BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF025B21

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06988.1|  unnamed protein product                                347   7e-117   Coffea canephora [robusta coffee]
ref|XP_009759515.1|  PREDICTED: splicing factor U2af small subuni...    343   2e-115   Nicotiana sylvestris
ref|XP_011090000.1|  PREDICTED: splicing factor U2af small subuni...    343   3e-115   Sesamum indicum [beniseed]
ref|XP_009349332.1|  PREDICTED: splicing factor U2af small subuni...    342   6e-115   Pyrus x bretschneideri [bai li]
ref|XP_004294039.1|  PREDICTED: splicing factor U2af small subuni...    342   7e-115   Fragaria vesca subsp. vesca
gb|KDP34367.1|  hypothetical protein JCGZ_11250                         342   8e-115   Jatropha curcas
ref|XP_006349078.1|  PREDICTED: splicing factor U2af small subuni...    342   1e-114   Solanum tuberosum [potatoes]
ref|XP_011005647.1|  PREDICTED: splicing factor U2af small subuni...    341   4e-114   Populus euphratica
ref|XP_009621463.1|  PREDICTED: splicing factor U2af small subuni...    340   4e-114   Nicotiana tomentosiformis
ref|XP_010278242.1|  PREDICTED: splicing factor U2af small subuni...    340   4e-114   Nelumbo nucifera [Indian lotus]
ref|XP_009337398.1|  PREDICTED: splicing factor U2af small subuni...    340   5e-114   Pyrus x bretschneideri [bai li]
ref|XP_009616753.1|  PREDICTED: splicing factor U2af small subuni...    340   5e-114   Nicotiana tomentosiformis
ref|XP_004251010.1|  PREDICTED: splicing factor U2af small subunit B    340   7e-114   Solanum lycopersicum
ref|XP_003540217.1|  PREDICTED: splicing factor U2af small subuni...    340   7e-114   Glycine max [soybeans]
ref|XP_007015960.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    339   1e-113   Theobroma cacao [chocolate]
ref|XP_008355218.1|  PREDICTED: splicing factor U2af small subuni...    339   1e-113   
gb|KEH38936.1|  splicing factor U2af small subunit A-like protein       339   1e-113   Medicago truncatula
gb|KJB35323.1|  hypothetical protein B456_006G109200                    339   2e-113   Gossypium raimondii
ref|XP_008385457.1|  PREDICTED: splicing factor U2af small subunit B    338   2e-113   Malus domestica [apple tree]
ref|XP_007206817.1|  hypothetical protein PRUPE_ppa025949mg             337   2e-113   
ref|XP_009760036.1|  PREDICTED: splicing factor U2af small subuni...    338   2e-113   Nicotiana sylvestris
ref|XP_006384672.1|  hypothetical protein POPTR_0004s20030g             339   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_007150110.1|  hypothetical protein PHAVU_005G127700g             338   2e-113   Phaseolus vulgaris [French bean]
ref|XP_008228178.1|  PREDICTED: splicing factor U2af small subunit A    337   3e-113   
ref|XP_008461981.1|  PREDICTED: splicing factor U2af small subuni...    338   7e-113   Cucumis melo [Oriental melon]
ref|XP_002527446.1|  U2 snrnp auxiliary factor, small subunit, pu...    337   1e-112   Ricinus communis
ref|XP_004487532.1|  PREDICTED: splicing factor U2af small subuni...    336   2e-112   
ref|XP_002277445.2|  PREDICTED: splicing factor U2af small subuni...    337   3e-112   Vitis vinifera
ref|XP_007015957.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    335   4e-112   
ref|XP_004139466.1|  PREDICTED: splicing factor U2af small subuni...    336   4e-112   Cucumis sativus [cucumbers]
ref|XP_006484971.1|  PREDICTED: splicing factor U2af small subuni...    335   4e-112   Citrus sinensis [apfelsine]
ref|XP_010690014.1|  PREDICTED: splicing factor U2af small subuni...    335   8e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007150113.1|  hypothetical protein PHAVU_005G127800g             333   1e-111   Phaseolus vulgaris [French bean]
gb|EYU36100.1|  hypothetical protein MIMGU_mgv1a010734mg                333   2e-111   Erythranthe guttata [common monkey flower]
ref|XP_010243574.1|  PREDICTED: splicing factor U2af small subuni...    333   2e-111   Nelumbo nucifera [Indian lotus]
gb|KJB35328.1|  hypothetical protein B456_006G109200                    333   3e-111   Gossypium raimondii
ref|XP_010535661.1|  PREDICTED: splicing factor U2af small subuni...    333   4e-111   Tarenaya hassleriana [spider flower]
ref|XP_010683884.1|  PREDICTED: splicing factor U2af small subuni...    332   5e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010045262.1|  PREDICTED: splicing factor U2af small subuni...    331   3e-110   Eucalyptus grandis [rose gum]
ref|XP_010312244.1|  PREDICTED: splicing factor U2af small subunit B    332   3e-110   
ref|XP_006851725.1|  hypothetical protein AMTR_s00040p00218420          330   3e-110   Amborella trichopoda
ref|XP_006339114.1|  PREDICTED: splicing factor U2af small subuni...    332   4e-110   
ref|XP_009760280.1|  PREDICTED: splicing factor U2af small subuni...    331   5e-110   Nicotiana sylvestris
ref|XP_009623014.1|  PREDICTED: splicing factor U2af small subuni...    331   6e-110   Nicotiana tomentosiformis
emb|CBI30239.3|  unnamed protein product                                325   6e-110   Vitis vinifera
ref|XP_009385083.1|  PREDICTED: splicing factor U2af small subuni...    328   2e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE77038.1|  unknown                                                 329   2e-109   Picea sitchensis
ref|XP_009383225.1|  PREDICTED: splicing factor U2af small subuni...    325   8e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383223.1|  PREDICTED: splicing factor U2af small subuni...    327   9e-109   
ref|XP_006430311.1|  hypothetical protein CICLE_v10012216mg             326   2e-108   Citrus clementina [clementine]
ref|XP_010927308.1|  PREDICTED: splicing factor U2af small subuni...    324   3e-108   Elaeis guineensis
ref|XP_006419102.1|  hypothetical protein EUTSA_v10002611mg             326   3e-108   Eutrema salsugineum [saltwater cress]
ref|XP_006381324.1|  hypothetical protein POPTR_0006s11790g             325   3e-108   Populus trichocarpa [western balsam poplar]
ref|XP_011018873.1|  PREDICTED: splicing factor U2af small subuni...    325   3e-108   Populus euphratica
ref|XP_008462532.1|  PREDICTED: splicing factor U2af small subuni...    325   5e-108   Cucumis melo [Oriental melon]
ref|XP_009353013.1|  PREDICTED: splicing factor U2af small subuni...    325   6e-108   Pyrus x bretschneideri [bai li]
ref|XP_004143302.1|  PREDICTED: splicing factor U2af small subuni...    325   7e-108   Cucumis sativus [cucumbers]
ref|XP_004171272.1|  PREDICTED: splicing factor U2af small subuni...    325   8e-108   
ref|XP_011094422.1|  PREDICTED: splicing factor U2af small subuni...    324   1e-107   Sesamum indicum [beniseed]
ref|XP_010503126.1|  PREDICTED: splicing factor U2af small subuni...    323   2e-107   Camelina sativa [gold-of-pleasure]
ref|XP_011101487.1|  PREDICTED: splicing factor U2af small subuni...    323   3e-107   Sesamum indicum [beniseed]
ref|XP_008386928.1|  PREDICTED: splicing factor U2af small subuni...    323   4e-107   
ref|XP_002877363.1|  hypothetical protein ARALYDRAFT_323163             321   6e-107   
ref|XP_004969477.1|  PREDICTED: splicing factor U2af small subuni...    321   7e-107   
ref|XP_010096852.1|  Splicing factor U2af small subunit B               322   9e-107   Morus notabilis
ref|XP_002307825.1|  U2 snRNP auxiliary factor small subunit fami...    320   1e-106   Populus trichocarpa [western balsam poplar]
emb|CAA77134.1|  U2 snRNP auxiliary factor, small subunit               319   2e-106   Oryza sativa [red rice]
ref|XP_003529190.1|  PREDICTED: splicing factor U2af small subuni...    319   3e-106   Glycine max [soybeans]
ref|XP_002458285.1|  hypothetical protein SORBIDRAFT_03g030670          319   3e-106   Sorghum bicolor [broomcorn]
ref|XP_008796188.1|  PREDICTED: splicing factor U2af small subuni...    319   3e-106   Phoenix dactylifera
ref|NP_001175917.1|  Os09g0491756                                       319   4e-106   
ref|XP_011041133.1|  PREDICTED: splicing factor U2af small subuni...    318   4e-106   Populus euphratica
gb|ABR17193.1|  unknown                                                 321   5e-106   Picea sitchensis
ref|XP_009602162.1|  PREDICTED: splicing factor U2af small subuni...    318   5e-106   Nicotiana tomentosiformis
gb|ABK24730.1|  unknown                                                 319   6e-106   Picea sitchensis
ref|XP_010425894.1|  PREDICTED: splicing factor U2af small subuni...    320   7e-106   Camelina sativa [gold-of-pleasure]
gb|ACN41131.1|  unknown                                                 319   7e-106   Picea sitchensis
gb|EYU36603.1|  hypothetical protein MIMGU_mgv1a027010mg                318   1e-105   Erythranthe guttata [common monkey flower]
gb|KDP42757.1|  hypothetical protein JCGZ_23697                         318   2e-105   Jatropha curcas
gb|EYU38608.1|  hypothetical protein MIMGU_mgv1a009386mg                319   3e-105   Erythranthe guttata [common monkey flower]
gb|KCW48369.1|  hypothetical protein EUGRSUZ_K02078                     315   3e-105   Eucalyptus grandis [rose gum]
gb|ACG33016.1|  splicing factor U2af 38 kDa subunit                     317   3e-105   Zea mays [maize]
gb|AIN39844.1|  hypothetical protein                                    317   3e-105   Zoysia matrella [Japanese carpet grass]
gb|ACG34774.1|  splicing factor U2af 38 kDa subunit                     317   4e-105   Zea mays [maize]
ref|XP_006605458.1|  PREDICTED: splicing factor U2af small subuni...    316   4e-105   Glycine max [soybeans]
ref|XP_006660778.1|  PREDICTED: splicing factor U2af small subuni...    316   5e-105   
gb|ACG29741.1|  splicing factor U2af 38 kDa subunit                     317   5e-105   Zea mays [maize]
ref|XP_010036733.1|  PREDICTED: splicing factor U2af small subuni...    317   5e-105   Eucalyptus grandis [rose gum]
ref|XP_002440251.1|  hypothetical protein SORBIDRAFT_09g028530          317   5e-105   Sorghum bicolor [broomcorn]
ref|NP_001130754.1|  splicing factor U2af subunit isoform 1             317   5e-105   Zea mays [maize]
ref|NP_001150605.1|  splicing factor U2af 38 kDa subunit                317   5e-105   Zea mays [maize]
ref|NP_001140674.1|  uncharacterized protein LOC100272749               316   6e-105   Zea mays [maize]
ref|XP_002528581.1|  U2 snrnp auxiliary factor, small subunit, pu...    317   6e-105   Ricinus communis
ref|XP_008654952.1|  PREDICTED: splicing factor U2af 38 kDa subun...    317   6e-105   Zea mays [maize]
ref|NP_001148499.1|  splicing factor U2af 38 kDa subunit                317   6e-105   Zea mays [maize]
gb|ACN36304.1|  unknown                                                 315   6e-105   Zea mays [maize]
ref|XP_004972468.1|  PREDICTED: splicing factor U2af small subuni...    316   9e-105   Setaria italica
ref|XP_004961212.1|  PREDICTED: splicing factor U2af small subuni...    316   1e-104   
ref|XP_004957211.1|  PREDICTED: splicing factor U2af small subuni...    315   1e-104   Setaria italica
gb|EPS71674.1|  hypothetical protein M569_03083                         315   1e-104   Genlisea aurea
ref|XP_009417288.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...    312   2e-104   
ref|XP_007050431.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    315   2e-104   
ref|XP_007202216.1|  hypothetical protein PRUPE_ppa008459mg             316   2e-104   Prunus persica
gb|EEC79701.1|  hypothetical protein OsI_20991                          315   3e-104   Oryza sativa Indica Group [Indian rice]
ref|XP_008241308.1|  PREDICTED: splicing factor U2af small subuni...    316   3e-104   Prunus mume [ume]
ref|XP_011074052.1|  PREDICTED: splicing factor U2af small subunit B    314   4e-104   Sesamum indicum [beniseed]
ref|XP_006654790.1|  PREDICTED: splicing factor U2af small subuni...    314   6e-104   Oryza brachyantha
ref|XP_006484974.1|  PREDICTED: splicing factor U2af small subuni...    314   8e-104   Citrus sinensis [apfelsine]
ref|NP_001056331.1|  Os05g0564200                                       313   1e-103   
emb|CAA77132.1|  U2 snRNP auxiliary factor, small subunit               313   1e-103   Oryza sativa [red rice]
gb|KJB22951.1|  hypothetical protein B456_004G075300                    311   3e-103   Gossypium raimondii
ref|XP_010063179.1|  PREDICTED: splicing factor U2af small subunit B    311   3e-103   Eucalyptus grandis [rose gum]
ref|XP_004145565.1|  PREDICTED: splicing factor U2af small subuni...    310   9e-103   Cucumis sativus [cucumbers]
ref|XP_008453027.1|  PREDICTED: splicing factor U2af small subuni...    310   1e-102   Cucumis melo [Oriental melon]
gb|ADE76244.1|  unknown                                                 310   1e-102   Picea sitchensis
ref|XP_010094497.1|  Splicing factor U2af small subunit A               312   1e-102   
ref|XP_002510741.1|  U2 snrnp auxiliary factor, small subunit, pu...    309   2e-102   
ref|XP_010530258.1|  PREDICTED: splicing factor U2af small subuni...    309   4e-102   Tarenaya hassleriana [spider flower]
ref|XP_008373338.1|  PREDICTED: splicing factor U2af small subuni...    309   4e-102   
ref|XP_008676046.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...    306   4e-102   
gb|KHG11538.1|  Splicing factor U2af small subunit A -like protein      310   5e-102   Gossypium arboreum [tree cotton]
ref|XP_009372655.1|  PREDICTED: splicing factor U2af small subuni...    308   7e-102   Pyrus x bretschneideri [bai li]
ref|XP_009777870.1|  PREDICTED: splicing factor U2af small subunit B    308   8e-102   Nicotiana sylvestris
ref|XP_002300614.1|  hypothetical protein POPTR_0002s00480g             307   9e-102   
ref|XP_003567899.1|  PREDICTED: splicing factor U2af small subunit B    308   1e-101   Brachypodium distachyon [annual false brome]
ref|XP_003569529.1|  PREDICTED: splicing factor U2af small subuni...    307   1e-101   Brachypodium distachyon [annual false brome]
gb|KJB25970.1|  hypothetical protein B456_004G218700                    307   1e-101   Gossypium raimondii
ref|XP_008787015.1|  PREDICTED: splicing factor U2af small subuni...    307   1e-101   Phoenix dactylifera
ref|XP_011034775.1|  PREDICTED: splicing factor U2af small subuni...    307   2e-101   Populus euphratica
ref|XP_010940634.1|  PREDICTED: splicing factor U2af small subuni...    308   2e-101   Elaeis guineensis
dbj|BAK02393.1|  predicted protein                                      307   2e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004303034.1|  PREDICTED: splicing factor U2af small subuni...    308   2e-101   Fragaria vesca subsp. vesca
emb|CDM83632.1|  unnamed protein product                                306   3e-101   Triticum aestivum [Canadian hard winter wheat]
gb|EMS52749.1|  Splicing factor U2af small subunit A                    306   3e-101   Triticum urartu
gb|EMS57689.1|  Splicing factor U2af small subunit A                    307   3e-101   Triticum urartu
gb|AAY84879.1|  U2AF small subunit                                      307   4e-101   Triticum aestivum [Canadian hard winter wheat]
gb|EMT12018.1|  Splicing factor U2af small subunit A                    307   5e-101   
gb|EMS51947.1|  Splicing factor U2af small subunit B                    305   5e-101   Triticum urartu
ref|XP_003589690.1|  Splicing factor U2af small subunit B               305   5e-101   
ref|XP_010932132.1|  PREDICTED: splicing factor U2af small subuni...    305   6e-101   Elaeis guineensis
ref|NP_199096.1|  Splicing factor U2af small subunit B                  305   9e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300085.1|  PREDICTED: splicing factor U2af small subunit B    305   1e-100   Fragaria vesca subsp. vesca
ref|XP_002863733.1|  hypothetical protein ARALYDRAFT_494737             305   1e-100   
dbj|BAJ89126.1|  predicted protein                                      306   1e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACJ84869.1|  unknown                                                 303   2e-100   Medicago truncatula
ref|XP_008807516.1|  PREDICTED: splicing factor U2af small subuni...    306   2e-100   Phoenix dactylifera
ref|XP_003554416.1|  PREDICTED: splicing factor U2af small subuni...    306   2e-100   Glycine max [soybeans]
ref|NP_174086.1|  splicing factor U2af small subunit A                  305   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521439.1|  PREDICTED: splicing factor U2af small subuni...    306   2e-100   Glycine max [soybeans]
gb|EMT17994.1|  Splicing factor U2af small subunit B                    305   2e-100   
gb|KHN18727.1|  Splicing factor U2af small subunit B                    305   2e-100   Glycine soja [wild soybean]
ref|XP_006415744.1|  hypothetical protein EUTSA_v10008280mg             305   2e-100   Eutrema salsugineum [saltwater cress]
dbj|BAJ34257.1|  unnamed protein product                                305   2e-100   Eutrema halophilum
ref|XP_010683631.1|  PREDICTED: splicing factor U2af small subuni...    303   3e-100   
ref|XP_002890741.1|  hypothetical protein ARALYDRAFT_472969             304   3e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_010539033.1|  PREDICTED: splicing factor U2af small subunit A    304   3e-100   Tarenaya hassleriana [spider flower]
ref|XP_007162850.1|  hypothetical protein PHAVU_001G186200g             305   3e-100   Phaseolus vulgaris [French bean]
ref|XP_006305464.1|  hypothetical protein CARUB_v10009885mg             304   3e-100   Capsella rubella
emb|CDP07247.1|  unnamed protein product                                304   3e-100   Coffea canephora [robusta coffee]
gb|EMT13818.1|  Splicing factor U2af small subunit A                    306   4e-100   
ref|XP_003576685.1|  PREDICTED: splicing factor U2af small subuni...    304   4e-100   Brachypodium distachyon [annual false brome]
gb|AES59941.2|  splicing factor U2af small subunit A-like protein       303   5e-100   Medicago truncatula
dbj|BAJ88434.1|  predicted protein                                      304   8e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010499248.1|  PREDICTED: splicing factor U2af small subuni...    303   1e-99    Camelina sativa [gold-of-pleasure]
ref|NP_001043811.2|  Os01g0667800                                       299   2e-99    
ref|XP_006403342.1|  hypothetical protein EUTSA_v10003254mg             301   3e-99    Eutrema salsugineum [saltwater cress]
emb|CDX95151.1|  BnaC09g17190D                                          301   4e-99    
ref|XP_009114033.1|  PREDICTED: splicing factor U2af small subunit B    301   4e-99    Brassica rapa
emb|CDY52374.1|  BnaA09g15730D                                          301   5e-99    Brassica napus [oilseed rape]
ref|XP_010503128.1|  PREDICTED: splicing factor U2af small subuni...    301   6e-99    Camelina sativa [gold-of-pleasure]
gb|KDP36729.1|  hypothetical protein JCGZ_08020                         299   2e-98    Jatropha curcas
gb|AAL06331.1|AF409139_1  U2 auxiliary factor small subunit             299   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498197.1|  PREDICTED: splicing factor U2af small subuni...    298   7e-98    Cicer arietinum [garbanzo]
gb|AAL06332.1|AF409140_1  U2 auxiliary factor small subunit             297   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435479.1|  hypothetical protein CICLE_v10003384mg             298   2e-97    
ref|XP_002961487.1|  hypothetical protein SELMODRAFT_230014             294   2e-97    
ref|XP_006495305.1|  PREDICTED: splicing factor U2af small subuni...    295   4e-97    
ref|XP_003634337.1|  PREDICTED: splicing factor U2af small subunit B    295   4e-97    
ref|XP_004494140.1|  PREDICTED: splicing factor U2af small subuni...    295   4e-96    Cicer arietinum [garbanzo]
gb|KEH24121.1|  splicing factor U2af small subunit A-like protein       295   6e-96    Medicago truncatula
ref|XP_006849930.1|  hypothetical protein AMTR_s00022p00118880          292   2e-95    Amborella trichopoda
gb|AFK48647.1|  unknown                                                 292   7e-95    Medicago truncatula
ref|XP_001754868.1|  predicted protein                                  290   1e-94    
ref|XP_001777116.1|  predicted protein                                  290   1e-94    
ref|XP_007153127.1|  hypothetical protein PHAVU_003G009100g             288   2e-94    Phaseolus vulgaris [French bean]
gb|AFK41187.1|  unknown                                                 290   4e-94    Lotus japonicus
ref|XP_002971319.1|  hypothetical protein SELMODRAFT_67301              287   1e-93    
gb|KHF98869.1|  Splicing factor U2af small subunit B                    285   1e-92    Gossypium arboreum [tree cotton]
tpg|DAA55289.1|  TPA: hypothetical protein ZEAMMB73_300759              280   2e-92    
emb|CDX90100.1|  BnaA08g18840D                                          283   4e-92    
ref|XP_005847929.1|  hypothetical protein CHLNCDRAFT_57737              286   1e-91    Chlorella variabilis
emb|CDY11775.1|  BnaC03g58030D                                          281   3e-91    Brassica napus [oilseed rape]
ref|XP_009109791.1|  PREDICTED: splicing factor U2af small subunit A    280   6e-91    Brassica rapa
ref|XP_009102962.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...    278   4e-90    Brassica rapa
ref|XP_005652312.1|  RNA-binding domain-containing protein              276   8e-90    Coccomyxa subellipsoidea C-169
ref|XP_001696419.1|  U2 snRNP auxiliary factor, small subunit           276   1e-89    Chlamydomonas reinhardtii
ref|XP_011401279.1|  Splicing factor U2af small subunit A               274   2e-89    Auxenochlorella protothecoides
gb|KCW48367.1|  hypothetical protein EUGRSUZ_K02078                     273   3e-88    Eucalyptus grandis [rose gum]
gb|KDD73606.1|  hypothetical protein H632_c2013p0                       270   3e-87    Helicosporidium sp. ATCC 50920
ref|XP_002506572.1|  predicted protein                                  267   2e-86    Micromonas commoda
ref|XP_003063225.1|  predicted protein                                  268   8e-86    Micromonas pusilla CCMP1545
ref|XP_002955007.1|  hypothetical protein VOLCADRAFT_83022              267   8e-86    Volvox carteri f. nagariensis
gb|EAY75306.1|  hypothetical protein OsI_03197                          266   9e-86    Oryza sativa Indica Group [Indian rice]
gb|EAY75311.1|  hypothetical protein OsI_03202                          266   1e-85    Oryza sativa Indica Group [Indian rice]
gb|EEE55149.1|  hypothetical protein OsJ_02948                          261   8e-84    Oryza sativa Japonica Group [Japonica rice]
gb|AIB09599.1|  mRNA splicing factor U2 associated factor               251   1e-80    Lotharella oceanica
ref|XP_007508626.1|  predicted protein                                  248   5e-78    Bathycoccus prasinos
emb|CDP10321.1|  unnamed protein product                                244   2e-75    Coffea canephora [robusta coffee]
emb|CEG00329.1|  U2 auxiliary factor small subunit                      238   4e-75    Ostreococcus tauri
emb|CDP15354.1|  unnamed protein product                                235   6e-75    Coffea canephora [robusta coffee]
ref|XP_001421585.1|  predicted protein                                  237   1e-74    Ostreococcus lucimarinus CCE9901
ref|XP_001712926.1|  mRNA splicing factor U2 associated factor          232   2e-73    Bigelowiella natans
ref|XP_011417404.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    234   3e-73    Crassostrea gigas
emb|CDP19362.1|  unnamed protein product                                234   3e-73    Coffea canephora [robusta coffee]
gb|ACF24526.1|  mRNA splicing factor U2 associated factor               231   6e-73    Gymnochlora stellata
emb|CCI44589.1|  unnamed protein product                                236   7e-73    Albugo candida
ref|XP_006379326.1|  hypothetical protein POPTR_0009s15180g             230   8e-73    
ref|XP_003747118.1|  PREDICTED: splicing factor U2af 38 kDa subun...    232   9e-73    Galendromus occidentalis
ref|XP_002999307.1|  splicing factor U2AF 35 kDa subunit                236   1e-72    Phytophthora infestans T30-4
emb|CCA15308.1|  splicing factor U2AF 35 kDa subunit putative           235   1e-72    Albugo laibachii Nc14
ref|XP_001630436.1|  predicted protein                                  231   1e-72    Nematostella vectensis
ref|XP_004696963.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    230   1e-72    Echinops telfairi [lesser hedgehog tenrec]
gb|EFX79448.1|  hypothetical protein DAPPUDRAFT_52589                   231   3e-72    Daphnia pulex
emb|CAF98200.1|  unnamed protein product                                230   4e-72    Tetraodon nigroviridis
ref|XP_010752203.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    230   4e-72    
ref|XP_003456044.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    230   4e-72    Oreochromis niloticus
ref|XP_006260531.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    231   4e-72    Alligator mississippiensis
ref|XP_008285544.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    230   4e-72    Stegastes partitus
