP YKIVVLDKLDYC++L+NL       NFKFVK
Sbjct  18   YTPKNILVTGGAGFIGSHVAILLAHRYPKYKIVVLDKLDYCASLENLADVTRRRNFKFVK  77

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            G+I S+DLVN++L  E IDTI+H AAQTHVDNSFGNSF FT+NNI GTHVLLE+ KV G 
Sbjct  78   GNICSSDLVNFVLEEEEIDTIVHLAAQTHVDNSFGNSFSFTQNNILGTHVLLESAKVHG-  136

Query  468  IRRFIHVSTDEVYGETDEDAVVGNH---EASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
            IRRF+HVSTDEVYGE       G     E + L PTNPY+ATKAGAE L  +Y RS+ LP
Sbjct  137  IRRFVHVSTDEVYGE----GAAGQEPMFEDNVLEPTNPYAATKAGAEFLAKSYHRSFNLP  192

Query  639  VITTRGNNVY  668
            VI TRGNNVY
Sbjct  193  VIITRGNNVY  202



>emb|CEG01892.1| NAD-dependent epimerase/dehydratase [Ostreococcus tauri]
Length=662

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = +3

Query  123  ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVKGDIGS  302
            IL+TG AGFIASHV   L   YP YKIVVLDKLDYC+++KNL  +R   N +F+KGDI S
Sbjct  5    ILLTGGAGFIASHVVRLLAEKYPKYKIVVLDKLDYCASMKNLESTRHLLNVEFIKGDIRS  64

Query  303  ADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFI  482
             DL+N++     ID ++HFAAQ+HVDNSFGNSFEFTKNN+ GTH LLEA K  G + RF+
Sbjct  65   VDLLNFIFQKNTIDVVLHFAAQSHVDNSFGNSFEFTKNNVEGTHALLEATKRAGTVTRFV  124

Query  483  HVSTDEVYGETDEDAVVGNHE-ASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGN  659
            HVSTDEVYGE+  +    N E AS L PTNPYSATKAGAEMLVMAYGRSYGLP I TRGN
Sbjct  125  HVSTDEVYGESSFEHDSSNTEHASLLAPTNPYSATKAGAEMLVMAYGRSYGLPFIITRGN  184

Query  660  NVY  668
            NVY
Sbjct  185  NVY  187



>ref|XP_003084264.1| UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase (ISS) [Ostreococcus 
tauri]
Length=689

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = +3

Query  123  ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVKGDIGS  302
            IL+TG AGFIASHV   L   YP YKIVVLDKLDYC+++KNL  +R   N +F+KGDI S
Sbjct  5    ILLTGGAGFIASHVVRLLAEKYPKYKIVVLDKLDYCASMKNLESTRHLLNVEFIKGDIRS  64

Query  303  ADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFI  482
             DL+N++     ID ++HFAAQ+HVDNSFGNSFEFTKNN+ GTH LLEA K  G + RF+
Sbjct  65   VDLLNFIFQKNTIDVVLHFAAQSHVDNSFGNSFEFTKNNVEGTHALLEATKRAGTVTRFV  124

Query  483  HVSTDEVYGETDEDAVVGNHE-ASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGN  659
            HVSTDEVYGE+  +    N E AS L PTNPYSATKAGAEMLVMAYGRSYGLP I TRGN
Sbjct  125  HVSTDEVYGESSFEHDSSNTEHASLLAPTNPYSATKAGAEMLVMAYGRSYGLPFIITRGN  184

Query  660  NVY  668
            NVY
Sbjct  185  NVY  187



>ref|XP_005850348.1| hypothetical protein CHLNCDRAFT_142172 [Chlorella variabilis]
 gb|EFN58246.1| hypothetical protein CHLNCDRAFT_142172 [Chlorella variabilis]
Length=377

 Score =   243 bits (620),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 142/199 (71%), Gaps = 12/199 (6%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKI------------VVLDKLDYCSNLKNLT  251
            Y PKNILITG AGFIAS V  +LV+  P+ K+            +VLDKLDYC+ L NL 
Sbjct  12   YQPKNILITGGAGFIASWVVIKLVKQRPECKVGSRVTLGVVGAVIVLDKLDYCATLNNLA  71

Query  252  PSRSSPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGT  431
              R  PNFKF+KGDI S+DLV ++L  E IDT+MHFAAQTHVDNSFGNS  FT NN YGT
Sbjct  72   AVRDLPNFKFIKGDIQSSDLVVHILEQEQIDTVMHFAAQTHVDNSFGNSMAFTMNNTYGT  131