gb|ETM49098.1|  hypothetical protein L914_06545                         234   5e-72    Phytophthora parasitica
ref|XP_008892402.1|  hypothetical protein PPTG_02849                    234   5e-72    Phytophthora parasitica INRA-310
ref|XP_006638939.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    229   5e-72    Lepisosteus oculatus
ref|XP_006424345.1|  hypothetical protein CICLE_v10029043mg             231   6e-72    Citrus clementina [clementine]
ref|XP_007906997.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    231   7e-72    Callorhinchus milii [Australian ghost shark]
ref|XP_003083571.1|  U2 snRNP auxiliary factor, small subunit (ISS)     230   7e-72    
gb|KDO45605.1|  hypothetical protein CISIN_1g024141mg                   231   7e-72    Citrus sinensis [apfelsine]
ref|XP_004696962.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    228   7e-72    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004570220.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    231   7e-72    
ref|XP_010998043.1|  PREDICTED: splicing factor U2AF 35 kDa subunit     228   8e-72    Camelus dromedarius [camel]
ref|XP_006005852.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    228   8e-72    
gb|AAD13394.1|  splicing factor U2AF35                                  228   1e-71    Takifugu rubripes [tiger puffer]
ref|XP_002610691.1|  hypothetical protein BRAFLDRAFT_202693             228   1e-71    Branchiostoma floridae
ref|XP_007253282.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    229   1e-71    
ref|XP_005812275.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    229   1e-71    
ref|XP_007906999.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    230   1e-71    Callorhinchus milii [Australian ghost shark]
ref|XP_005526584.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    228   1e-71    
ref|NP_001279955.1|  U2 small nuclear RNA auxiliary factor 1            230   2e-71    Callorhinchus milii [Australian ghost shark]
ref|XP_008322811.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    229   2e-71    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003961766.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    228   2e-71    
ref|XP_011417402.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    229   2e-71    Crassostrea gigas
ref|XP_009518861.1|  hypothetical protein PHYSODRAFT_370516             228   2e-71    Phytophthora sojae
ref|XP_005812274.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    228   2e-71    Xiphophorus maculatus
emb|CAG05840.1|  unnamed protein product                                228   2e-71    Tetraodon nigroviridis
ref|XP_003961765.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    228   2e-71    Takifugu rubripes [tiger puffer]
ref|XP_006260532.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    229   2e-71    Alligator mississippiensis
ref|NP_803432.1|  splicing factor U2AF 35 kDa subunit                   229   2e-71    Danio rerio [leopard danio]
ref|XP_011483916.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    228   2e-71    Oryzias latipes [Japanese rice fish]
ref|XP_003961764.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    228   2e-71    
ref|XP_004066668.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    228   3e-71    Oryzias latipes [Japanese rice fish]
ref|XP_009034974.1|  hypothetical protein AURANDRAFT_14519              226   4e-71    Aureococcus anophagefferens
gb|AAH98601.1|  U2af1 protein                                           228   4e-71    Danio rerio [leopard danio]
gb|ELU01671.1|  hypothetical protein CAPTEDRAFT_164217                  228   5e-71    Capitella teleta
ref|NP_001232170.1|  putative U2 snRNP auxiliary factor small sub...    228   5e-71    Taeniopygia guttata
tpd|FAA00160.1|  TPA: zinc finger protein                               227   7e-71    Ciona intestinalis [sea vase]
ref|XP_006788378.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    227   9e-71    Neolamprologus brichardi [lyretail cichlid]
ref|XP_003452934.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    227   9e-71    Oreochromis niloticus
ref|XP_010903464.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    227   9e-71    Esox lucius
ref|NP_001089860.1|  U2 small nuclear RNA auxiliary factor 1            227   9e-71    Xenopus laevis [clawed frog]
ref|XP_004551403.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    227   1e-70    
ref|NP_001039113.1|  U2 small nuclear RNA auxiliary factor 1            227   1e-70    Xenopus tropicalis [western clawed frog]
ref|XP_010945643.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   1e-70    Camelus bactrianus [camel]
gb|EPY75855.1|  splicing factor U2AF subunit isoform 2                  226   1e-70    Camelus ferus
ref|XP_006813128.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    227   2e-70    Saccoglossus kowalevskii
ref|XP_011417403.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    226   2e-70    Crassostrea gigas
gb|KFM65978.1|  Splicing factor U2af subunit                            226   2e-70    Stegodyphus mimosarum
ref|XP_009904118.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   2e-70    Picoides pubescens
ref|XP_004264647.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   3e-70    Orcinus orca [Orca]
ref|XP_004384863.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   3e-70    Trichechus manatus latirostris
ref|NP_001157241.1|  splicing factor U2AF 35 kDa subunit isoform 2      226   3e-70    Mus musculus [mouse]
ref|NP_001020374.1|  splicing factor U2AF 35 kDa subunit isoform b      226   3e-70    Homo sapiens [man]
ref|XP_003219027.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   3e-70    
ref|XP_004452792.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   3e-70    
ref|XP_004842475.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   3e-70    
ref|XP_001364583.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   4e-70    
ref|XP_005311023.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   4e-70    
ref|XP_007555441.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    225   4e-70    
ref|XP_007435009.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   4e-70    
ref|XP_005112030.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    226   4e-70    
ref|XP_008399908.1|  PREDICTED: splicing factor U2AF 35 kDa subunit     225   5e-70    
ref|XP_005798130.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    225   5e-70    
ref|XP_010903463.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    225   6e-70    
gb|ACN10240.1|  Splicing factor U2AF 35 kDa subunit                     224   6e-70    
ref|XP_009059775.1|  hypothetical protein LOTGIDRAFT_125122             224   6e-70    
ref|XP_010745836.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    225   7e-70    
ref|XP_008326134.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   8e-70    
emb|CDQ73123.1|  unnamed protein product                                224   8e-70    
ref|XP_005639004.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   9e-70    
gb|AAI35291.1|  LOC733934 protein                                       224   9e-70    
ref|XP_007064492.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   1e-69    
ref|XP_002989645.1|  hypothetical protein SELMODRAFT_4876               224   1e-69    
ref|XP_008273763.1|  PREDICTED: splicing factor U2AF 35 kDa subunit     224   1e-69    
ref|XP_010964831.1|  PREDICTED: splicing factor U2AF 35 kDa subunit     224   1e-69    
ref|XP_007435012.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   1e-69    
ref|NP_001073737.1|  splicing factor U2AF 35 kDa subunit                224   2e-69    
ref|XP_004384862.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|XP_009904119.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|NP_001037756.1|  splicing factor U2AF 35 kDa subunit                224   2e-69    
ref|XP_005526582.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|NP_006749.1|  splicing factor U2AF 35 kDa subunit isoform a         224   2e-69    
ref|XP_004631837.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
gb|KDO27275.1|  hypothetical protein SPRG_07523                         224   2e-69    
ref|XP_004226883.1|  PREDICTED: splicing factor U2AF 35 kDa subunit     223   2e-69    
ref|XP_003219026.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|XP_005548646.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|XP_004452791.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|XP_006813127.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|XP_004452793.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|XP_004842474.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|XP_003763431.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|XP_004842476.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|XP_008178086.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   2e-69    
ref|XP_007435008.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    224   3e-69    
ref|XP_004081462.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    223   3e-69    
gb|EKC34075.1|  Splicing factor U2AF 26 kDa subunit                     224   4e-69    
emb|CDS18825.1|  splicing factor u2af 35 kda subunit                    222   4e-69    
emb|CDJ01893.1|  splicing factor u2af 35 kda subunit                    222   4e-69    
ref|XP_008608040.1|  hypothetical protein SDRG_04157                    224   5e-69    
dbj|BAG70058.1|  U2 small nuclear RNA auxillary factor 1 isoform a      223   5e-69    
gb|ACN09842.1|  Splicing factor U2AF 35 kDa subunit                     223   5e-69    
emb|CEP13981.1|  hypothetical protein                                   222   6e-69    
ref|XP_006099627.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    223   6e-69    
ref|XP_011333996.1|  PREDICTED: splicing factor U2af 38 kDa subun...    223   6e-69    
gb|EHJ71738.1|  putative U2 snrnp auxiliary factor, small subunit       222   7e-69    
gb|ESA15716.1|  hypothetical protein GLOINDRAFT_333854                  221   7e-69    
ref|XP_006941474.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    221   7e-69    
gb|EXX53092.1|  hypothetical protein RirG_247160                        221   7e-69    
emb|CAX70328.1|  Splicing factor U2AF 35 kDa subunit                    221   8e-69    
gb|ABG21828.1|  U2 snRNP auxiliary factor small subunit-like protein    221   8e-69    
ref|XP_011309531.1|  PREDICTED: splicing factor U2af 38 kDa subunit     222   8e-69    
ref|XP_004452794.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    222   8e-69    
ref|XP_008483537.1|  PREDICTED: splicing factor U2af 38 kDa subun...    222   9e-69    
emb|CDS12301.1|  hypothetical protein LRAMOSA04496                      223   9e-69    
ref|XP_008468294.1|  PREDICTED: splicing factor U2af 38 kDa subun...    222   9e-69    
ref|XP_008545438.1|  PREDICTED: splicing factor U2af 38 kDa subun...    222   9e-69    
gb|AAH02184.1|  U2af1 protein                                           222   1e-68    
ref|XP_005692351.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    221   1e-68    
ref|XP_008710343.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    221   1e-68    
ref|XP_789191.3|  PREDICTED: splicing factor U2AF 35 kDa subunit-...    221   2e-68    
ref|XP_004926538.1|  PREDICTED: splicing factor U2af 38 kDa subun...    221   2e-68    
gb|EPB90905.1|  hypothetical protein HMPREF1544_02323                   221   2e-68    
ref|XP_006068853.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    221   2e-68    
ref|XP_005958266.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    221   2e-68    
ref|XP_001363961.1|  PREDICTED: splicing factor U2AF 26 kDa subunit     220   2e-68    
ref|XP_010847328.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    221   2e-68    
ref|XP_005908266.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    221   3e-68    
ref|XP_969424.1|  PREDICTED: splicing factor U2af 38 kDa subunit        220   3e-68    
ref|XP_004396530.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    221   3e-68    
ref|XP_003362292.2|  PREDICTED: splicing factor U2AF 26 kDa subun...    221   3e-68    
ref|XP_001606160.1|  PREDICTED: splicing factor U2af 38 kDa subunit     221   3e-68    
ref|XP_011261450.1|  PREDICTED: splicing factor U2af 38 kDa subun...    221   3e-68    
ref|XP_011148424.1|  PREDICTED: splicing factor U2af 38 kDa subun...    221   4e-68    
ref|XP_009019667.1|  hypothetical protein HELRODRAFT_184981             220   4e-68    
ref|XP_007165213.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    220   4e-68    
gb|ELV10521.1|  Splicing factor U2AF 35 kDa subunit                     220   4e-68    
ref|XP_011068348.1|  PREDICTED: splicing factor U2af 38 kDa subun...    220   5e-68    
ref|XP_011143282.1|  PREDICTED: splicing factor U2af 38 kDa subun...    220   5e-68    
ref|XP_002986097.1|  hypothetical protein SELMODRAFT_123490             221   5e-68    
ref|XP_004634541.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    220   5e-68    
ref|XP_011187449.1|  PREDICTED: splicing factor U2af 38 kDa subunit     220   5e-68    
ref|XP_397281.4|  PREDICTED: splicing factor U2af 38 kDa subunit        220   5e-68    
ref|NP_739566.1|  splicing factor U2AF 26 kDa subunit                   219   6e-68    
ref|XP_011329618.1|  PREDICTED: splicing factor U2af 38 kDa subun...    220   6e-68    
ref|XP_004531218.1|  PREDICTED: splicing factor U2af 38 kDa subun...    220   6e-68    
ref|XP_005361294.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    219   6e-68    
emb|CDH53504.1|  splicing factor u2af subunit                           219   6e-68    
ref|XP_011200107.1|  PREDICTED: splicing factor U2af 38 kDa subunit     219   7e-68    
ref|XP_011173566.1|  PREDICTED: splicing factor U2af 38 kDa subun...    220   7e-68    
ref|XP_008555412.1|  PREDICTED: splicing factor U2af 38 kDa subun...    220   7e-68    
gb|ABR23363.1|  U2 snRNP splicing factor small subunit                  221   8e-68    
ref|XP_003966563.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    219   8e-68    
ref|XP_009825980.1|  hypothetical protein H257_03540                    220   1e-67    
ref|XP_011504424.1|  PREDICTED: splicing factor U2af 38 kDa subunit     219   1e-67    
ref|XP_004284242.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    219   1e-67    
dbj|BAH72001.1|  ACYPI001339                                            218   1e-67    
ref|XP_008879913.1|  hypothetical protein H310_14001                    220   1e-67    
ref|XP_004659986.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    218   1e-67    
ref|XP_007066225.1|  PREDICTED: splicing factor U2AF 26 kDa subunit     218   1e-67    
gb|AAB17271.1|  U2 snRNP auxiliary factor                               219   2e-67    
emb|CEG73476.1|  Putative RNA-binding domain-containing protein         218   2e-67    
emb|CEI89885.1|  Putative RNA-binding domain-containing protein         218   2e-67    
ref|XP_011061937.1|  PREDICTED: splicing factor U2af 38 kDa subun...    219   2e-67    
ref|XP_003966562.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    218   2e-67    
ref|XP_002118076.1|  hypothetical protein TRIADDRAFT_33482              216   3e-67    
ref|XP_002041562.1|  GM16679                                            219   3e-67    
ref|NP_477208.1|  U2 small nuclear riboprotein auxiliary factor 3...    219   3e-67    
ref|XP_001968154.1|  GG24659                                            219   3e-67    
ref|XP_002087409.1|  GE16227                                            219   3e-67    
ref|XP_005862826.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    218   3e-67    
gb|AAX27612.2|  SJCHGC07381 protein                                     217   3e-67    
gb|ELK26863.1|  Splicing factor U2AF 35 kDa subunit                     218   4e-67    
ref|XP_006906029.1|  PREDICTED: splicing factor U2AF 26 kDa subunit     217   4e-67    
ref|XP_002399674.1|  U2 snRNP splicing factor, small subunit, put...    218   5e-67    
ref|XP_001950331.2|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...    219   6e-67    
emb|CDH54298.1|  u2 auxiliary factor small                              217   6e-67    
ref|NP_001029950.1|  splicing factor U2AF 26 kDa subunit                217   6e-67    
gb|EIE85055.1|  hypothetical protein RO3G_09765                         218   6e-67    
ref|XP_010598601.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    216   7e-67    
ref|XP_004439794.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    216   7e-67    
ref|XP_002920964.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    216   8e-67    
gb|ADD24040.1|  Splicing factor U2af 38 kDa subunit                     217   8e-67    
ref|XP_005823636.1|  hypothetical protein GUITHDRAFT_78757              216   9e-67    
ref|XP_003127103.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    216   9e-67    
ref|XP_011380099.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    216   9e-67    
emb|CDS11306.1|  hypothetical protein LRAMOSA03569                      216   1e-66    
ref|XP_008540553.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    216   1e-66    
ref|XP_005703884.1|  splicing factor U2AF 35 kDa subunit                218   1e-66    
ref|XP_008247756.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...    216   1e-66    
ref|XP_011404320.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    216   1e-66    
ref|XP_006998499.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    216   1e-66    
ref|XP_008573908.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    216   1e-66    
ref|XP_004765155.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    216   2e-66    
gb|KHJ41896.1|  hypothetical protein D918_07945                         216   2e-66    
emb|CDW54826.1|  splicing factor U2AF 35 kDa subunit                    215   2e-66    
ref|XP_005588943.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    214   2e-66    
gb|EIE79138.1|  hypothetical protein RO3G_03843                         216   2e-66    
gb|KFH68726.1|  hypothetical protein MVEG_05533                         214   4e-66    
ref|XP_008350319.1|  PREDICTED: splicing factor U2af small subuni...    214   4e-66    
ref|XP_007471066.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    214   4e-66    
ref|XP_010987985.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    215   4e-66    
emb|CBN08648.1|  U2 small nuclear RNA auxiliary factor 1                214   5e-66    
ref|XP_001845569.1|  splicing factor U2af 38 kDa subunit                214   5e-66    
emb|CDJ50469.1|  U2 snRNP auxiliary factor small subunit, putative      214   8e-66    
ref|XP_011225385.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    218   9e-66    
ref|XP_005186433.1|  PREDICTED: splicing factor U2af 38 kDa subunit     214   9e-66    
dbj|BAB25609.1|  unnamed protein product                                214   1e-65    
emb|CDI76245.1|  U2 snRNP auxiliary factor small subunit, putative      213   1e-65    
ref|XP_008967418.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    213   1e-65    
emb|CDI74669.1|  U2 snRNP auxiliary factor small subunit, putative      214   1e-65    
ref|XP_004990308.1|  splicing factor U2af 38 kDa subunit                215   2e-65    
emb|CDJ57598.1|  U2 snRNP auxiliary factor small subunit, putative      214   2e-65    
gb|KFB36360.1|  AGAP002956-PA-like protein                              214   2e-65    
emb|CDJ37382.1|  U2 snRNP auxiliary factor small subunit, putative      214   2e-65    
ref|XP_311943.3|  AGAP002956-PA                                         214   2e-65    
ref|XP_002427855.1|  Splicing factor U2Af 38 kDa subunit, putative      214   2e-65    
gb|ETN63697.1|  splicing factor U2af 38 kDa subunit                     214   2e-65    
ref|XP_008710340.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    218   2e-65    
ref|XP_001657976.1|  AAEL006713-PA                                      213   2e-65    
ref|XP_001867190.1|  splicing factor U2af 38 kDa subunit                213   3e-65    
sp|Q8WU68.2|U2AF4_HUMAN  RecName: Full=Splicing factor U2AF 26 kD...    212   4e-65    
ref|XP_008119873.1|  PREDICTED: eukaryotic peptide chain release ...    226   4e-65    
ref|XP_003380657.1|  conserved hypothetical protein                     213   5e-65    
ref|XP_006998500.1|  PREDICTED: splicing factor U2AF 35 kDa subun...    211   5e-65    
gb|EHH59479.1|  U2 auxiliary factor 26                                  212   6e-65    
ref|XP_005692350.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    213   6e-65    
ref|XP_005775881.1|  hypothetical protein EMIHUDRAFT_444106             214   6e-65    
ref|XP_002369044.1|  U2 snRNP auxiliary factor small subunit, put...    213   7e-65    
ref|XP_003292017.1|  hypothetical protein DICPUDRAFT_57704              218   9e-65    
ref|XP_005219069.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    212   1e-64    
ref|XP_008885455.1|  U2 snRNP auxiliary factor, putative                212   1e-64    
ref|XP_006068852.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    212   1e-64    
ref|XP_002051880.1|  GJ17240                                            212   1e-64    
ref|XP_001965391.1|  GF24893                                            212   1e-64    
ref|XP_006678367.1|  hypothetical protein BATDEDRAFT_11284              211   1e-64    
ref|XP_001989123.1|  GH10217                                            212   2e-64    
ref|XP_002183517.1|  predicted protein                                  211   2e-64    
ref|XP_002065155.1|  GK14823                                            213   2e-64    
ref|XP_002001793.1|  GI15018                                            212   2e-64    
gb|EFA77932.1|  RNA-binding region RNP-1 domain-containing protein      217   2e-64    
emb|CBJ27310.1|  conserved unknown protein                              218   2e-64    
ref|XP_639991.1|  RNA-binding region RNP-1 domain-containing protein    218   3e-64    
ref|XP_007994595.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    209   3e-64    
emb|CAK22276.1|  putative U2 snRNP auxiliary factor                     207   4e-64    
ref|XP_001357453.2|  GA17536                                            212   4e-64    
gb|ACN94635.1|  GA17536                                                 212   4e-64    
gb|EJW79960.1|  U2(RNU2) small nuclear RNA auxiliary factor 1           209   4e-64    
ref|XP_002018674.1|  GL25824                                            212   5e-64    
gb|AET50613.1|  hypothetical protein                                    210   5e-64    
gb|EJW86895.1|  U2 snRNP splicing factor small subunit                  210   6e-64    
ref|XP_001902599.1|  U2 small nuclear RNA auxiliary factor small ...    210   6e-64    
gb|KDQ71588.1|  Splicing factor U2af 38 kDa subunit                     211   6e-64    
gb|EHH29937.1|  U2 auxiliary factor 26                                  209   7e-64    
emb|CEF66329.1|  Splicing factor U2AF 35 kDa subunit                    209   7e-64    
ref|XP_004832402.1|  U2 snrnp auxiliary factor, small subunit, pu...    209   8e-64    
ref|XP_006424346.1|  hypothetical protein CICLE_v10029043mg             210   9e-64    
gb|EPZ35644.1|  Nucleotide-binding, alpha-beta plait domain-conta...    209   1e-63    
gb|KDO45604.1|  hypothetical protein CISIN_1g024141mg                   210   1e-63    
gb|ERE86838.1|  splicing factor U2AF subunit-like protein               210   1e-63    
ref|XP_001902678.1|  splicing factor U2AF35                             209   1e-63    
gb|KFP39297.1|  Splicing factor U2AF 35 kDa subunit                     207   2e-63    
ref|XP_010598602.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    208   2e-63    
ref|XP_003145864.1|  hypothetical protein LOAG_10291                    209   2e-63    
ref|XP_005616751.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    207   2e-63    
ref|XP_005664572.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    207   2e-63    
emb|CDR97534.1|  U2 splicing factor subunit, putative                   208   2e-63    
ref|XP_001610703.1|  U2 splicing factor subunit                         208   3e-63    
gb|KHN73384.1|  Splicing factor U2AF 35 kDa subunit                     218   3e-63    
gb|KFQ63103.1|  Splicing factor U2AF 35 kDa subunit                     206   3e-63    
ref|XP_007101128.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    207   3e-63    
gb|KFW90627.1|  Splicing factor U2AF 35 kDa subunit                     206   4e-63    
ref|XP_005958267.1|  PREDICTED: splicing factor U2AF 26 kDa subun...    207   4e-63    
gb|KFP53608.1|  Splicing factor U2AF 35 kDa subunit                     206   4e-63    



>emb|CDP06988.1| unnamed protein product [Coffea canephora]
Length=300

 Score =   347 bits (890),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDPHKMQEHFE+FYEDLFEELSKYG IESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGQPIDPHKMQEHFEDFYEDLFEELSKYGVIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAANALKNL+GR+YAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRISREL
Sbjct  121  QAANALKNLTGRYYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_009759515.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
sylvestris]
 ref|XP_009759516.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
sylvestris]
 ref|XP_009759517.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
sylvestris]
Length=318

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G+PIDP KMQEHFE+FYEDLFEEL+KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDVHGQPIDPRKMQEHFEDFYEDLFEELNKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA+NALKNL+GRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRI REL
Sbjct  121  QASNALKNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_011090000.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum 
indicum]
 ref|XP_011090001.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum 
indicum]
Length=320

 Score =   343 bits (881),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYEDLFEEL+KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGQPIDPKKMQEHFEDFYEDLFEELNKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANALKNL+GR+YAGRPIIVDFSPVTDFREATCRQYEE++CNRGGYCNFMHLKRISREL
Sbjct  121  HAANALKNLTGRYYAGRPIIVDFSPVTDFREATCRQYEEDACNRGGYCNFMHLKRISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_009349332.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
Length=314

 Score =   342 bits (878),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP +MQ HFEEFYEDLF ELSKYG+IESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGQPIDPRQMQRHFEEFYEDLFLELSKYGDIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NLSGRFYAGRPIIVD+SPVTDFREATCRQYEEN+CNRGGYCNFMHLKRI REL
Sbjct  121  HAANALRNLSGRFYAGRPIIVDYSPVTDFREATCRQYEENTCNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRELFG  186



>ref|XP_004294039.1| PREDICTED: splicing factor U2af small subunit B-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011460687.1| PREDICTED: splicing factor U2af small subunit B-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011460689.1| PREDICTED: splicing factor U2af small subunit B-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011460690.1| PREDICTED: splicing factor U2af small subunit B-like [Fragaria 
vesca subsp. vesca]
Length=307

 Score =   342 bits (877),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQ HFEEFYEDLF+ELSKYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGQPIDPRKMQSHFEEFYEDLFQELSKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANALKNL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRI REL
Sbjct  121  HAANALKNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFGRY  630
               LF  Y
Sbjct  181  RHELFRNY  188



>gb|KDP34367.1| hypothetical protein JCGZ_11250 [Jatropha curcas]
Length=313

 Score =   342 bits (878),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+QEHFE+FYEDLFEELSKYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGNPIDPRKIQEHFEDFYEDLFEELSKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANA +NLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL
Sbjct  121  HAANAHRNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_006349078.1| PREDICTED: splicing factor U2af small subunit A-like [Solanum 
tuberosum]
Length=309

 Score =   342 bits (876),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPD ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDSITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+QEHFE+FYEDLFEEL+KYGEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGNPIDPRKIQEHFEDFYEDLFEELNKYGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAANALKNL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  QAANALKNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_011005647.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
 ref|XP_011005653.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
 ref|XP_011005661.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
Length=322

 Score =   341 bits (874),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+Q+HFEEFYEDLFEEL KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGNPIDPRKIQQHFEEFYEDLFEELRKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A+NALKNL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRI REL
Sbjct  121  HASNALKNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENACNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_009621463.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
tomentosiformis]
 ref|XP_009621464.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
tomentosiformis]
 ref|XP_009621465.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
tomentosiformis]
Length=320

 Score =   340 bits (873),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G+PIDP KMQEHFE+FYEDLFEEL+KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDVHGQPIDPRKMQEHFEDFYEDLFEELNKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA+NALKNL+GRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRI REL
Sbjct  121  QASNALKNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFG  624
               LFG
Sbjct  181  RHQLFG  186



>ref|XP_010278242.1| PREDICTED: splicing factor U2af small subunit B-like [Nelumbo 
nucifera]
 ref|XP_010278244.1| PREDICTED: splicing factor U2af small subunit B-like [Nelumbo 
nucifera]
Length=322

 Score =   340 bits (873),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMIT 
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITT  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+QEHFE+FYEDLFEELSKYGEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGQPLDPRKIQEHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NL+GR+YAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+ISREL
Sbjct  121  HAANALRNLTGRYYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKISREL  180

Query  607  XRHLFGRYHR  636
             R LFGRY R
Sbjct  181  RRQLFGRYRR  190



>ref|XP_009337398.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
 ref|XP_009337399.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
 ref|XP_009337400.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
Length=310

 Score =   340 bits (872),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP +MQ HFEEFYEDLF+ELSKYG+IESLNVCDNLADHMVGNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRQMQRHFEEFYEDLFQELSKYGDIESLNVCDNLADHMVGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NLSGRFYAGRPIIVD+SPVTDFREATCRQYEEN+CNRGGYCNFMHLKRI REL
Sbjct  121  HAANALRNLSGRFYAGRPIIVDYSPVTDFREATCRQYEENTCNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRELFG  186



>ref|XP_009616753.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
tomentosiformis]
 ref|XP_009616754.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
tomentosiformis]
 ref|XP_009616755.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
tomentosiformis]
Length=306

 Score =   340 bits (871),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPD ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDSITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG PIDPHK+Q+HFE+FYEDLFEEL+KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGHPIDPHKIQQHFEDFYEDLFEELNKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA NALKNL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLKRISREL
Sbjct  121  QAGNALKNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKRISREL  180

Query  607  XRHLFG  624
             + LFG
Sbjct  181  RQQLFG  186



>ref|XP_004251010.1| PREDICTED: splicing factor U2af small subunit B [Solanum lycopersicum]
 ref|XP_010313325.1| PREDICTED: splicing factor U2af small subunit B [Solanum lycopersicum]
Length=309

 Score =   340 bits (871),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPD ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDSITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+QEHFE+FYEDLFEEL+KYGEIESLN+CDNLADHMVGNVYVQF EEE
Sbjct  61   GVDAQGNPIDPRKIQEHFEDFYEDLFEELNKYGEIESLNICDNLADHMVGNVYVQFSEEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAANALKNL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  QAANALKNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_003540217.1| PREDICTED: splicing factor U2af small subunit A isoform X1 [Glycine 
max]
 ref|XP_006592737.1| PREDICTED: splicing factor U2af small subunit A isoform X2 [Glycine 
max]
 ref|XP_006592738.1| PREDICTED: splicing factor U2af small subunit A isoform X3 [Glycine 
max]
 gb|KHN27680.1| Splicing factor U2af small subunit A [Glycine soja]
Length=315

 Score =   340 bits (871),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDA G PIDP K+Q+HFEEFYEDLF+ELSKYG+IESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAHGHPIDPRKIQDHFEEFYEDLFDELSKYGDIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANA++NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRISREL
Sbjct  121  HAANAVRNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISREL  180

Query  607  XRHLFGR  627
             R LFG+
Sbjct  181  RRQLFGK  187



>ref|XP_007015960.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
 gb|EOY33579.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
Length=315

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+QEHFE FYEDLFEELSKYGE+ESLN+CDNLADHMVGNVYVQF+EEE
Sbjct  61   GVDAQGNPIDPRKIQEHFEGFYEDLFEELSKYGELESLNICDNLADHMVGNVYVQFKEEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NLSGRFYA RPIIVDFSPVTDFREATCRQY+EN+CNRGGYCNFMHLKRISREL
Sbjct  121  HAANALRNLSGRFYAARPIIVDFSPVTDFREATCRQYDENTCNRGGYCNFMHLKRISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  KRQLFG  186



>ref|XP_008355218.1| PREDICTED: splicing factor U2af small subunit B-like [Malus domestica]
 ref|XP_008355219.1| PREDICTED: splicing factor U2af small subunit B-like [Malus domestica]
Length=315

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDA+G+PIDP +MQ HFEEFYEDLF ELSKYG+IESLNVCDNLADHMVGNV VQFREEE
Sbjct  61   GVDAEGQPIDPRQMQRHFEEFYEDLFLELSKYGDIESLNVCDNLADHMVGNVCVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NLSGRFYAGRPIIVD+SPVTDFREATCRQYEEN+CNRGGYCNFMHLKRI REL
Sbjct  121  HAANALRNLSGRFYAGRPIIVDYSPVTDFREATCRQYEENTCNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFGRY  630
             R LFG Y
Sbjct  181  RRELFGSY  188



>gb|KEH38936.1| splicing factor U2af small subunit A-like protein [Medicago truncatula]
Length=324

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G+PIDP K+Q+HFEEFYEDLF+ELSKYG+IESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDVHGQPIDPRKIQDHFEEFYEDLFDELSKYGDIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A NA+KNL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRISREL
Sbjct  121  HAGNAVKNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISREL  180

Query  607  XRHLFGR  627
             R LFG+
Sbjct  181  RRQLFGK  187



>gb|KJB35323.1| hypothetical protein B456_006G109200 [Gossypium raimondii]
 gb|KJB35324.1| hypothetical protein B456_006G109200 [Gossypium raimondii]
 gb|KJB35325.1| hypothetical protein B456_006G109200 [Gossypium raimondii]
 gb|KJB35326.1| hypothetical protein B456_006G109200 [Gossypium raimondii]
 gb|KJB35327.1| hypothetical protein B456_006G109200 [Gossypium raimondii]
Length=314

 Score =   339 bits (869),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+Q+HFE FYEDLFEELSKYG+IESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGNPIDPRKIQQHFEAFYEDLFEELSKYGQIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANA+KNLSGRFYA RPIIVDFSPVTDFREATCRQY+EN+C+RGGYCNFMHLKRISREL
Sbjct  121  HAANAVKNLSGRFYAARPIIVDFSPVTDFREATCRQYDENTCSRGGYCNFMHLKRISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_008385457.1| PREDICTED: splicing factor U2af small subunit B [Malus domestica]
 ref|XP_008385458.1| PREDICTED: splicing factor U2af small subunit B [Malus domestica]
 ref|XP_008385459.1| PREDICTED: splicing factor U2af small subunit B [Malus domestica]
Length=310

 Score =   338 bits (868),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP +MQ HFEEFYEDL++ELSKYG+IESLNVCDNLADHMVGNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRQMQRHFEEFYEDLYQELSKYGDIESLNVCDNLADHMVGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NLSGRFYAGRPIIVD+SPVT+FREATCRQYEEN+CNRGGYCNFMHLKRI REL
Sbjct  121  HAANALRNLSGRFYAGRPIIVDYSPVTNFREATCRQYEENTCNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRELFG  186



>ref|XP_007206817.1| hypothetical protein PRUPE_ppa025949mg, partial [Prunus persica]
 gb|EMJ08016.1| hypothetical protein PRUPE_ppa025949mg, partial [Prunus persica]
Length=259

 Score =   337 bits (863),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP ++Q HFEEFYEDLF+ELSKYG+IESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGQPIDPRQIQRHFEEFYEDLFQELSKYGDIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A+NAL+NLSGRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRISREL
Sbjct  121  HASNALQNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISREL  180

Query  607  XRHLFG  624
               LFG
Sbjct  181  RHELFG  186



>ref|XP_009760036.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
sylvestris]
 ref|XP_009760037.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
sylvestris]
 ref|XP_009760038.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
sylvestris]
Length=309

 Score =   338 bits (868),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPD ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDSITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG PIDPHK+Q+HFE+FYEDLFEEL+KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGHPIDPHKIQQHFEDFYEDLFEELNKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA NALK+L+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLKRISREL
Sbjct  121  QAGNALKSLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKRISREL  180