Query  432  HVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVM  611
            HVLLE  ++ G+++RFI+VSTDEVYGE+      G  E S L PTNPYSA KAGAEM+  
Sbjct  132  HVLLECSRLYGKVQRFINVSTDEVYGESSLGKTEGLKEHSPLEPTNPYSAAKAGAEMMAR  191

Query  612  AYGRSYGLPVITTRGNNVY  668
            AY  SY LPVI TRGNNVY
Sbjct  192  AYHTSYKLPVIVTRGNNVY  210



>ref|XP_005845105.1| hypothetical protein CHLNCDRAFT_7301, partial [Chlorella variabilis]
 gb|EFN53003.1| hypothetical protein CHLNCDRAFT_7301 [Chlorella variabilis]
Length=327

 Score =   241 bits (614),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 141/181 (78%), Gaps = 2/181 (1%)
 Frame = +3

Query  129  ITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVKGDI-GSA  305
            +TG AGFI SHVA RL++ Y  YK+VVLDKLDYC+++ NL  ++  P FKFV+GDI G  
Sbjct  1    VTGGAGFIGSHVAIRLLKRY-SYKVVVLDKLDYCASMHNLREAQDHPRFKFVRGDITGGL  59

Query  306  DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIH  485
            DLV Y+L  E +DT++HFAAQTHVDNSFGNS  FT NN YGTHVLLEAC+V G++RRFI+
Sbjct  60   DLVQYVLREEGVDTVLHFAAQTHVDNSFGNSLAFTANNTYGTHVLLEACRVYGRVRRFIN  119

Query  486  VSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNV  665
            VSTDEVYG+T    + G  E+S L PTNPYSA KAGAE++ +AY  SY LPVI TR NNV
Sbjct  120  VSTDEVYGDTSHSLLAGLPESSSLAPTNPYSAAKAGAELMSLAYLTSYNLPVIVTRSNNV  179

Query  666  Y  668
            +
Sbjct  180  F  180



>ref|XP_011401987.1| putative rhamnose biosynthetic enzyme 3 [Auxenochlorella protothecoides]
 gb|KFM28938.1| putative rhamnose biosynthetic enzyme 3 [Auxenochlorella protothecoides]
Length=372

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 142/198 (72%), Gaps = 11/198 (6%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            YTP+NIL+TG AGFI SHV  RLV+ YP Y++VV D LDYC+ L NL   + +PNFKF+K
Sbjct  7    YTPRNILVTGGAGFIGSHVVVRLVQRYPQYRVVVFDCLDYCATLHNLQAVKDAPNFKFIK  66

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DL+ Y++ TE IDT+MHFAAQTHVD+SFGNS  FT NN+YGTHVLLEA +  GQ
Sbjct  67   GDIKSGDLLYYVMETEKIDTVMHFAAQTHVDHSFGNSVSFTINNMYGTHVLLEAARRYGQ  126

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPY-----------SATKAGAEMLVMA  614
            + RFI+VSTDEVYGET      G  E S+L PTNPY               AGAE++ +A
Sbjct  127  VHRFINVSTDEVYGETSFGLAAGLVEKSRLEPTNPYAAAKARRRGRRLLRHAGAEIMALA  186

Query  615  YGRSYGLPVITTRGNNVY  668
            Y  SY LPVI TRGNNVY
Sbjct  187  YYTSYQLPVIITRGNNVY  204



>ref|XP_004336227.1| dTDPD-glucose 4,6-dehydratase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14214.1| dTDPD-glucose 4,6-dehydratase [Acanthamoeba castellanii str. 
Neff]
Length=386

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 151/200 (76%), Gaps = 16/200 (8%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y+PKNILITG AGFI SHV + LV  YPDYKIV  DKLDYCS+LKN+   +S PN++FV+
Sbjct  5    YSPKNILITGGAGFIGSHVVSLLVNKYPDYKIVNYDKLDYCSSLKNIASLQSKPNYRFVE  64

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            G+I SA+LV+++L  E IDTI+HFAAQTHVDNSFGNSF+FT+ N+ GTHVLLEA K+ G 
Sbjct  65   GNILSAELVSFILEEEQIDTIVHFAAQTHVDNSFGNSFQFTETNVLGTHVLLEAAKLAG-  123

Query  468  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL-------------PTNPYSATKAGAEMLV  608
            I+RFIHVSTDEV GE   +A+  +H    L+             PTNPY+A+KAGAE++V
Sbjct  124  IKRFIHVSTDEVKGEN--EALTTHHSPLTLVVSVRQIGADNILEPTNPYAASKAGAELVV  181