Query  607  XRHLFG  624
               LFG
Sbjct  181  RHQLFG  186



>ref|XP_006384672.1| hypothetical protein POPTR_0004s20030g [Populus trichocarpa]
 gb|ERP62469.1| hypothetical protein POPTR_0004s20030g [Populus trichocarpa]
Length=320

 Score =   339 bits (869),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP ++Q+HFEEFYEDLFEEL KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGNPIDPRRIQQHFEEFYEDLFEELRKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A+NALKNL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRI REL
Sbjct  121  HASNALKNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENACNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_007150110.1| hypothetical protein PHAVU_005G127700g [Phaseolus vulgaris]
 ref|XP_007150111.1| hypothetical protein PHAVU_005G127700g [Phaseolus vulgaris]
 ref|XP_007150112.1| hypothetical protein PHAVU_005G127700g [Phaseolus vulgaris]
 gb|ESW22104.1| hypothetical protein PHAVU_005G127700g [Phaseolus vulgaris]
 gb|ESW22105.1| hypothetical protein PHAVU_005G127700g [Phaseolus vulgaris]
 gb|ESW22106.1| hypothetical protein PHAVU_005G127700g [Phaseolus vulgaris]
Length=308

 Score =   338 bits (867),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILL+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDA G PIDP K+Q+HF+EFYEDLFEELSKYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAHGHPIDPRKIQDHFQEFYEDLFEELSKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANA++NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRISR+L
Sbjct  121  HAANAVRNLAGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISRDL  180

Query  607  XRHLFGRY  630
               LFG++
Sbjct  181  RLQLFGKH  188



>ref|XP_008228178.1| PREDICTED: splicing factor U2af small subunit A, partial [Prunus 
mume]
Length=282

 Score =   337 bits (864),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP ++Q HFEEFYEDLF+ELSKYG+IESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGQPIDPRQIQRHFEEFYEDLFQELSKYGDIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A+NAL+NLSGRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRISREL
Sbjct  121  HASNALRNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISREL  180

Query  607  XRHLFG  624
               LFG
Sbjct  181  RHELFG  186



>ref|XP_008461981.1| PREDICTED: splicing factor U2af small subunit B-like [Cucumis 
melo]
 ref|XP_008461988.1| PREDICTED: splicing factor U2af small subunit B-like [Cucumis 
melo]
 ref|XP_008461997.1| PREDICTED: splicing factor U2af small subunit B-like [Cucumis 
melo]
Length=326

 Score =   338 bits (866),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+Q+HFEEFYEDLF+EL+KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGNPIDPRKIQDHFEEFYEDLFQELNKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAANAL+NLSGRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLKRI REL
Sbjct  121  QAANALRNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENMCNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFG  624
               LF 
Sbjct  181  RHELFA  186



>ref|XP_002527446.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis]
 gb|EEF34938.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis]
Length=322

 Score =   337 bits (864),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPT+LLSNMYQRPD+ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTLLLSNMYQRPDIITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDA G PIDP K+Q+HFEEFYEDLF+ELSKYGEI+SLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDANGNPIDPRKIQQHFEEFYEDLFQELSKYGEIDSLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A NAL+NLSGRFYAGRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRI REL
Sbjct  121  DAENALRNLSGRFYAGRPIIADFSPVTDFREATCRQYEENACNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFGRY  630
               LFGRY
Sbjct  181  RHQLFGRY  188



>ref|XP_004487532.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X1 [Cicer arietinum]
 ref|XP_004487533.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X2 [Cicer arietinum]
 ref|XP_004487534.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X3 [Cicer arietinum]
 ref|XP_004487535.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X4 [Cicer arietinum]
Length=319

 Score =   336 bits (862),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G PIDP K+Q+HFEEFYEDLFEELSKYG+IESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDVNGLPIDPRKIQDHFEEFYEDLFEELSKYGDIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANA++NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRISR+L
Sbjct  121  HAANAVRNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISRDL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_002277445.2| PREDICTED: splicing factor U2af small subunit B-like [Vitis vinifera]
 ref|XP_010654034.1| PREDICTED: splicing factor U2af small subunit B-like [Vitis vinifera]
Length=343

 Score =   337 bits (863),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMVTP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+QEHFE+FYEDLFEELSKYGEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGQPLDPRKIQEHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  HAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENICNRGGYCNFMHLKKISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_007015957.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007015958.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007015959.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33576.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33577.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33578.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma 
cacao]
Length=318

 Score =   335 bits (860),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GV+ QG PIDP K+QEHFEEFYEDLFEELSKYGEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVENQGNPIDPRKIQEHFEEFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NLSGR+Y+GRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK ISREL
Sbjct  121  HAANALRNLSGRYYSGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKTISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_004139466.1| PREDICTED: splicing factor U2af small subunit A-like [Cucumis 
sativus]
 ref|XP_004163713.1| PREDICTED: splicing factor U2af small subunit A-like [Cucumis 
sativus]
 gb|KGN64894.1| hypothetical protein Csa_1G145960 [Cucumis sativus]
Length=326

 Score =   336 bits (861),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP  +Q+HFEEFYEDLF+EL+KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGNPIDPRNIQDHFEEFYEDLFQELNKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAANAL+NLSGRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLKRI REL
Sbjct  121  QAANALRNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENMCNRGGYCNFMHLKRIGREL  180

Query  607  XRHLFG  624
               LF 
Sbjct  181  RHELFA  186



>ref|XP_006484971.1| PREDICTED: splicing factor U2af small subunit A-like isoform 
X1 [Citrus sinensis]
 ref|XP_006484972.1| PREDICTED: splicing factor U2af small subunit A-like isoform 
X2 [Citrus sinensis]
 ref|XP_006484973.1| PREDICTED: splicing factor U2af small subunit A-like isoform 
X3 [Citrus sinensis]
Length=320

 Score =   335 bits (860),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPT+LLSNMYQR DMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTLLLSNMYQRLDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG P+DP K+QEHFE+FYEDLFEEL+KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGNPLDPRKIQEHFEDFYEDLFEELNKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA ALK+LSGRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRISR+L
Sbjct  121  QAARALKSLSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISRDL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_010690014.1| PREDICTED: splicing factor U2af small subunit B-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010690015.1| PREDICTED: splicing factor U2af small subunit B-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010690016.1| PREDICTED: splicing factor U2af small subunit B-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010690017.1| PREDICTED: splicing factor U2af small subunit B-like [Beta vulgaris 
subsp. vulgaris]
Length=324

 Score =   335 bits (859),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MA+HLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MADHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+QEHFE+FYEDLFEEL KYGEIESLN+CDNLADHMVGNVYVQ+REEE
Sbjct  61   GVDAQGNPIDPRKIQEHFEDFYEDLFEELCKYGEIESLNICDNLADHMVGNVYVQYREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA+AL+NL+GRFY+GRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+I+REL
Sbjct  121  QAADALRNLTGRFYSGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKINREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_007150113.1| hypothetical protein PHAVU_005G127800g [Phaseolus vulgaris]
 gb|ESW22107.1| hypothetical protein PHAVU_005G127800g [Phaseolus vulgaris]
Length=297

 Score =   333 bits (855),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDA G PIDP K+Q+HFEEFYEDLFEELSKYGEIESLNVCDNLADHMVGNVYVQF EEE
Sbjct  61   GVDAHGHPIDPRKIQDHFEEFYEDLFEELSKYGEIESLNVCDNLADHMVGNVYVQFGEEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
              ANA++NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRISR+L
Sbjct  121  HVANAVRNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISRDL  180

Query  607  XRHLFGRY  630
               LFG++
Sbjct  181  RLQLFGKH  188



>gb|EYU36100.1| hypothetical protein MIMGU_mgv1a010734mg [Erythranthe guttata]
Length=303

 Score =   333 bits (854),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPD ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDSITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP KMQEHFE+FYEDLFEEL+K+GEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGLPIDPKKMQEHFEDFYEDLFEELNKHGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A+ ALK L+GRFYAGRPIIVDFSPVTDFREATCRQYEE++CNRGGYCNFMHLKRISREL
Sbjct  121  HASKALKALTGRFYAGRPIIVDFSPVTDFREATCRQYEEDACNRGGYCNFMHLKRISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_010243574.1| PREDICTED: splicing factor U2af small subunit B-like [Nelumbo 
nucifera]
 ref|XP_010243584.1| PREDICTED: splicing factor U2af small subunit B-like [Nelumbo 
nucifera]
Length=323

 Score =   333 bits (855),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+ IDP ++QEHFE+FYEDLFEELSKYGEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGQAIDPRRIQEHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK ISREL
Sbjct  121  HAANALRNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKMISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>gb|KJB35328.1| hypothetical protein B456_006G109200 [Gossypium raimondii]
Length=315

 Score =   333 bits (854),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 179/187 (96%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+Q+HFE FYEDLFEELSKYG+IESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGNPIDPRKIQQHFEAFYEDLFEELSKYGQIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE-  603
             AANA+KNLSGRFYA RPIIVDFSPVTDFREATCRQY+EN+C+RGGYCNFMHLKRISR+ 
Sbjct  121  HAANAVKNLSGRFYAARPIIVDFSPVTDFREATCRQYDENTCSRGGYCNFMHLKRISRQD  180

Query  604  LXRHLFG  624
            L R LFG
Sbjct  181  LRRQLFG  187



>ref|XP_010535661.1| PREDICTED: splicing factor U2af small subunit B-like [Tarenaya 
hassleriana]
 ref|XP_010535663.1| PREDICTED: splicing factor U2af small subunit B-like [Tarenaya 
hassleriana]
 ref|XP_010535664.1| PREDICTED: splicing factor U2af small subunit B-like [Tarenaya 
hassleriana]
Length=328

 Score =   333 bits (854),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GV AQG PIDP K+Q+HFE+FYEDLFEELSKYGEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVGAQGNPIDPRKIQQHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NL GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK ISREL
Sbjct  121  HAANALRNLQGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKAISREL  180

Query  607  XRHLFG  624
               L+G
Sbjct  181  RWQLYG  186



>ref|XP_010683884.1| PREDICTED: splicing factor U2af small subunit B-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683885.1| PREDICTED: splicing factor U2af small subunit B-like [Beta vulgaris 
subsp. vulgaris]
 gb|AAH03883.1| CDNA sequence BC003883 [Mus musculus]
Length=310

 Score =   332 bits (852),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LL+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q+HFE+FYEDLFEELSKYGEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGQPLDPRKIQQHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A  AL+NLSGRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  HAGEALRNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_010045262.1| PREDICTED: splicing factor U2af small subunit B-like [Eucalyptus 
grandis]
 ref|XP_010045263.1| PREDICTED: splicing factor U2af small subunit B-like [Eucalyptus 
grandis]
 ref|XP_010045264.1| PREDICTED: splicing factor U2af small subunit B-like [Eucalyptus 
grandis]
 gb|KCW87420.1| hypothetical protein EUGRSUZ_B03897 [Eucalyptus grandis]
Length=327

 Score =   331 bits (849),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYEDLFEEL+KYGE+ESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDLFEELNKYGEMESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  AL++LSGR+YAGRPIIVD+SPVTDFREATCRQYEE+ CNRGGYCNFMHLK ISREL
Sbjct  121  QAQRALQSLSGRYYAGRPIIVDYSPVTDFREATCRQYEEDKCNRGGYCNFMHLKSISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_010312244.1| PREDICTED: splicing factor U2af small subunit B [Solanum lycopersicum]
 ref|XP_010312245.1| PREDICTED: splicing factor U2af small subunit B [Solanum lycopersicum]
 ref|XP_010312246.1| PREDICTED: splicing factor U2af small subunit B [Solanum lycopersicum]
 ref|XP_010312247.1| PREDICTED: splicing factor U2af small subunit B [Solanum lycopersicum]
Length=350

 Score =   332 bits (850),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT++LSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLVLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP ++Q HFE+FYEDLFEELSKYGEIE+LN+CDNLADHMVGNVYVQFREE+
Sbjct  61   GVDPQGQPLDPRQIQRHFEDFYEDLFEELSKYGEIENLNICDNLADHMVGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA+AL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  HAASALQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180

Query  607  XRHLFGR  627
             R LFG+
Sbjct  181  RRQLFGK  187



>ref|XP_006851725.1| hypothetical protein AMTR_s00040p00218420 [Amborella trichopoda]
 gb|ERN13192.1| hypothetical protein AMTR_s00040p00218420 [Amborella trichopoda]
Length=294

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMVTP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+D QG+ +DP K+QEHFE+FYEDLFEELSKYGEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GMDPQGQAMDPRKIQEHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+ LS RFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+ISREL
Sbjct  121  HAANALRALSNRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRQLFG  186



>ref|XP_006339114.1| PREDICTED: splicing factor U2af small subunit B-like [Solanum 
tuberosum]
Length=350

 Score =   332 bits (850),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT++LSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLVLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP ++Q HFE+FYEDLFEELSKYGEIE+LN+CDNLADHMVGNVYVQFREE+
Sbjct  61   GVDPQGQPLDPRQIQRHFEDFYEDLFEELSKYGEIENLNICDNLADHMVGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA+AL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  HAASALQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180

Query  607  XRHLFGR  627
             R LFG+
Sbjct  181  RRQLFGK  187



>ref|XP_009760280.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
sylvestris]
 ref|XP_009760281.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
sylvestris]
Length=347

 Score =   331 bits (849),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT++LSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLVLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP ++Q HFE+FYEDLFEELSKYGEIE+LN+CDNLADHMVGNVYVQFREE+
Sbjct  61   GVDPQGQPLDPRQIQRHFEDFYEDLFEELSKYGEIENLNICDNLADHMVGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA+AL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  HAASALQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180

Query  607  XRHLF  621
             +HLF
Sbjct  181  RKHLF  185



>ref|XP_009623014.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
tomentosiformis]
 ref|XP_009623016.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
tomentosiformis]
Length=347

 Score =   331 bits (848),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT++LSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLVLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP ++Q HFE+FYEDLFEELSKYGEIE+LN+CDNLADHMVGNVYVQFREE+
Sbjct  61   GVDPQGQPLDPRQIQRHFEDFYEDLFEELSKYGEIENLNICDNLADHMVGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA+AL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  HAASALQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180

Query  607  XRHLF  621
             +HLF
Sbjct  181  RKHLF  185



>emb|CBI30239.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   325 bits (833),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMVTP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+QEHFE+FYEDLFEELSKYGEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGQPLDPRKIQEHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
             AANAL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISR+
Sbjct  121  HAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENICNRGGYCNFMHLKKISRQ  179



>ref|XP_009385083.1| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385084.1| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385085.1| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata 
subsp. malaccensis]
Length=301

 Score =   328 bits (841),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 179/187 (96%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPD-MIT  243
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQR D  IT
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRLDNAIT  60

Query  244  PGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
            PG+D+QG+P+DP ++QEHFE FYEDLFEELSKYGEIESLNVCDNLADHMVGNVYVQFREE
Sbjct  61   PGLDSQGQPMDPRQIQEHFENFYEDLFEELSKYGEIESLNVCDNLADHMVGNVYVQFREE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E AANAL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+ISRE
Sbjct  121  EHAANALRNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKQISRE  180

Query  604  LXRHLFG  624
            L R LFG
Sbjct  181  LRRKLFG  187



>gb|ADE77038.1| unknown [Picea sitchensis]
Length=334

 Score =   329 bits (843),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHT+PSISPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTRPSISPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+D QG  +DP K+QEHFE+FYEDLFEEL KYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GMDPQGHALDPQKIQEHFEDFYEDLFEELGKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL+ L+GRFYAGR IIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+ISREL
Sbjct  121  HAAAALQALTGRFYAGRAIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKISREL  180

Query  607  XRHLFGRYHR  636
             R LFGRY R
Sbjct  181  RRQLFGRYRR  190



>ref|XP_009383225.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383227.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383228.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=279

 Score =   325 bits (834),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED+FEEL K+GEIE+LNVCDNLADHM+GNVYVQ+REE+
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIFEELGKFGEIENLNVCDNLADHMIGNVYVQYREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA+ A++ L GRFY+GRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+I REL
Sbjct  121  QASAAMRALQGRFYSGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHVKQIGREL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRKLFGRY  188



>ref|XP_009383223.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009383224.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=319

 Score =   327 bits (838),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPTILLSNMYQRPDMITP
Sbjct  41   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTILLSNMYQRPDMITP  100

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED+FEEL K+GEIE+LNVCDNLADHM+GNVYVQ+REE+
Sbjct  101  GVDAQGQPIDPRKIQEHFEDFYEDIFEELGKFGEIENLNVCDNLADHMIGNVYVQYREED  160

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA+ A++ L GRFY+GRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+I REL
Sbjct  161  QASAAMRALQGRFYSGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHVKQIGREL  220

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  221  RRKLFGRY  228



>ref|XP_006430311.1| hypothetical protein CICLE_v10012216mg [Citrus clementina]
 ref|XP_006430312.1| hypothetical protein CICLE_v10012216mg [Citrus clementina]
 ref|XP_006481905.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481906.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X2 [Citrus sinensis]
 gb|ESR43551.1| hypothetical protein CICLE_v10012216mg [Citrus clementina]
 gb|ESR43552.1| hypothetical protein CICLE_v10012216mg [Citrus clementina]
 gb|KDO61019.1| hypothetical protein CISIN_1g045807mg [Citrus sinensis]
Length=320

 Score =   326 bits (836),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+ +DP K+Q+HFE+FYEDLFEELSKYGEIESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGQALDPRKIQDHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANAL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  HAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180



>ref|XP_010927308.1| PREDICTED: splicing factor U2af small subunit B-like [Elaeis 
guineensis]
Length=276

 Score =   324 bits (831),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMY RPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYHRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+ IDP K+QEHFE+FYED+FEELSK+GEIESLNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQQIDPRKIQEHFEDFYEDIFEELSKFGEIESLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A+K L GRFY+GRPIIVDFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K+ISREL
Sbjct  121  QAAAAVKALQGRFYSGRPIIVDFSPVTDFREATCRQFEENSCNRGGYCNFMHVKQISREL  180

Query  607  XRHLFGRY  630
             R LFG+Y
Sbjct  181  RRKLFGQY  188



>ref|XP_006419102.1| hypothetical protein EUTSA_v10002611mg [Eutrema salsugineum]
 gb|ESQ37538.1| hypothetical protein EUTSA_v10002611mg [Eutrema salsugineum]
Length=318

 Score =   326 bits (835),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G PIDP KMQ+HFE+FYEDLFEEL+KYGEIESLN+CDN++DH+VGNVYVQFREEE
Sbjct  61   GVDVHGNPIDPRKMQQHFEDFYEDLFEELNKYGEIESLNICDNISDHLVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  AL+NL GR+YAGRPIIVDFSPVTDFREATCRQYEE  C RGGYCNFMHLK ISR+L
Sbjct  121  QAGKALQNLRGRYYAGRPIIVDFSPVTDFREATCRQYEEEICKRGGYCNFMHLKSISRDL  180

Query  607  XRHLFGRYH  633
             R L+GRY+
Sbjct  181  RRQLYGRYN  189



>ref|XP_006381324.1| hypothetical protein POPTR_0006s11790g [Populus trichocarpa]
 gb|ERP59121.1| hypothetical protein POPTR_0006s11790g [Populus trichocarpa]
Length=311

 Score =   325 bits (834),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 2/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPT+LLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTLLLSNMYQRPDMLTP  60

Query  247  GVD--AQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFRE  420
            GVD  AQ + +DP K+Q+HFE+FYEDLFEELSKYG+IESLN+CDNLADHMVGNVYVQFRE
Sbjct  61   GVDPQAQSQSLDPRKIQDHFEDFYEDLFEELSKYGDIESLNICDNLADHMVGNVYVQFRE  120

Query  421  EEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISR  600
            EE AANAL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISR
Sbjct  121  EEHAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISR  180

Query  601  ELXRHLFG  624
            EL R LFG
Sbjct  181  ELRRQLFG  188



>ref|XP_011018873.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
 ref|XP_011018874.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
 ref|XP_011018875.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
 ref|XP_011018876.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
Length=311

 Score =   325 bits (834),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 2/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPT+LLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTLLLSNMYQRPDMLTP  60

Query  247  GVD--AQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFRE  420
            GVD  AQ + +DP K+Q+HFE+FYEDLFEELSKYG+IESLN+CDNLADHMVGNVYVQFRE
Sbjct  61   GVDPQAQSQSLDPRKIQDHFEDFYEDLFEELSKYGDIESLNICDNLADHMVGNVYVQFRE  120

Query  421  EEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISR  600
            EE AANAL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISR
Sbjct  121  EEHAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISR  180

Query  601  ELXRHLFG  624
            EL R LFG
Sbjct  181  ELRRQLFG  188



>ref|XP_008462532.1| PREDICTED: splicing factor U2af small subunit B-like [Cucumis 
melo]
 ref|XP_008462533.1| PREDICTED: splicing factor U2af small subunit B-like [Cucumis 
melo]
Length=315

 Score =   325 bits (832),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+ +DP K+Q+HFE+FYEDLFEELSKYG++ESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGQALDPRKVQDHFEDFYEDLFEELSKYGDLESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAANAL NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  QAANALHNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180



>ref|XP_009353013.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
Length=325

 Score =   325 bits (833),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 178/188 (95%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMIT-  243
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDM+T 
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMLTN  60

Query  244  PGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
            PGVD QG+ +DP K+Q++FE+FYEDLFEELSKYG+IESLN+CDNLADHMVGNVYVQFREE
Sbjct  61   PGVDPQGQALDPRKIQDNFEDFYEDLFEELSKYGQIESLNICDNLADHMVGNVYVQFREE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  AL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISRE
Sbjct  121  EHAQAALQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISRE  180

Query  604  LXRHLFGR  627
            L R LFGR
Sbjct  181  LRRRLFGR  188



>ref|XP_004143302.1| PREDICTED: splicing factor U2af small subunit A-like [Cucumis 
sativus]
 gb|KGN48233.1| hypothetical protein Csa_6G450380 [Cucumis sativus]
Length=317

 Score =   325 bits (832),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+ +DP K+Q+HFE+FYEDLFEELSKYG++ESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGQALDPRKVQDHFEDFYEDLFEELSKYGDLESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAANAL NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  QAANALHNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180



>ref|XP_004171272.1| PREDICTED: splicing factor U2af small subunit A-like [Cucumis 
sativus]
Length=317

 Score =   325 bits (832),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+ +DP K+Q+HFE+FYEDLFEELSKYG++ESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDPQGQALDPRKVQDHFEDFYEDLFEELSKYGDLESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAANAL NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  QAANALHNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180



>ref|XP_011094422.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum 
indicum]
 ref|XP_011094423.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum 
indicum]
 ref|XP_011094424.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum 
indicum]
Length=314

 Score =   324 bits (830),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q HFE+FYEDLF+ELSKYG+I+SLN+CDNLADHMVGNVYVQFREE+
Sbjct  61   GVDPQGQPLDPKKIQSHFEDFYEDLFQELSKYGDIQSLNICDNLADHMVGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA NAL+NL GR Y GRPII DFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  QAQNALQNLMGRSYEGRPIIADFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180

Query  607  XRHLF  621
             + LF
Sbjct  181  RQQLF  185



>ref|XP_010503126.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X1 [Camelina sativa]
 ref|XP_010503127.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X1 [Camelina sativa]
Length=317

 Score =   323 bits (828),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G PI+P KMQ+HFEEFYEDLFEEL+KYGEIESLN+CDN++DH+VGNVYVQFREEE
Sbjct  61   GVDVYGNPIEPRKMQQHFEEFYEDLFEELNKYGEIESLNICDNISDHLVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  AL+NL GRFYAGRPIIVDFSPVTDFREATCRQYEE +C RGGYCNFMHLK IS  L
Sbjct  121  QAGKALRNLQGRFYAGRPIIVDFSPVTDFREATCRQYEEETCKRGGYCNFMHLKSISSGL  180

Query  607  XRHLFGRY  630
             R L+GRY
Sbjct  181  RRQLYGRY  188



>ref|XP_011101487.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum 
indicum]
Length=313

 Score =   323 bits (827),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q HFE+FYEDLF+ELSKYG+I+SLN+CDNLADHMVGNVY+QFREE+
Sbjct  61   GVDPQGQPLDPKKIQSHFEDFYEDLFQELSKYGDIQSLNICDNLADHMVGNVYIQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA NAL+NL GR Y GRPII DFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  QAQNALQNLIGRSYEGRPIIADFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180

Query  607  XRHLF  621
             + LF
Sbjct  181  RQQLF  185



>ref|XP_008386928.1| PREDICTED: splicing factor U2af small subunit B-like [Malus domestica]
Length=325

 Score =   323 bits (828),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMIT-  243
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQ PDM+T 
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQHPDMLTN  60

Query  244  PGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
            PGVD QG+ IDP K+Q++FE+FYEDLFEELSKYG+IESLN+CDNLADHMVGNVYVQFREE
Sbjct  61   PGVDPQGQAIDPRKIQDNFEDFYEDLFEELSKYGQIESLNICDNLADHMVGNVYVQFREE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  AL+NL+GRFYAGRPIIV+FSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISRE
Sbjct  121  EHAQAALQNLTGRFYAGRPIIVBFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISRE  180

Query  604  LXRHLFGR  627
            L R LFGR
Sbjct  181  LRRRLFGR  188



>ref|XP_002877363.1| hypothetical protein ARALYDRAFT_323163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53622.1| hypothetical protein ARALYDRAFT_323163 [Arabidopsis lyrata subsp. 
lyrata]
Length=277

 Score =   321 bits (822),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDR NC FYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRANCHFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G  IDP KMQ HFE+FYEDLFEEL+KYGEIESLNVCDNL+DHMVGNVYVQFREEE
Sbjct  61   GVDVNGNRIDPRKMQAHFEDFYEDLFEELNKYGEIESLNVCDNLSDHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA NAL NL GRFYAGRPIIVDFSPVTDFREATCRQYEE +C RGGYCNFMHLK IS  L
Sbjct  121  QAGNALHNLQGRFYAGRPIIVDFSPVTDFREATCRQYEEETCKRGGYCNFMHLKSISSGL  180

Query  607  XRHLFGRY  630
             R L+GRY
Sbjct  181  RRQLYGRY  188



>ref|XP_004969477.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X1 [Setaria italica]
 ref|XP_004969478.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X2 [Setaria italica]
 ref|XP_004969479.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X3 [Setaria italica]
 ref|XP_004969480.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X4 [Setaria italica]
Length=293

 Score =   321 bits (823),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSR+H +P+ISPT++L NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRIHNRPTISPTLVLVNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED+FEELSK+GEIE+LNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKMQEHFEDFYEDIFEELSKFGEIENLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPI+VDFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+I R+L
Sbjct  121  QAAAAHTALQGRFYSGRPIVVDFSPVTDFREATCRQYEENSCNRGGYCNFMHVKQIGRDL  180

Query  607  XRHLFGRYHR  636
             + LFGRY R
Sbjct  181  RKKLFGRYRR  190



>ref|XP_010096852.1| Splicing factor U2af small subunit B [Morus notabilis]
 gb|EXB66236.1| Splicing factor U2af small subunit B [Morus notabilis]
Length=334

 Score =   322 bits (826),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 178/187 (95%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMIT-  243
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDM+T 
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMLTA  60

Query  244  PGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
            PGVD QG+ +DP K+Q++FE+FYEDLFEELSKYG+IESLN+CDNLADHMVGNVYVQFREE
Sbjct  61   PGVDTQGQSLDPRKIQDNFEDFYEDLFEELSKYGQIESLNICDNLADHMVGNVYVQFREE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E AA AL++L+GRFYAGRPIIVDFSPVTDFREATCRQYEEN C+RGGYCNFMHLK+ISRE
Sbjct  121  EHAAAALQSLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCSRGGYCNFMHLKKISRE  180

Query  604  LXRHLFG  624
            L R LFG
Sbjct  181  LRRKLFG  187



>ref|XP_002307825.1| U2 snRNP auxiliary factor small subunit family protein [Populus 
trichocarpa]
 gb|EEE94821.1| U2 snRNP auxiliary factor small subunit family protein [Populus 
trichocarpa]
Length=272

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSN Y RPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNTYHRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DPHK+QEHFE+FYED+FEELSK+GEIE+LNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPHKIQEHFEDFYEDIFEELSKFGEIENLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL++L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K I ++L
Sbjct  121  QAAAALQSLQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLIGKDL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRKLFGRY  188



>emb|CAA77134.1| U2 snRNP auxiliary factor, small subunit [Oryza sativa]
Length=274

 Score =   319 bits (818),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPS+SPT+LLSNMY RPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSVSPTLLLSNMYLRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+DAQG PIDP K+Q  FE+FYED+FEELSKYGEIESL+VCDN ADHM+GNVYVQFREE+
Sbjct  61   GIDAQGNPIDPEKIQADFEDFYEDIFEELSKYGEIESLHVCDNFADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L+GR+Y+GRPIIV+FSPV+DFREATCRQYEENSCNRGGYCNFMH+K I R+L
Sbjct  121  QAARALQALTGRYYSGRPIIVEFSPVSDFREATCRQYEENSCNRGGYCNFMHVKEIGRDL  180

Query  607  XRHLFGRYHR  636
             + LFG  HR
Sbjct  181  RKRLFGHLHR  190



>ref|XP_003529190.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
2 [Glycine max]
Length=271

 Score =   319 bits (817),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +PSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q+HFE+FYED+F EL+K+G+IESLNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDPQGQPLDPRKIQQHFEDFYEDIFTELAKFGDIESLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL  L GRFY  RPII DFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K I R+L
Sbjct  121  QAAKALHALHGRFYNARPIIADFSPVTDFREATCRQFEENSCNRGGYCNFMHVKLIGRDL  180

Query  607  XRHLFGRYHR  636
             R LFGR+HR
Sbjct  181  RRRLFGRHHR  190



>ref|XP_002458285.1| hypothetical protein SORBIDRAFT_03g030670 [Sorghum bicolor]
 gb|EES03405.1| hypothetical protein SORBIDRAFT_03g030670 [Sorghum bicolor]
Length=288

 Score =   319 bits (818),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLVNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EELSK+GEIE+LNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKMQEHFEDFYEDIYEELSKFGEIENLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPI+VDFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+I R+L
Sbjct  121  QAAAAHTALQGRFYSGRPIVVDFSPVTDFREATCRQYEENSCNRGGYCNFMHVKKIGRDL  180

Query  607  XRHLFGRYHR  636
             + +FG Y R
Sbjct  181  RKKMFGHYKR  190



>ref|XP_008796188.1| PREDICTED: splicing factor U2af small subunit B-like [Phoenix 
dactylifera]
Length=276

 Score =   319 bits (817),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+DAQG+ I+P K+QEHFE+FYED+FEELSK+GEIE LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GIDAQGQQIEPQKIQEHFEDFYEDIFEELSKFGEIECLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A+K L GRFY+GRPIIVDFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I +EL
Sbjct  121  QAAAAVKALQGRFYSGRPIIVDFSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGKEL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>ref|NP_001175917.1| Os09g0491756 [Oryza sativa Japonica Group]
 sp|Q9ZQW8.1|U2AFA_ORYSJ RecName: Full=Splicing factor U2af small subunit A; AltName: 
Full=U2 auxiliary factor 35 kDa subunit A; AltName: Full=U2 
small nuclear ribonucleoprotein auxiliary factor small subunit 
A; Short=U2 snRNP auxiliary factor small subunit A; AltName: 
Full=Zinc finger CCCH domain-containing protein 60; Short=OsC3H60 
[Oryza sativa Japonica Group]
 emb|CAA77133.1| U2 snRNP auxiliary factor, small subunit [Oryza sativa]
 gb|EAZ09583.1| hypothetical protein OsI_31864 [Oryza sativa Indica Group]
 gb|EAZ45203.1| hypothetical protein OsJ_29848 [Oryza sativa Japonica Group]
 dbj|BAG88365.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94151.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94645.1| Os09g0491756 [Oryza sativa Japonica Group]
Length=290

 Score =   319 bits (818),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPS+SPT+LLSNMY RPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSVSPTLLLSNMYLRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+DAQG PIDP K+Q  FE+FYED+FEELSKYGEIESL+VCDN ADHM+GNVYVQFREE+
Sbjct  61   GIDAQGNPIDPEKIQADFEDFYEDIFEELSKYGEIESLHVCDNFADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L+GR+Y+GRPIIV+FSPV+DFREATCRQYEENSCNRGGYCNFMH+K I R+L
Sbjct  121  QAARALQALTGRYYSGRPIIVEFSPVSDFREATCRQYEENSCNRGGYCNFMHVKEIGRDL  180

Query  607  XRHLFGRYHR  636
             + LFG  HR
Sbjct  181  RKRLFGHLHR  190



>ref|XP_011041133.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
Length=272

 Score =   318 bits (816),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSN Y RPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNTYHRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+FYED+FEELSK+GEIE+LNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFYEDIFEELSKFGEIENLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL++L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K I R+L
Sbjct  121  QAAAALQSLQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLIGRDL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRKLFGRY  188



>gb|ABR17193.1| unknown [Picea sitchensis]
Length=344

 Score =   321 bits (822),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIG CRHGDRCSRLHT+PSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGVCRHGDRCSRLHTRPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+D QG  +DP K+QEHFE+FYEDLFEEL KYG IESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GMDPQGHALDPRKIQEHFEDFYEDLFEELGKYGAIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL+ L+GRFYA R IIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+ISREL
Sbjct  121  HAAAALQALTGRFYAERAIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKISREL  180

Query  607  XRHLFGRYHR  636
             R LFGRY R
Sbjct  181  RRQLFGRYRR  190



>ref|XP_009602162.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana 
tomentosiformis]
Length=270

 Score =   318 bits (815),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHT+P++SPT+LLSNMY RPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTRPTVSPTLLLSNMYHRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GV+ QG+P+DP K+QEHFE+FYED+FEELSK+GEIE+LNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVEPQGQPLDPRKIQEHFEDFYEDIFEELSKFGEIENLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA  L+ L GRFY+GRPII DFSPVTDFREATCRQYEEN CNRGGYCNFMH+K ISREL
Sbjct  121  HAAATLQALQGRFYSGRPIIADFSPVTDFREATCRQYEENDCNRGGYCNFMHVKMISREL  180

Query  607  XRHLFGRYH  633
             R LFG+YH
Sbjct  181  RRKLFGKYH  189



>gb|ABK24730.1| unknown [Picea sitchensis]
Length=312

 Score =   319 bits (818),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHT+P+ISPTILLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTRPTISPTILLSNMYQRPDMVTP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+D QG  +DP K+QEHFE+FYEDLFEEL KYGE+ESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GMDIQGHAMDPRKIQEHFEDFYEDLFEELGKYGELESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            QAANAL++L GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+ISRE
Sbjct  121  QAANALRSLQGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKISRE  179



>ref|XP_010425894.1| PREDICTED: splicing factor U2af small subunit B-like [Camelina 
sativa]
 ref|XP_010425895.1| PREDICTED: splicing factor U2af small subunit B-like [Camelina 
sativa]
 ref|XP_010425896.1| PREDICTED: splicing factor U2af small subunit B-like [Camelina 
sativa]
 ref|XP_010425897.1| PREDICTED: splicing factor U2af small subunit B-like [Camelina 
sativa]
Length=317

 Score =   320 bits (819),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G  I+P KMQ+HFEEFYEDLFEEL+KYGEIESLN+CDN++DH+VGNVYVQFREEE
Sbjct  61   GVDVYGNHIEPRKMQQHFEEFYEDLFEELNKYGEIESLNICDNISDHLVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  AL+NL GRFYAGRPIIVDFSPVTDFREATCRQYEE++C RGGYCNFMHLK IS  L
Sbjct  121  QAGKALRNLQGRFYAGRPIIVDFSPVTDFREATCRQYEEDTCKRGGYCNFMHLKTISSGL  180

Query  607  XRHLFGRY  630
             R L+GRY
Sbjct  181  RRQLYGRY  188



>gb|ACN41131.1| unknown [Picea sitchensis]
Length=312

 Score =   319 bits (818),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHT+P+ISPTILLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTRPTISPTILLSNMYQRPDMVTP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+D QG  +DP K+QEHFE+FYEDLFEEL KYGE+ESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GMDIQGHAMDPRKIQEHFEDFYEDLFEELGKYGELESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            QAANAL++L GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+ISRE
Sbjct  121  QAANALRSLQGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKISRE  179



>gb|EYU36603.1| hypothetical protein MIMGU_mgv1a027010mg [Erythranthe guttata]
Length=304

 Score =   318 bits (816),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+F+ED+FEEL K+GEIESLNVCDNLADHM+GNVY QF+EE+
Sbjct  61   GVDAQGQPIDPDKIQEHFEDFFEDIFEELRKFGEIESLNVCDNLADHMIGNVYAQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            +AA AL  L GRFY+GRPII DFSPVTDFREATCRQYEENSCNRGGYCNFMH+K I +EL
Sbjct  121  EAAAALNALQGRFYSGRPIIADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKMIGKEL  180

Query  607  XRHLFGRYH  633
             R LFG+++
Sbjct  181  RRKLFGKHN  189



>gb|KDP42757.1| hypothetical protein JCGZ_23697 [Jatropha curcas]
Length=312

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 2/182 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMLTP  60

Query  247  GVD--AQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFRE  420
            GVD  AQ + +DP K+Q+HFE+FY+DLFEELSKYG+IESLN+CDNLADHMVGNVYVQFRE
Sbjct  61   GVDPQAQSQSLDPRKIQDHFEDFYQDLFEELSKYGDIESLNICDNLADHMVGNVYVQFRE  120

Query  421  EEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISR  600
            EE AA+AL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISR
Sbjct  121  EEHAASALQNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISR  180

Query  601  EL  606
            EL
Sbjct  181  EL  182



>gb|EYU38608.1| hypothetical protein MIMGU_mgv1a009386mg [Erythranthe guttata]
 gb|EYU38609.1| hypothetical protein MIMGU_mgv1a009386mg [Erythranthe guttata]
Length=344

 Score =   319 bits (817),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ SPTI+LSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTTSPTIVLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q HFE+FYEDLF+ELSKYG+I++LN+CDNLADHMVGNVY+QFREE+
Sbjct  61   GVDPQGQPLDPKKIQSHFEDFYEDLFQELSKYGDIQNLNICDNLADHMVGNVYIQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  AL+NL+GR Y GRPII DFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  QAQEALQNLTGRSYEGRPIIADFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180

Query  607  XRHLF  621
             + LF
Sbjct  181  RQQLF  185



>gb|KCW48369.1| hypothetical protein EUGRSUZ_K02078 [Eucalyptus grandis]
Length=244

 Score =   315 bits (808),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPTILLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTILLSNMYQRPDMLTP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD Q + +DP K+Q+HFE+FYEDLFEELSKYG+IE+LN+CDN+ADHMVGNVYVQFREEE
Sbjct  61   GVDPQAQNLDPRKVQDHFEDFYEDLFEELSKYGDIENLNICDNIADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANA++NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  HAANAVQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180



>gb|ACG33016.1| splicing factor U2af 38 kDa subunit [Zea mays]
 gb|ACG39290.1| splicing factor U2af 38 kDa subunit [Zea mays]
Length=284