Query  609  MAYGRSYGLPVITTRGNNVY  668
             +Y RS+ LPVI TR NNVY
Sbjct  182  RSYHRSFNLPVIITRSNNVY  201



>ref|XP_005778340.1| hypothetical protein EMIHUDRAFT_367182 [Emiliania huxleyi CCMP1516]
 ref|XP_005784020.1| dTDP-glucose 4,6-dehydratase [Emiliania huxleyi CCMP1516]
 gb|EOD25911.1| hypothetical protein EMIHUDRAFT_367182 [Emiliania huxleyi CCMP1516]
 gb|EOD31591.1| dTDP-glucose 4,6-dehydratase [Emiliania huxleyi CCMP1516]
Length=378

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 141/190 (74%), Gaps = 2/190 (1%)
 Frame = +3

Query  99   MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  278
            +  YTP NIL+TG AGFIASHV   LV  YP YK+V LDK+DYCS+L NL   +  PNFK
Sbjct  22   VGNYTPTNILVTGGAGFIASHVVIGLVEKYPQYKVVCLDKMDYCSSLHNLDQVKDKPNFK  81

Query  279  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  458
             VKG++ SADL+NY+L TE IDTI+H AAQTHVDNSFGNSF FT+NN+ GTHVL+EA K 
Sbjct  82   MVKGNLLSADLMNYVLETEQIDTIIHAAAQTHVDNSFGNSFAFTENNVLGTHVLVEAAKK  141

Query  459  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP  638
             G IRRFIHVSTDEVYG +  +      E   L PTNPY+ATKA AE +  +Y  S+ +P
Sbjct  142  AG-IRRFIHVSTDEVYGSSYSEE-PSRKEGDVLEPTNPYAATKAAAENIARSYWYSFKMP  199

Query  639  VITTRGNNVY  668
            +I TRGNNV+
Sbjct  200  IIVTRGNNVF  209



>gb|EJK47833.1| hypothetical protein THAOC_33424 [Thalassiosira oceanica]
Length=369

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 138/196 (70%), Gaps = 9/196 (5%)
 Frame = +3

Query  108  YTPKNILITGAAG---------FIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSR  260
            Y P+NIL+TG AG         FI SH A  L + YP Y ++V DKLDYCS L NL    
Sbjct  13   YIPRNILLTGGAGPLIIAETLGFIGSHAAILLAKKYPQYNVIVYDKLDYCSCLANLDEIS  72

Query  261  SSPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVL  440
               NFKFVKGDI S DLV+Y++  E++DT+MHFAAQTHVDNSFGNSF FT++NIYGTHVL
Sbjct  73   RLKNFKFVKGDICSPDLVSYVMREEDVDTVMHFAAQTHVDNSFGNSFNFTQSNIYGTHVL  132

Query  441  LEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYG  620
            LE+ K    IRRFIHVSTDEVYGE +        E   L PTNPY+ATKAGAE LV +Y 
Sbjct  133  LESAKNHKTIRRFIHVSTDEVYGEGETFETEAMKEEHVLEPTNPYAATKAGAEFLVKSYH  192

Query  621  RSYGLPVITTRGNNVY  668
            RS+ LP + TRGNNVY
Sbjct  193  RSFKLPCVITRGNNVY  208



>ref|XP_005757838.1| hypothetical protein EMIHUDRAFT_433184 [Emiliania huxleyi CCMP1516]
 gb|EOD05409.1| hypothetical protein EMIHUDRAFT_433184 [Emiliania huxleyi CCMP1516]
Length=378

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 141/192 (73%), Gaps = 2/192 (1%)
 Frame = +3

Query  93   VKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPN  272
            V +  YTP NIL+TG AGFIASHV   LV  YP YK+V LDK+DYCS+L NL   +  PN
Sbjct  20   VDVGNYTPTNILVTGGAGFIASHVVIGLVEKYPQYKVVCLDKMDYCSSLHNLDQVKDKPN  79

Query  273  FKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  452
            F+ VKG++ SADL+NY+L TE IDTI+H AAQTHVDNSFGNSF FT+NN+ GTHVL+EA 
Sbjct  80   FRMVKGNLLSADLMNYVLETEQIDTIIHAAAQTHVDNSFGNSFAFTENNVLGTHVLVEAA  139

Query  453  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYG  632
            K  G IRRFIHVSTDEVYG +  +      E   L PTNPY+ATKA AE +   Y  S+ 
Sbjct  140  KKAG-IRRFIHVSTDEVYGSSYSEE-PSRKEGDVLEPTNPYAATKAAAENIARLYWYSFK  197

Query  633  LPVITTRGNNVY  668
            +P+I TRGNNV+
Sbjct  198  MPIIVTRGNNVF  209



>ref|XP_004256510.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
 gb|ELP89739.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
Length=342

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 139/189 (74%), Gaps = 8/189 (4%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            Y PK ILITG AGFIASHV    V  YP YKIVV+DKLDYC++LKNL   + +PNFKF  
Sbjct  3    YEPKVILITGGAGFIASHVVIHFVTQYPQYKIVVVDKLDYCASLKNLDAVKGAPNFKFFI  62

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
             DI  A  +  +   E +DT+MHFAAQTHVDNSFGNSF+FT NNI+GTHVLLE  K    
Sbjct  63   ADITDAHTMQKIFEMEKVDTVMHFAAQTHVDNSFGNSFQFTHNNIFGTHVLLEVAK-NAN  121

Query  468  IRRFIHVSTDEVYGETDEDAVVGNH--EASQLLPTNPYSATKAGAEMLVMAYGRSYGLPV  641
            +RRFIHVSTDEVYG+     V+GN   E S L PTNPYSATKAGAE +  A+ +S+GLP+
Sbjct  122  VRRFIHVSTDEVYGQ-----VIGNAATENSLLNPTNPYSATKAGAEFIARAFYQSFGLPL  176

Query  642  ITTRGNNVY  668
            I TRGNNV+
Sbjct  177  IITRGNNVF  185



>ref|XP_005537192.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81156.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 141/188 (75%), Gaps = 6/188 (3%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            + P+NIL+TG AGFIASHV  RLV  YP Y++ VLDKLDYCS+L NL    + PNFKF++
Sbjct  36   FVPRNILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIR  95

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DLV Y+L  E IDT++HFAA THVDNSF +S  FT+NN+ GTHVLLE  +  G+
Sbjct  96   GDIRSHDLVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGK  155

Query  468  IRRFIHVSTDEVY-GETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            +RRFIHVSTDEVY GE++ +      E+S L PTNPY+ +KA AE +   Y +S+GLPVI
Sbjct  156  VRRFIHVSTDEVYGGESNMET-----ESSILAPTNPYACSKAAAEFICRGYVKSFGLPVI  210

Query  645  TTRGNNVY  668
             TRGNNVY
Sbjct  211  ITRGNNVY  218



>ref|XP_005536953.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80917.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 141/188 (75%), Gaps = 6/188 (3%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            + P+NIL+TG AGFIASHV  RLV  YP Y++ VLDKLDYCS+L NL    + PNFKF++
Sbjct  36   FVPRNILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIR  95

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DLV Y+L  E IDT++HFAA THVDNSF +S  FT+NN+ GTHVLLE  +  G+
Sbjct  96   GDIRSHDLVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGK  155

Query  468  IRRFIHVSTDEVY-GETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            +RRFIHVSTDEVY GE++ +      E+S L PTNPY+ +KA AE +   Y +S+GLPVI
Sbjct  156  VRRFIHVSTDEVYGGESNMET-----ESSILAPTNPYACSKAAAEFICRGYVKSFGLPVI  210

Query  645  TTRGNNVY  668
             TRGNNVY
Sbjct  211  ITRGNNVY  218



>ref|XP_005535008.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 ref|XP_005536685.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 ref|XP_005537980.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80401.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80649.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81944.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 141/188 (75%), Gaps = 6/188 (3%)
 Frame = +3

Query  108  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  287
            + P+NIL+TG AGFIASHV  RLV  YP Y++ VLDKLDYCS+L NL    + PNFKF++
Sbjct  36   FVPRNILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIR  95

Query  288  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  467
            GDI S DLV Y+L  E IDT++HFAA THVDNSF +S  FT+NN+ GTHVLLE  +  G+
Sbjct  96   GDIRSHDLVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGK  155

Query  468  IRRFIHVSTDEVY-GETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVI  644
            +RRFIHVSTDEVY GE++ +      E+S L PTNPY+ +KA AE +   Y +S+GLPVI
Sbjct  156  VRRFIHVSTDEVYGGESNMET-----ESSILAPTNPYACSKAAAEFICRGYVKSFGLPVI  210

Query  645  TTRGNNVY  668
             TRGNNVY
Sbjct  211  ITRGNNVY  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780