 Score =   317 bits (811),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPSISPT+LL NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSISPTLLLCNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP ++QE FE+FYED+F ELSK+GEIESL+VCDNLADHM+GNVYV+FREEE
Sbjct  61   GVDAQGNPIDPERIQEDFEDFYEDIFVELSKHGEIESLHVCDNLADHMIGNVYVEFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GR+Y+GRPII +FSPVTDFREATCRQ+EE+SCNRGGYCNFMH+K++ R+L
Sbjct  121  QAARALQALQGRYYSGRPIIAEFSPVTDFREATCRQFEEHSCNRGGYCNFMHVKQVGRDL  180

Query  607  XRHLFGRYHR  636
             R LFG  HR
Sbjct  181  RRKLFGHLHR  190



>gb|AIN39844.1| hypothetical protein [Zoysia matrella]
Length=303

 Score =   317 bits (813),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EELSK+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELSKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I R+L
Sbjct  121  QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGRDL  180

Query  607  XRHLFGR  627
             R ++GR
Sbjct  181  RRKIYGR  187



>gb|ACG34774.1| splicing factor U2af 38 kDa subunit [Zea mays]
Length=307

 Score =   317 bits (813),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I R+L
Sbjct  121  QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGRDL  180

Query  607  XRHLFGR  627
             R L+GR
Sbjct  181  RRKLYGR  187



>ref|XP_006605458.1| PREDICTED: splicing factor U2af small subunit A-like isoform 
X1 [Glycine max]
 ref|XP_006605459.1| PREDICTED: splicing factor U2af small subunit A-like isoform 
X2 [Glycine max]
Length=268

 Score =   316 bits (809),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +PSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+ +DP K+Q+HFE+FYED+F EL+K+GEIESLNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDPQGQTLDPRKIQQHFEDFYEDIFTELAKFGEIESLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL  L GRFY  RPII DFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K I R+L
Sbjct  121  QAAKALHALRGRFYNARPIIADFSPVTDFREATCRQFEENSCNRGGYCNFMHVKLIGRDL  180

Query  607  XRHLFGRYHR  636
             R LFGR HR
Sbjct  181  RRRLFGRNHR  190



>ref|XP_006660778.1| PREDICTED: splicing factor U2af small subunit A-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006660779.1| PREDICTED: splicing factor U2af small subunit A-like isoform 
X2 [Oryza brachyantha]
Length=280

 Score =   316 bits (810),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPS+SPT+LLSNMY RPD+ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSVSPTLLLSNMYLRPDVITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+Q  FE+FYED+F+ELSK+GE+ESL+VCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGNPIDPEKIQADFEDFYEDIFDELSKHGEVESLHVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L+GR+Y+GRPIIV+FSPVTDFREATCRQYEENSCNRGGYCNFMH+K I R+L
Sbjct  121  QAARALQALTGRYYSGRPIIVEFSPVTDFREATCRQYEENSCNRGGYCNFMHVKEIGRDL  180

Query  607  XRHLFGRYHR  636
             + L G  HR
Sbjct  181  RKRLVGHLHR  190



>gb|ACG29741.1| splicing factor U2af 38 kDa subunit [Zea mays]
Length=307

 Score =   317 bits (812),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I R+L
Sbjct  121  QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGRDL  180

Query  607  XRHLFGR  627
             R L+GR
Sbjct  181  RRKLYGR  187



>ref|XP_010036733.1| PREDICTED: splicing factor U2af small subunit B-like [Eucalyptus 
grandis]
 gb|KCW48368.1| hypothetical protein EUGRSUZ_K02078 [Eucalyptus grandis]
Length=289

 Score =   317 bits (811),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPTILLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTILLSNMYQRPDMLTP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD Q + +DP K+Q+HFE+FYEDLFEELSKYG+IE+LN+CDN+ADHMVGNVYVQFREEE
Sbjct  61   GVDPQAQNLDPRKVQDHFEDFYEDLFEELSKYGDIENLNICDNIADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANA++NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  HAANAVQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL  180



>ref|XP_002440251.1| hypothetical protein SORBIDRAFT_09g028530 [Sorghum bicolor]
 gb|EES18681.1| hypothetical protein SORBIDRAFT_09g028530 [Sorghum bicolor]
Length=307

 Score =   317 bits (812),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I R+L
Sbjct  121  QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGRDL  180

Query  607  XRHLFGR  627
             R L+GR
Sbjct  181  RRKLYGR  187



>ref|NP_001130754.1| splicing factor U2af subunit isoform 1 [Zea mays]
 ref|XP_008647303.1| PREDICTED: splicing factor U2af subunit isoform 1 isoform X1 
[Zea mays]
 ref|XP_008647304.1| PREDICTED: splicing factor U2af subunit isoform 1 isoform X1 
[Zea mays]
 ref|XP_008647306.1| PREDICTED: splicing factor U2af subunit isoform 1 isoform X1 
[Zea mays]
 gb|ACF79097.1| unknown [Zea mays]
 gb|ACF85752.1| unknown [Zea mays]
 gb|AFT82709.1| C3H53 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW79167.1| splicing factor U2af subunit isoform 1 [Zea mays]
 gb|AFW79168.1| splicing factor U2af subunit isoform 2 [Zea mays]
 gb|AFW79169.1| splicing factor U2af subunit isoform 3 [Zea mays]
Length=307

 Score =   317 bits (812),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I R+L
Sbjct  121  QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGRDL  180

Query  607  XRHLFGR  627
             R L+GR
Sbjct  181  RRKLYGR  187



>ref|NP_001150605.1| splicing factor U2af 38 kDa subunit [Zea mays]
 ref|XP_008668072.1| PREDICTED: splicing factor U2af 38 kDa subunit isoform X1 [Zea 
mays]
 ref|XP_008668073.1| PREDICTED: splicing factor U2af 38 kDa subunit isoform X1 [Zea 
mays]
 gb|ACG39730.1| splicing factor U2af 38 kDa subunit [Zea mays]
 gb|ACN27948.1| unknown [Zea mays]
 gb|AFT82673.1| C3H4 C3H transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA42496.1| TPA: Splicing factor U2af subunit isoform 1 [Zea mays]
 tpg|DAA42497.1| TPA: Splicing factor U2af subunit isoform 2 [Zea mays]
 tpg|DAA42498.1| TPA: Splicing factor U2af subunit isoform 3 [Zea mays]
 tpg|DAA42499.1| TPA: Splicing factor U2af subunit isoform 4 [Zea mays]
Length=299

 Score =   317 bits (811),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I R+L
Sbjct  121  QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGRDL  180

Query  607  XRHLFGR  627
             R L+GR
Sbjct  181  RRKLYGR  187



>ref|NP_001140674.1| uncharacterized protein LOC100272749 [Zea mays]
 ref|XP_008651068.1| PREDICTED: uncharacterized protein LOC100272749 isoform X1 [Zea 
mays]
 ref|XP_008651069.1| PREDICTED: uncharacterized protein LOC100272749 isoform X1 [Zea 
mays]
 ref|XP_008651070.1| PREDICTED: uncharacterized protein LOC100272749 isoform X1 [Zea 
mays]
 gb|ACF84265.1| unknown [Zea mays]
 gb|ACF84345.1| unknown [Zea mays]
 gb|ACN32158.1| unknown [Zea mays]
 gb|AFT82717.1| C3H40 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 tpg|DAA62057.1| TPA: splicing factor U2af subunit isoform 1 [Zea mays]
 tpg|DAA62058.1| TPA: splicing factor U2af subunit isoform 2 [Zea mays]
 tpg|DAA62059.1| TPA: splicing factor U2af subunit isoform 3 [Zea mays]
 tpg|DAA62060.1| TPA: splicing factor U2af subunit isoform 4 [Zea mays]
 tpg|DAA62061.1| TPA: splicing factor U2af subunit isoform 5 [Zea mays]
 tpg|DAA62062.1| TPA: splicing factor U2af subunit isoform 6 [Zea mays]
 tpg|DAA62063.1| TPA: splicing factor U2af subunit isoform 7 [Zea mays]
 tpg|DAA62064.1| TPA: splicing factor U2af subunit isoform 8 [Zea mays]
Length=287

 Score =   316 bits (810),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPSISPT+LL NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSISPTLLLCNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP ++QE FE+FYED+F ELSK+GEIESL+VCDNLADHM+GNVYV+FREEE
Sbjct  61   GVDAQGNPIDPERIQEDFEDFYEDIFVELSKHGEIESLHVCDNLADHMIGNVYVEFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GR+Y+GRPII +FSPVTDFREATCRQ+EE+SCNRGGYCNFMH+K++ R+L
Sbjct  121  QAARALQALQGRYYSGRPIIAEFSPVTDFREATCRQFEEHSCNRGGYCNFMHVKQVGRDL  180

Query  607  XRHLFGRYHR  636
             R LFG  HR
Sbjct  181  RRKLFGHLHR  190



>ref|XP_002528581.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis]
 gb|EEF33789.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis]
Length=313

 Score =   317 bits (812),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 2/182 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMLTP  60

Query  247  GVD--AQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFRE  420
            GVD  AQ + +DP K+Q+HFE+FY+DLFEELSKYG+IESLN+CDNLADHMVGNVYVQFRE
Sbjct  61   GVDPQAQSQSLDPRKIQDHFEDFYQDLFEELSKYGDIESLNICDNLADHMVGNVYVQFRE  120

Query  421  EEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISR  600
            E+ AANAL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISR
Sbjct  121  EDHAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISR  180

Query  601  EL  606
            EL
Sbjct  181  EL  182



>ref|XP_008654952.1| PREDICTED: splicing factor U2af 38 kDa subunit isoform X1 [Zea 
mays]
 gb|AFW81128.1| splicing factor U2af subunit isoform 1 [Zea mays]
 gb|AFW81129.1| splicing factor U2af subunit isoform 2 [Zea mays]
 gb|AFW81130.1| splicing factor U2af subunit isoform 3 [Zea mays]
 gb|AFW81131.1| splicing factor U2af subunit isoform 4 [Zea mays]
 gb|AFW81132.1| splicing factor U2af subunit isoform 5 [Zea mays]
 gb|AIB05178.1| C3H transcription factor, partial [Zea mays]
Length=304

 Score =   317 bits (811),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I R+L
Sbjct  121  QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGRDL  180

Query  607  XRHLFGR  627
             R L+GR
Sbjct  181  RRKLYGR  187



>ref|NP_001148499.1| splicing factor U2af 38 kDa subunit [Zea mays]
 gb|ACG31738.1| splicing factor U2af 38 kDa subunit [Zea mays]
Length=305

 Score =   317 bits (811),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I R+L
Sbjct  121  QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGRDL  180

Query  607  XRHLFGR  627
             R L+GR
Sbjct  181  RRKLYGR  187



>gb|ACN36304.1| unknown [Zea mays]
Length=276

 Score =   315 bits (808),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPSISPT+LL NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSISPTLLLCNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP ++QE FE+FYED+F ELSK+GEIESL+VCDNLADHM+GNVYV+FREEE
Sbjct  61   GVDAQGNPIDPERIQEDFEDFYEDIFVELSKHGEIESLHVCDNLADHMIGNVYVEFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GR+Y+GRPII +FSPVTDFREATCRQ+EE+SCNRGGYCNFMH+K++ R+L
Sbjct  121  QAARALQALQGRYYSGRPIIAEFSPVTDFREATCRQFEEHSCNRGGYCNFMHVKQVGRDL  180

Query  607  XRHLFGRYHR  636
             R LFG  HR
Sbjct  181  RRKLFGHLHR  190



>ref|XP_004972468.1| PREDICTED: splicing factor U2af small subunit B-like [Setaria 
italica]
Length=306

 Score =   316 bits (810),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV+FSPVTDFREATCRQYEENSCNRGGYCNFMH+K+I ++L
Sbjct  121  QAAAAYNALQGRFYSGRPIIVEFSPVTDFREATCRQYEENSCNRGGYCNFMHVKQIGKDL  180

Query  607  XRHLFGR  627
             R L GR
Sbjct  181  RRKLHGR  187



>ref|XP_004961212.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X1 [Setaria italica]
 ref|XP_004961213.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X2 [Setaria italica]
 ref|XP_004961214.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X3 [Setaria italica]
 gb|AEQ54731.1| SiU2af35 [Setaria italica]
Length=294

 Score =   316 bits (809),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I ++L
Sbjct  121  QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGKDL  180

Query  607  XRHLFGR  627
             R L+GR
Sbjct  181  RRKLYGR  187



>ref|XP_004957211.1| PREDICTED: splicing factor U2af small subunit A-like isoform 
X1 [Setaria italica]
 ref|XP_004957212.1| PREDICTED: splicing factor U2af small subunit A-like isoform 
X2 [Setaria italica]
Length=284

 Score =   315 bits (807),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPSISPT+LL NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSISPTLLLCNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG  IDP ++QE FE+FYED+FEELSK+GEIESL+VCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGNSIDPERIQEDFEDFYEDIFEELSKHGEIESLHVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GR+Y+GRPII +FSPVTDFREATCRQ+EE+SCNRGGYCNFMH+K+I R+L
Sbjct  121  QAARALQALQGRYYSGRPIIAEFSPVTDFREATCRQFEEHSCNRGGYCNFMHVKQIRRDL  180

Query  607  XRHLFGRYHR  636
             R LFG  HR
Sbjct  181  RRKLFGHLHR  190



>gb|EPS71674.1| hypothetical protein M569_03083, partial [Genlisea aurea]
Length=278

 Score =   315 bits (806),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PI+  K+QEHFE+F+ED+FEELSK+GEIESLNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPIEARKIQEHFEDFFEDIFEELSKFGEIESLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL  L GRFY+GRPII DFSPVTDFREATCRQYEE+SCNRGGYCNFMH+K I R+L
Sbjct  121  QAAAALNALRGRFYSGRPIIADFSPVTDFREATCRQYEEDSCNRGGYCNFMHVKMIGRDL  180

Query  607  XRHLFGR  627
             + LFGR
Sbjct  181  RKKLFGR  187



>ref|XP_009417288.1| PREDICTED: LOW QUALITY PROTEIN: splicing factor U2af small subunit 
A-like [Musa acuminata subsp. malaccensis]
Length=210

 Score =   312 bits (799),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PI+P K+QEHFE+FYED+FEEL K+GEIESLNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIEPQKIQEHFEDFYEDIFEELGKFGEIESLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A++ L GRFY+GRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+I    
Sbjct  121  QAAAAMRALQGRFYSGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHVKQIGXGA  180

Query  607  XRHLF  621
                F
Sbjct  181  EEEAF  185



>ref|XP_007050431.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007050432.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma 
cacao]
 gb|EOX94588.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma 
cacao]
 gb|EOX94589.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma 
cacao]
Length=279

 Score =   315 bits (806),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDPHK+QEHFE+FYED+FEELSK+GEIESLNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPHKIQEHFEDFYEDIFEELSKFGEIESLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I REL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQFEENNCNRGGYCNFMHVKVIGREL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRKLFGRY  188



>ref|XP_007202216.1| hypothetical protein PRUPE_ppa008459mg [Prunus persica]
 gb|EMJ03415.1| hypothetical protein PRUPE_ppa008459mg [Prunus persica]
Length=330

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMIT-  243
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDM+T 
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMLTN  60

Query  244  PGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
            PGVD QG+ +DP K+Q++FE+FYEDLFEELSKYG+IESLN+CDNLADHMVGNVYVQFREE
Sbjct  61   PGVDPQGQALDPRKIQDNFEDFYEDLFEELSKYGQIESLNICDNLADHMVGNVYVQFREE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  AL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISRE
Sbjct  121  EHAQAALQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISRE  180

Query  604  L  606
            L
Sbjct  181  L  181



>gb|EEC79701.1| hypothetical protein OsI_20991 [Oryza sativa Indica Group]
Length=308

 Score =   315 bits (807),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P++SPTI+L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTVSPTIVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EELSK+GE+E+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELSKFGEVETLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I REL
Sbjct  121  QAVAAHNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGREL  180

Query  607  XRHLF  621
             R L+
Sbjct  181  RRKLY  185



>ref|XP_008241308.1| PREDICTED: splicing factor U2af small subunit B-like [Prunus 
mume]
Length=329

 Score =   316 bits (809),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMIT-  243
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDM+T 
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMLTN  60

Query  244  PGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
            PGVD QG+ +DP K+Q++FE+FYEDLFEELSKYG+IESLN+CDNLADHMVGNVYVQFREE
Sbjct  61   PGVDPQGQALDPRKIQDNFEDFYEDLFEELSKYGQIESLNICDNLADHMVGNVYVQFREE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  AL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISRE
Sbjct  121  EHAQAALQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISRE  180

Query  604  L  606
            L
Sbjct  181  L  181



>ref|XP_011074052.1| PREDICTED: splicing factor U2af small subunit B [Sesamum indicum]
Length=283

 Score =   314 bits (804),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPAISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED+FEELSK+GEIE+LNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIFEELSKFGEIETLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL  L GRFY+GRPII DFSPVTDFREATCRQYEENSCNRGGYCNFMH+K I REL
Sbjct  121  QAAAALNALQGRFYSGRPIIADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKMIGREL  180

Query  607  XRHLFGRYH  633
             R LFGR+H
Sbjct  181  RRKLFGRHH  189



>ref|XP_006654790.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006654791.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X2 [Oryza brachyantha]
Length=292

 Score =   314 bits (804),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P++SPTI+L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTVSPTIVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EELSK+GE+E+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELSKFGEVETLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I REL
Sbjct  121  QAVAAHNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGREL  180

Query  607  XRHLF  621
             R L+
Sbjct  181  RRKLY  185



>ref|XP_006484974.1| PREDICTED: splicing factor U2af small subunit A-like isoform 
X4 [Citrus sinensis]
Length=313

 Score =   314 bits (805),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 173/186 (93%), Gaps = 7/186 (4%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPS+SPT+LLSNMYQR DMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSVSPTLLLSNMYQRLDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG P+DP K+QEHFE+FYEDLFEEL+KYGEIESLNVCDNLADHM       FREEE
Sbjct  61   GVDAQGNPLDPRKIQEHFEDFYEDLFEELNKYGEIESLNVCDNLADHM-------FREEE  113

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA ALK+LSGRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLKRISR+L
Sbjct  114  QAARALKSLSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISRDL  173

Query  607  XRHLFG  624
             R LFG
Sbjct  174  RRQLFG  179



>ref|NP_001056331.1| Os05g0564200 [Oryza sativa Japonica Group]
 sp|Q6AUG0.1|U2AFB_ORYSJ RecName: Full=Splicing factor U2af small subunit B; AltName: 
Full=U2 auxiliary factor 35 kDa subunit B; AltName: Full=U2 
small nuclear ribonucleoprotein auxiliary factor small subunit 
B; Short=U2 snRNP auxiliary factor small subunit B; AltName: 
Full=Zinc finger CCCH domain-containing protein 38; Short=OsC3H38 
[Oryza sativa Japonica Group]
 gb|AAT77399.1| U2 snRNP auxiliary factor, small subunit [Oryza sativa Japonica 
Group]
 dbj|BAF18245.1| Os05g0564200 [Oryza sativa Japonica Group]
 dbj|BAG91824.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96940.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64700.1| hypothetical protein OsJ_19555 [Oryza sativa Japonica Group]
Length=304

 Score =   313 bits (803),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P++SPTI+L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTVSPTIVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EELSK+GE+E+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELSKFGEVETLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I REL
Sbjct  121  QAVAAHNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGREL  180

Query  607  XRHLF  621
             R L+
Sbjct  181  RRKLY  185



>emb|CAA77132.1| U2 snRNP auxiliary factor, small subunit [Oryza sativa]
Length=301

 Score =   313 bits (803),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P++SPTI+L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTVSPTIVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EELSK+GE+E+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELSKFGEVETLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I REL
Sbjct  121  QAVAAHNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGREL  180

Query  607  XRHLF  621
             R L+
Sbjct  181  RRKLY  185



>gb|KJB22951.1| hypothetical protein B456_004G075300 [Gossypium raimondii]
Length=280

 Score =   311 bits (798),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED+FEELSK+GEIESLNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIFEELSKFGEIESLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEENSCNRGGYCNFMH+K I REL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKVIGREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>ref|XP_010063179.1| PREDICTED: splicing factor U2af small subunit B [Eucalyptus grandis]
 gb|KCW70374.1| hypothetical protein EUGRSUZ_F03613 [Eucalyptus grandis]
Length=281

 Score =   311 bits (798),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED+FEELSK+GEIESLNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIFEELSKFGEIESLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL  L GRFY+GRPII DFSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I REL
Sbjct  121  QAAAALHALQGRFYSGRPIIADFSPVTDFREATCRQFEENNCNRGGYCNFMHVKMIGREL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRRLFGRY  188



>ref|XP_004145565.1| PREDICTED: splicing factor U2af small subunit B-like [Cucumis 
sativus]
 ref|XP_004157064.1| PREDICTED: splicing factor U2af small subunit B-like [Cucumis 
sativus]
 gb|KGN55547.1| hypothetical protein Csa_4G664540 [Cucumis sativus]
Length=276

 Score =   310 bits (794),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED++EEL K+GEIESLNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIYEELGKFGEIESLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K I ++L
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKMIGKDL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRKLFGRY  188



>ref|XP_008453027.1| PREDICTED: splicing factor U2af small subunit B-like [Cucumis 
melo]
Length=276

 Score =   310 bits (794),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED++EEL K+GEIESLNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIYEELGKFGEIESLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K I ++L
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKMIGKDL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRKLFGRY  188



>gb|ADE76244.1| unknown [Picea sitchensis]
Length=290

 Score =   310 bits (795),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +PSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+D QG+ +DP K+QEHFE+F+ED+FEELSK+GEIE+LN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GLDPQGQAMDPRKIQEHFEDFFEDIFEELSKFGEIENLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA ALK + GRFY+GRPIIVDFSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K+I+++L
Sbjct  121  QAAAALKAMQGRFYSGRPIIVDFSPVTDFREATCRQFEENNCNRGGYCNFMHVKKINKDL  180



>ref|XP_010094497.1| Splicing factor U2af small subunit A [Morus notabilis]
 gb|EXB56251.1| Splicing factor U2af small subunit A [Morus notabilis]
Length=348

 Score =   312 bits (800),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDPHK+QEHFE+FYED+FEEL K+GEIESLNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPIDPHKIQEHFEDFYEDIFEELCKFGEIESLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL+ L GRFY GRPII DFSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I R+L
Sbjct  121  HAAAALQALQGRFYNGRPIIADFSPVTDFREATCRQFEENNCNRGGYCNFMHVKLIGRDL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRKLFGRY  188



>ref|XP_002510741.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis]
 gb|EEF52928.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis]
Length=272

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED+FEEL K+GEIESLNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIFEELGKFGEIESLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I R+L
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQFEENNCNRGGYCNFMHVKLIGRDL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRKLFGRY  188



>ref|XP_010530258.1| PREDICTED: splicing factor U2af small subunit A-like [Tarenaya 
hassleriana]
Length=283

 Score =   309 bits (791),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMY RPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYLRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+QEHFE+FYED+FEEL+K+GEIESLNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDPQGQPLDPRKIQEHFEDFYEDIFEELNKFGEIESLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K +SR L
Sbjct  121  QAGAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLVSRGL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|XP_008373338.1| PREDICTED: splicing factor U2af small subunit B-like [Malus domestica]
 ref|XP_008373339.1| PREDICTED: splicing factor U2af small subunit B-like [Malus domestica]
 ref|XP_008373340.1| PREDICTED: splicing factor U2af small subunit B-like [Malus domestica]
 ref|XP_008373341.1| PREDICTED: splicing factor U2af small subunit B-like [Malus domestica]
 ref|XP_008373342.1| PREDICTED: splicing factor U2af small subunit B-like [Malus domestica]
 ref|XP_008373343.1| PREDICTED: splicing factor U2af small subunit B-like [Malus domestica]
Length=290

 Score =   309 bits (791),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD+QG+P+DP K+QEHFE+FYED+FEEL+K+GEIESLNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDSQGQPLDPRKIQEHFEDFYEDIFEELTKFGEIESLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY GRPII DFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K I REL
Sbjct  121  QAAAALQALQGRFYNGRPIIADFSPVTDFREATCRQFEENSCNRGGYCNFMHVKLIGREL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRRLFGRY  188



>ref|XP_008676046.1| PREDICTED: LOW QUALITY PROTEIN: splicing factor U2af small subunit 
B-like [Zea mays]
Length=224

 Score =   306 bits (785),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 176/194 (91%), Gaps = 5/194 (3%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKDRVNCPFYFKIG CRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEYLASIFGTEKDRVNCPFYFKIGVCRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGG CNFMH+K+I R+L
Sbjct  121  QAAVAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGXCNFMHVKQIGRDL  180

Query  607  XRHLFG-----RYH  633
             R L+G     RYH
Sbjct  181  MRKLYGCSASRRYH  194



>gb|KHG11538.1| Splicing factor U2af small subunit A -like protein [Gossypium 
arboreum]
Length=336

 Score =   310 bits (795),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED+FEELSK+GEIESLNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIFEELSKFGEIESLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEENSCNRGGYCNFMH+K I REL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKVIGREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>ref|XP_009372655.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
 ref|XP_009372656.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
 ref|XP_009372657.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
 ref|XP_009372658.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
 ref|XP_009372659.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
 ref|XP_009372660.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
 ref|XP_009372661.1| PREDICTED: splicing factor U2af small subunit B-like [Pyrus x 
bretschneideri]
Length=286

 Score =   308 bits (789),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD+QG+P+DP K+QEHFE+FYED+FEEL+K+GEIESLNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDSQGQPLDPRKIQEHFEDFYEDIFEELTKFGEIESLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY GRPII DFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K I REL
Sbjct  121  QAAAALQALQGRFYNGRPIIADFSPVTDFREATCRQFEENSCNRGGYCNFMHVKLIGREL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRRLFGRY  188



>ref|XP_009777870.1| PREDICTED: splicing factor U2af small subunit B [Nicotiana sylvestris]
Length=276

 Score =   308 bits (788),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHT+P++SPT+LLSNMY RPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTRPTVSPTLLLSNMYHRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GV+ QG+P+DP K+QEHFE+FYED+FEELSK+GEIE+LNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVEPQGQPLDPLKIQEHFEDFYEDIFEELSKFGEIENLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL+ L GRFY+GRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMH+K ISR+L
Sbjct  121  HAAAALQALQGRFYSGRPIIVDFSPVTDFREATCRQYEENDCNRGGYCNFMHVKMISRDL  180

Query  607  XRHLFGRYH  633
             R LFG+YH
Sbjct  181  RRKLFGKYH  189



>ref|XP_002300614.1| hypothetical protein POPTR_0002s00480g [Populus trichocarpa]
 ref|XP_006386121.1| hypothetical protein POPTR_0002s00480g [Populus trichocarpa]
 ref|XP_006386122.1| U2 snRNP auxiliary factor small subunit family protein [Populus 
trichocarpa]
 gb|EEE79887.1| hypothetical protein POPTR_0002s00480g [Populus trichocarpa]
 gb|ERP63918.1| hypothetical protein POPTR_0002s00480g [Populus trichocarpa]
 gb|ERP63919.1| U2 snRNP auxiliary factor small subunit family protein [Populus 
trichocarpa]
Length=273

 Score =   307 bits (787),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DPHK+QEHFEEFYED+FEEL+K+GEIESLNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDAQGQPLDPHKIQEHFEEFYEDIFEELNKFGEIESLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I R+L
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQFEENNCNRGGYCNFMHVKLIGRDL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRKLFGRY  188



>ref|XP_003567899.1| PREDICTED: splicing factor U2af small subunit B [Brachypodium 
distachyon]
 ref|XP_010231023.1| PREDICTED: splicing factor U2af small subunit B [Brachypodium 
distachyon]
 ref|XP_010231024.1| PREDICTED: splicing factor U2af small subunit B [Brachypodium 
distachyon]
 ref|XP_010231025.1| PREDICTED: splicing factor U2af small subunit B [Brachypodium 
distachyon]
 ref|XP_010231026.1| PREDICTED: splicing factor U2af small subunit B [Brachypodium 
distachyon]
Length=308

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ SPTI+L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTTSPTIVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG  IDP KMQEHFE+FYED++EELSK+GE+E+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGHTIDPEKMQEHFEDFYEDIYEELSKFGEVETLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I REL
Sbjct  121  QAVAAHNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGREL  180

Query  607  XRHLF  621
             R L+
Sbjct  181  RRKLY  185



>ref|XP_003569529.1| PREDICTED: splicing factor U2af small subunit B-like [Brachypodium 
distachyon]
 ref|XP_010232117.1| PREDICTED: splicing factor U2af small subunit B-like [Brachypodium 
distachyon]
 ref|XP_010232118.1| PREDICTED: splicing factor U2af small subunit B-like [Brachypodium 
distachyon]
 ref|XP_010232119.1| PREDICTED: splicing factor U2af small subunit B-like [Brachypodium 
distachyon]
 ref|XP_010232120.1| PREDICTED: splicing factor U2af small subunit B-like [Brachypodium 
distachyon]
Length=281

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSR+H +P+ISPTI+L NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRIHNRPTISPTIVLMNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED+FEELSK+GEIE+LNVCDNL+DHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKMQEHFEDFYEDIFEELSKFGEIETLNVCDNLSDHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GR IIVDFSPVTDFREATCRQYEEN+C RGG+CNFMH+K+I ++L
Sbjct  121  QAAAAHTALQGRFYSGRLIIVDFSPVTDFREATCRQYEENTCTRGGHCNFMHVKQIGKDL  180

Query  607  XRHLFG  624
             + LFG
Sbjct  181  RKKLFG  186



>gb|KJB25970.1| hypothetical protein B456_004G218700 [Gossypium raimondii]
Length=279

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+PIDP K+QEHFE+FYED++EELSK+GEIESLNVCDNLADHM+GNVY QFREE+
Sbjct  61   GVDPQGQPIDPRKIQEHFEDFYEDIYEELSKFGEIESLNVCDNLADHMIGNVYAQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K I R+L
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKVIGRDL  180

Query  607  XRHLFGRYHR  636
             R LFG Y +
Sbjct  181  RRKLFGSYRK  190



>ref|XP_008787015.1| PREDICTED: splicing factor U2af small subunit B-like [Phoenix 
dactylifera]
Length=275

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+DAQG+PIDP ++QEHFE+FYED+FEEL+K+GEIESLNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GIDAQGQPIDPRRIQEHFEDFYEDIFEELNKFGEIESLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPIIVDFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K+ISREL
Sbjct  121  QAAAALRALQGRFYSGRPIIVDFSPVTDFREATCRQFEENSCNRGGYCNFMHVKQISREL  180

Query  607  XRHLFGRYH  633
             R LFGRY 
Sbjct  181  RRRLFGRYQ  189



>ref|XP_011034775.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
 ref|XP_011034776.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
 ref|XP_011034777.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
 ref|XP_011034778.1| PREDICTED: splicing factor U2af small subunit B-like [Populus 
euphratica]
Length=275

 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DPHK+QEHFEEFYED+FEEL+K+GEIESLNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDAQGQPLDPHKIQEHFEEFYEDIFEELNKFGEIESLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I R+L
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQFEENNCNRGGYCNFMHVKLIGRDL  180

Query  607  XRHLFGRY  630
             R LFGRY
Sbjct  181  RRKLFGRY  188



>ref|XP_010940634.1| PREDICTED: splicing factor U2af small subunit B-like [Elaeis 
guineensis]
 ref|XP_010940642.1| PREDICTED: splicing factor U2af small subunit B-like [Elaeis 
guineensis]
 ref|XP_010940649.1| PREDICTED: splicing factor U2af small subunit B-like [Elaeis 
guineensis]
 ref|XP_010940656.1| PREDICTED: splicing factor U2af small subunit B-like [Elaeis 
guineensis]
Length=310

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 174/187 (93%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHT+PSISPT+LLSNMYQRPDM+ P
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTRPSISPTLLLSNMYQRPDMLAP  60

Query  247  GVDAQGRP-IDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
                  +P +DP K+Q HFE+FYEDLF+ELSKYG+IESLNVCDNLADHMVGNVYVQFREE
Sbjct  61   PGPQAQQPPMDPRKIQHHFEDFYEDLFQELSKYGDIESLNVCDNLADHMVGNVYVQFREE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E AANAL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+ISRE
Sbjct  121  EHAANALQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKISRE  180

Query  604  LXRHLFG  624
            L R LFG
Sbjct  181  LRRQLFG  187



>dbj|BAK02393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSR+H +P+ISPTI+L NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRIHNRPTISPTIVLMNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED+FEELSK+GEIE+LNVCDNL+DHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKMQEHFEDFYEDIFEELSKFGEIETLNVCDNLSDHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GR IIVDFSPVTDFREATCRQYEEN+C RGG+CNFMH+K+I ++L
Sbjct  121  QAAAAHTALQGRFYSGRLIIVDFSPVTDFREATCRQYEENTCTRGGHCNFMHVKQIGKDL  180

Query  607  XRHLFG  624
             + LFG
Sbjct  181  RKKLFG  186



>ref|XP_004303034.1| PREDICTED: splicing factor U2af small subunit B-like [Fragaria 
vesca subsp. vesca]
Length=321

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 172/181 (95%), Gaps = 2/181 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMIT-  243
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDM+T 
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMLTN  60

Query  244  PGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
            PGVD QG+ +DP K+Q++FE+FYEDLFEELSKYG+IESLN+CDNLADH  GNVYVQFREE
Sbjct  61   PGVDPQGQALDPRKIQDNFEDFYEDLFEELSKYGQIESLNICDNLADH-YGNVYVQFREE  119

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E AA AL+NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+ISRE
Sbjct  120  EHAAAALQNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISRE  179

Query  604  L  606
            L
Sbjct  180  L  180



>emb|CDM83632.1| unnamed protein product [Triticum aestivum]
Length=281

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSR+H +P+ISPTI+L NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRIHNRPTISPTIVLMNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED+FEELSK+GEIE+LNVCDNL+DHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKMQEHFEDFYEDIFEELSKFGEIETLNVCDNLSDHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GR IIVDFSPVTDFREATCRQYEEN+C RGG+CNFMH+K+I ++L
Sbjct  121  QAAAAHTALQGRFYSGRLIIVDFSPVTDFREATCRQYEENTCTRGGHCNFMHVKQIGKDL  180

Query  607  XRHLFG  624
             + LFG
Sbjct  181  RKKLFG  186



>gb|EMS52749.1| Splicing factor U2af small subunit A [Triticum urartu]
Length=287

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSR+H +P+ISPTI+L NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRIHNRPTISPTIVLMNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED+FEELSK+GEIE+LNVCDNL+DHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKMQEHFEDFYEDIFEELSKFGEIETLNVCDNLSDHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GR IIVDFSPVTDFREATCRQYEEN+C RGG+CNFMH+K+I ++L
Sbjct  121  QAAAAHTALQGRFYSGRLIIVDFSPVTDFREATCRQYEENTCTRGGHCNFMHVKQIGKDL  180

Query  607  XRHLFG  624
             + LFG
Sbjct  181  RKKLFG  186



>gb|EMS57689.1| Splicing factor U2af small subunit A [Triticum urartu]
Length=315

 Score =   307 bits (787),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPS+SPT+LL NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSVSPTLLLCNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+Q  FE+FYED+F+ELSK+GE+E+L+VCDNLADH++GNVYVQFREE+
Sbjct  61   GVDAQGNPIDPVKIQGDFEDFYEDIFDELSKHGEVENLHVCDNLADHLIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII +FSPVTDFREATCRQ+EE++CNRGGYCNFMH+K I R+L
Sbjct  121  QAAKALQALQGRFYSGRPIIAEFSPVTDFREATCRQFEEHNCNRGGYCNFMHVKEIGRDL  180

Query  607  XRHLFG  624
             + L+G
Sbjct  181  RKRLYG  186



>gb|AAY84879.1| U2AF small subunit [Triticum aestivum]
Length=314

 Score =   307 bits (787),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPS+SPT+LL NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSVSPTLLLCNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+Q  FE+FYED+F+ELSK+GE+E+L+VCDNLADH++GNVYVQFREE+
Sbjct  61   GVDAQGNPIDPVKIQGDFEDFYEDIFDELSKHGEVENLHVCDNLADHLIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII +FSPVTDFREATCRQ+EE++CNRGGYCNFMH+K I R+L
Sbjct  121  QAAKALQALQGRFYSGRPIIAEFSPVTDFREATCRQFEEHNCNRGGYCNFMHVKEIGRDL  180

Query  607  XRHLFG  624
             + L+G
Sbjct  181  RKRLYG  186



>gb|EMT12018.1| Splicing factor U2af small subunit A [Aegilops tauschii]
Length=312

 Score =   307 bits (786),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPS+SPT+LL NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSVSPTLLLCNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+Q  FE+FYED+F+ELSK+GE+E+L+VCDNLADH++GNVYVQFREE+
Sbjct  61   GVDAQGNPIDPVKIQGDFEDFYEDIFDELSKHGEVENLHVCDNLADHLIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII +FSPVTDFREATCRQ+EE++CNRGGYCNFMH+K I R+L
Sbjct  121  QAAKALQALQGRFYSGRPIIAEFSPVTDFREATCRQFEEHNCNRGGYCNFMHVKEIGRDL  180

Query  607  XRHLFG  624
             + L+G
Sbjct  181  RKRLYG  186



>gb|EMS51947.1| Splicing factor U2af small subunit B [Triticum urartu]
Length=267

 Score =   305 bits (782),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ SPTI+L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTTSPTIVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG  I P KMQEHFE+FYED++EELSK+GE+E+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGVAIAPEKMQEHFEDFYEDIYEELSKFGEVETLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I REL
Sbjct  121  QAVAAHNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGREL  180

Query  607  XRHLF  621
             R L+
Sbjct  181  RRKLY  185



>ref|XP_003589690.1| Splicing factor U2af small subunit B [Medicago truncatula]
Length=272

 Score =   305 bits (782),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPD+ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDIITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G+PIDP ++Q+HFE+FYED+F ELSK+G +E+LNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDPNGQPIDPRQIQQHFEDFYEDIFTELSKFGYVETLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL +L GRFY GRPI+ DFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+I REL
Sbjct  121  HAAAALASLRGRFYEGRPILADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKKIGREL  180

Query  607  XRHLFGRYHR  636
             R LF    R
Sbjct  181  RRKLFSSQRR  190



>ref|XP_010932132.1| PREDICTED: splicing factor U2af small subunit B-like [Elaeis 
guineensis]
Length=275

 Score =   305 bits (782),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMIT 
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITT  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+DAQG+PIDP K+QEHFE+FYED+FEELSK+GEIESLNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GIDAQGQPIDPRKIQEHFEDFYEDIFEELSKFGEIESLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPIIVDFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K+ISREL
Sbjct  121  QAAAALRALQGRFYSGRPIIVDFSPVTDFREATCRQFEENSCNRGGYCNFMHVKQISREL  180

Query  607  XRHLFGRYHR  636
             R LFG Y R
Sbjct  181  RRKLFGHYRR  190



>ref|NP_199096.1| Splicing factor U2af small subunit B [Arabidopsis thaliana]
 ref|NP_974870.1| Splicing factor U2af small subunit B [Arabidopsis thaliana]
 sp|Q9FMY5.1|U2AFB_ARATH RecName: Full=Splicing factor U2af small subunit B; AltName: 
Full=U2 auxiliary factor 35 kDa subunit B; AltName: Full=U2 
small nuclear ribonucleoprotein auxiliary factor small subunit 
B; Short=U2 snRNP auxiliary factor small subunit B; AltName: 
Full=Zinc finger CCCH domain-containing protein 60; Short=AtC3H60 
[Arabidopsis thaliana]
 dbj|BAB10638.1| U2 snRNP auxiliary factor, small subunit [Arabidopsis thaliana]
 gb|AAM97101.1| U2 snRNP auxiliary factor small subunit [Arabidopsis thaliana]
 gb|AAN15538.1| U2 snRNP auxiliary factor small subunit [Arabidopsis thaliana]
 gb|AED94868.1| Splicing factor U2af small subunit B [Arabidopsis thaliana]
 gb|AED94869.1| Splicing factor U2af small subunit B [Arabidopsis thaliana]
Length=283

 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q+HFE+FYED+FEEL+K+GE+ESLNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDPQGQPLDPSKIQDHFEDFYEDIFEELNKFGEVESLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+ISREL
Sbjct  121  HAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKQISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>ref|XP_004300085.1| PREDICTED: splicing factor U2af small subunit B [Fragaria vesca 
subsp. vesca]
 ref|XP_011465001.1| PREDICTED: splicing factor U2af small subunit B [Fragaria vesca 
subsp. vesca]
Length=280

 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q+HFE+FYED+FEEL K+GEIESLNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDPQGQPLDPRKIQDHFEDFYEDIFEELDKFGEIESLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY GRPII DFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K I REL
Sbjct  121  QAAAALQALQGRFYNGRPIIADFSPVTDFREATCRQFEENSCNRGGYCNFMHVKLIGREL  180

Query  607  XRHLFGRY  630
             R L+GRY
Sbjct  181  RRKLYGRY  188



>ref|XP_002863733.1| hypothetical protein ARALYDRAFT_494737 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39992.1| hypothetical protein ARALYDRAFT_494737 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q+HFE+FYED+FEEL+K+GE+ESLNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDPQGQPLDPSKIQDHFEDFYEDIFEELNKFGEVESLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+ISREL
Sbjct  121  HAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKQISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>dbj|BAJ89126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   306 bits (783),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPS+SPT+LL NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSVSPTLLLCNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PI+P K+Q  FE+FYED+F+ELSK+GE+E+L+VCDNLADH++GNVYVQFREE+
Sbjct  61   GVDAQGNPINPVKIQGDFEDFYEDIFDELSKHGEVENLHVCDNLADHLIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII +FSPVTDFREATCRQ+EE++CNRGGYCNFMH+K+I R+L
Sbjct  121  QAAKALQALQGRFYSGRPIIAEFSPVTDFREATCRQFEEHNCNRGGYCNFMHVKQIGRDL  180

Query  607  XRHLFG  624
             + L+G
Sbjct  181  RKRLYG  186



>gb|ACJ84869.1| unknown [Medicago truncatula]
Length=228

 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPD+ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDIITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G+PIDP ++Q+HFE+FYED+F ELSK+G +E+LNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDPNGQPIDPRQIQQHFEDFYEDIFTELSKFGYVETLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL +L GRFY GRPI+ DFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+I REL
Sbjct  121  HAAAALASLRGRFYEGRPILADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKKIGREL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|XP_008807516.1| PREDICTED: splicing factor U2af small subunit B-like [Phoenix 
dactylifera]
 ref|XP_008807517.1| PREDICTED: splicing factor U2af small subunit B-like [Phoenix 
dactylifera]
 ref|XP_008807518.1| PREDICTED: splicing factor U2af small subunit B-like [Phoenix 
dactylifera]
 ref|XP_008807519.1| PREDICTED: splicing factor U2af small subunit B-like [Phoenix 
dactylifera]
Length=310

 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 173/187 (93%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHT+PSISPT+LLSNMYQRPDM+ P
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTRPSISPTLLLSNMYQRPDMLAP  60

Query  247  GVDAQGRP-IDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
                  +P +DP K+Q HFEEFYEDLF+ELSKYG+IESLNVCDNLADHMVGNVYVQFREE
Sbjct  61   PGPQAQQPPMDPRKVQHHFEEFYEDLFQELSKYGDIESLNVCDNLADHMVGNVYVQFREE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E AA+AL NL+GRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+ISRE
Sbjct  121  EHAASALHNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKISRE  180

Query  604  LXRHLFG  624
            L R LFG
Sbjct  181  LRRQLFG  187



>ref|XP_003554416.1| PREDICTED: splicing factor U2af small subunit B-like [Glycine 
max]
 gb|KHN02261.1| Splicing factor U2af small subunit B [Glycine soja]
Length=314

 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 174/194 (90%), Gaps = 4/194 (2%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM---  237
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPT++LSNMYQRPDM   
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTLVLSNMYQRPDMNMN  60

Query  238  -ITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQF  414
             IT     Q + +DP K+Q+HF++FYEDLFEELSKYG I+SLN+CDNLADHMVGNVYVQF
Sbjct  61   IITNPDQPQPQSLDPDKVQDHFDDFYEDLFEELSKYGPIQSLNICDNLADHMVGNVYVQF  120

Query  415  REEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRI  594
            REE+ AANAL NL+GRFY+GRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+I
Sbjct  121  REEDHAANALMNLTGRFYSGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKI  180

Query  595  SRELXRHLFGRYHR  636
            SR+L R LFGR  R
Sbjct  181  SRDLRRKLFGRNRR  194



>ref|NP_174086.1| splicing factor U2af small subunit A [Arabidopsis thaliana]
 sp|Q9S709.1|U2AFA_ARATH RecName: Full=Splicing factor U2af small subunit A; AltName: 
Full=U2 auxiliary factor 35 kDa subunit A; AltName: Full=U2 
small nuclear ribonucleoprotein auxiliary factor small subunit 
A; Short=U2 snRNP auxiliary factor small subunit A; AltName: 
Full=Zinc finger CCCH domain-containing protein 8; Short=AtC3H8 
[Arabidopsis thaliana]
 gb|AAD46002.1|AC005916_14 Strong similarity to gb|Y18349 U2 snRNP auxiliary factor, small 
subunit from Oryza sativa. ESTs gb|AA586295 and gb|AA597332 
come from this gene [Arabidopsis thaliana]
 gb|AAF24943.1|AC012375_6 T22C5.10 [Arabidopsis thaliana]
 gb|AAK06875.1|AF344324_1 putative U2 snRNP auxiliary factor [Arabidopsis thaliana]
 gb|AAL38678.1| putative U2 snRNP auxiliary factor [Arabidopsis thaliana]
 gb|AAL91249.1| At1g27650/T22C5_2 [Arabidopsis thaliana]
 gb|AAM20157.1| putative U2 snRNP auxiliary factor protein [Arabidopsis thaliana]
 gb|AAM66073.1| putative U2 snRNP auxiliary factor [Arabidopsis thaliana]
 gb|AAM67427.1| At1g27650/T22C5_2 [Arabidopsis thaliana]
 gb|AEE30858.1| splicing factor U2af small subunit A [Arabidopsis thaliana]
Length=296

 Score =   305 bits (781),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+F+EDLFEEL K+GEIESLN+CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFFEDLFEELGKFGEIESLNICDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K +SREL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLVSREL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|XP_003521439.1| PREDICTED: splicing factor U2af small subunit B-like [Glycine 
max]
Length=314

 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 174/194 (90%), Gaps = 4/194 (2%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM---  237
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPT++LSNMYQRPDM   
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTLVLSNMYQRPDMNMS  60

Query  238  -ITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQF  414
             IT     Q + +DP K+Q+HF++FYEDLFEELSKYG I+SLN+CDNLADHMVGNVYVQF
Sbjct  61   IITNPDQPQPQSLDPDKVQDHFDDFYEDLFEELSKYGPIQSLNICDNLADHMVGNVYVQF  120

Query  415  REEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRI  594
            REE+ AANAL NL+GRFY+GRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+I
Sbjct  121  REEDHAANALMNLTGRFYSGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKI  180

Query  595  SRELXRHLFGRYHR  636
            SR+L R LFGR  R
Sbjct  181  SRDLRRKLFGRNRR  194



>gb|EMT17994.1| Splicing factor U2af small subunit B [Aegilops tauschii]
Length=302

 Score =   305 bits (781),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ SPTI+L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTTSPTIVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG  I P KMQEHFE+FYED++EELSK+GE+E+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGVAIAPEKMQEHFEDFYEDIYEELSKFGEVETLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I REL
Sbjct  121  QAVAAHNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGREL  180

Query  607  XRHLF  621
             R L+
Sbjct  181  RRKLY  185



>gb|KHN18727.1| Splicing factor U2af small subunit B [Glycine soja]
Length=314

 Score =   305 bits (782),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 174/194 (90%), Gaps = 4/194 (2%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM---  237
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPT++LSNMYQRPDM   
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTLVLSNMYQRPDMNMN  60

Query  238  -ITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQF  414
             IT     Q + +DP K+Q+HF++FYEDLFEELSKYG I+SLN+CDNLADHMVGNVYVQF
Sbjct  61   IITNPDQPQPQSLDPDKVQDHFDDFYEDLFEELSKYGPIQSLNICDNLADHMVGNVYVQF  120

Query  415  REEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRI  594
            REE+ AANAL NL+GRFY+GRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+I
Sbjct  121  REEDHAANALMNLTGRFYSGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKI  180

Query  595  SRELXRHLFGRYHR  636
            SR+L R LFGR  R
Sbjct  181  SRDLRRKLFGRNRR  194



>ref|XP_006415744.1| hypothetical protein EUTSA_v10008280mg [Eutrema salsugineum]
 gb|ESQ34097.1| hypothetical protein EUTSA_v10008280mg [Eutrema salsugineum]
Length=308

 Score =   305 bits (781),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+F+EDLFEEL K+GEIESLN+CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFFEDLFEELGKFGEIESLNICDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K +SREL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLVSREL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>dbj|BAJ34257.1| unnamed protein product [Thellungiella halophila]
Length=308

 Score =   305 bits (781),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+F+EDLFEEL K+GEIESLN+CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFFEDLFEELGKFGEIESLNICDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K +SREL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLVSREL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|XP_010683631.1| PREDICTED: splicing factor U2af small subunit A-like [Beta vulgaris 
subsp. vulgaris]
Length=270

 Score =   303 bits (777),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PI P  +Q HFE+FYED+FEEL K+GEIE+LNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPISPRTLQSHFEDFYEDIFEELGKFGEIETLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL  L GRFY+GRPII DFSPVTDFREATCRQ+EE SCNRGGYCNFMH+K I REL
Sbjct  121  QAAAALGALQGRFYSGRPIIADFSPVTDFREATCRQFEEESCNRGGYCNFMHVKMIGREL  180

Query  607  XRHLFGRYH  633
             R LFG++H
Sbjct  181  RRQLFGKFH  189



>ref|XP_002890741.1| hypothetical protein ARALYDRAFT_472969 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67000.1| hypothetical protein ARALYDRAFT_472969 [Arabidopsis lyrata subsp. 
lyrata]
Length=296

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+F+EDLFEEL K+GEIESLN+CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFFEDLFEELGKFGEIESLNICDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K +SREL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLVSREL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|XP_010539033.1| PREDICTED: splicing factor U2af small subunit A [Tarenaya hassleriana]
Length=290

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASI+GTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIYGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+FYED+FEEL+K+GEIESLNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFYEDIFEELNKFGEIESLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A++ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K +SREL
Sbjct  121  QAAAAVQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLVSREL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|XP_007162850.1| hypothetical protein PHAVU_001G186200g [Phaseolus vulgaris]
 gb|ESW34844.1| hypothetical protein PHAVU_001G186200g [Phaseolus vulgaris]
Length=315

 Score =   305 bits (781),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 174/194 (90%), Gaps = 4/194 (2%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM---  237
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPT++LSNMYQRPDM   
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTLVLSNMYQRPDMNMN  60

Query  238  -ITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQF  414
             IT     Q + +DP K+Q+HF++FYEDLFEELSKYG I+SLN+CDNLADHMVGNVYVQF
Sbjct  61   IITNPNQPQPQSLDPDKVQDHFDDFYEDLFEELSKYGPIQSLNICDNLADHMVGNVYVQF  120

Query  415  REEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRI  594
            REE+ AANAL NL+GRFY+GRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNFMHLK+I
Sbjct  121  REEDHAANALMNLTGRFYSGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKI  180

Query  595  SRELXRHLFGRYHR  636
            SR+L R LFGR  R
Sbjct  181  SRDLRRKLFGRNRR  194



>ref|XP_006305464.1| hypothetical protein CARUB_v10009885mg [Capsella rubella]
 gb|EOA38362.1| hypothetical protein CARUB_v10009885mg [Capsella rubella]
Length=296

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+F+EDLFEEL K+GEIESLN+CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFFEDLFEELGKFGEIESLNICDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K +SREL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLVSREL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>emb|CDP07247.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+PIDP K+QEHFE+FYED+FEEL K+GEIESLNVCDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDPQGQPIDPRKIQEHFEDFYEDIFEELGKFGEIESLNVCDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL+ L GRFY+GRPII DFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K I R+L
Sbjct  121  HAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQFEENSCNRGGYCNFMHVKMIGRDL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>gb|EMT13818.1| Splicing factor U2af small subunit A [Aegilops tauschii]
Length=366

 Score =   306 bits (785),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSR+H +P+ISPTI+L NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRIHNRPTISPTIVLMNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED+FEELSK+GEIE+LNVCDNL+DHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRKMQEHFEDFYEDIFEELSKFGEIETLNVCDNLSDHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GR IIVDFSPVTDFREATCRQYEEN+C RGG+CNFMH+K+I ++L
Sbjct  121  QAAAAHTALQGRFYSGRLIIVDFSPVTDFREATCRQYEENTCTRGGHCNFMHVKQIGKDL  180

Query  607  XRHLFG  624
             + LFG
Sbjct  181  RKKLFG  186



>ref|XP_003576685.1| PREDICTED: splicing factor U2af small subunit A-like [Brachypodium 
distachyon]
 ref|XP_010238304.1| PREDICTED: splicing factor U2af small subunit A-like [Brachypodium 
distachyon]
Length=295

 Score =   304 bits (778),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPS+SPT+LL NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSVSPTLLLCNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+Q  FE+FYED+F+ELSK+G +ESL+VCDNLADH++GNVYVQFREE+
Sbjct  61   GVDAQGNPIDPVKIQGDFEDFYEDIFDELSKHGVVESLHVCDNLADHLIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII +FSPVTDFREATCRQ+EE++CNRGGYCNFMH+K I R+L
Sbjct  121  QAARALQALQGRFYSGRPIIAEFSPVTDFREATCRQFEEHNCNRGGYCNFMHVKEIGRDL  180

Query  607  XRHLFG  624
             + L+G
Sbjct  181  RKRLYG  186



>gb|AES59941.2| splicing factor U2af small subunit A-like protein [Medicago truncatula]
Length=279

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPD+ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDIITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G+PIDP ++Q+HFE+FYED+F ELSK+G +E+LNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDPNGQPIDPRQIQQHFEDFYEDIFTELSKFGYVETLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL +L GRFY GRPI+ DFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+I REL
Sbjct  121  HAAAALASLRGRFYEGRPILADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKKIGREL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>dbj|BAJ88434.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   304 bits (779),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ SPTI+L+NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTTSPTIVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG  I P KMQEHFE+FYED++EELSK+GE+E+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGVAIAPEKMQEHFEDFYEDIYEELSKFGEVETLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGGYCNFMH+K+I REL
Sbjct  121  QAVAAHNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGREL  180

Query  607  XRHLF  621
             R L+
Sbjct  181  RRKLY  185



>ref|XP_010499248.1| PREDICTED: splicing factor U2af small subunit A isoform X1 [Camelina 
sativa]
 ref|XP_010460520.1| PREDICTED: splicing factor U2af small subunit A [Camelina sativa]
 ref|XP_010460521.1| PREDICTED: splicing factor U2af small subunit A [Camelina sativa]
 ref|XP_010478108.1| PREDICTED: splicing factor U2af small subunit A [Camelina sativa]
Length=299

 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+F+EDLFEEL K+GEIESLN+CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFFEDLFEELGKFGEIESLNICDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K +SREL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLVSREL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|NP_001043811.2| Os01g0667800 [Oryza sativa Japonica Group]
 dbj|BAF05725.2| Os01g0667800 [Oryza sativa Japonica Group]
Length=207

 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKD+VNCPFYFKIGACRHGDRCS LH +P+ISPT++ +NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDKVNCPFYFKIGACRHGDRCSCLHNRPTISPTVVFANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP +MQEHFE+FYED+FEELSK+GEIE+LNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRQMQEHFEDFYEDIFEELSKFGEIENLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRI  594
            QAA A   L GRFY+GRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNF H+K+I
Sbjct  121  QAAAAHTALQGRFYSGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFTHVKQI  176



>ref|XP_006403342.1| hypothetical protein EUTSA_v10003254mg [Eutrema salsugineum]
 gb|ESQ44795.1| hypothetical protein EUTSA_v10003254mg [Eutrema salsugineum]
Length=282

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q+HFE+FYED+FEEL K+GE+ESLNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDPQGQPLDPSKIQDHFEDFYEDIFEELDKFGEVESLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEE++CNRGGYCNFMH+K+ISREL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEEDNCNRGGYCNFMHVKQISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>emb|CDX95151.1| BnaC09g17190D [Brassica napus]
Length=281

 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q HFE+FYED+FEEL K+GE+ESLNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDPQGQPLDPSKIQAHFEDFYEDIFEELDKFGEMESLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA ALK L GRFY+GRPII DFSPVTDFREATCRQYEE++CNRGGYCNFMH+K+ISREL
Sbjct  121  QAAAALKALQGRFYSGRPIIADFSPVTDFREATCRQYEEDNCNRGGYCNFMHVKQISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>ref|XP_009114033.1| PREDICTED: splicing factor U2af small subunit B [Brassica rapa]
Length=291

 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q HFE+FYED+FEEL K+GE+ESLNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDPQGQPLDPSKIQAHFEDFYEDIFEELDKFGEMESLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA ALK L GRFY+GRPII DFSPVTDFREATCRQYEE++CNRGGYCNFMH+K+ISREL
Sbjct  121  QAAAALKALQGRFYSGRPIIADFSPVTDFREATCRQYEEDNCNRGGYCNFMHVKQISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>emb|CDY52374.1| BnaA09g15730D [Brassica napus]
Length=286

 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q HFE+FYED+FEEL K+GE+ESLNVCDNLADHM+GNVYV F+EE+
Sbjct  61   GVDPQGQPLDPSKIQAHFEDFYEDIFEELDKFGEMESLNVCDNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA ALK L GRFY+GRPII DFSPVTDFREATCRQYEE++CNRGGYCNFMH+K+ISREL
Sbjct  121  QAAAALKALQGRFYSGRPIIADFSPVTDFREATCRQYEEDNCNRGGYCNFMHVKQISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>ref|XP_010503128.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X2 [Camelina sativa]
Length=310

 Score =   301 bits (772),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 167/188 (89%), Gaps = 7/188 (4%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G PI+P KMQ+HFEEFYEDLFEEL+KYGEIESLN+CDN++DH+       FREEE
Sbjct  61   GVDVYGNPIEPRKMQQHFEEFYEDLFEELNKYGEIESLNICDNISDHL-------FREEE  113

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QA  AL+NL GRFYAGRPIIVDFSPVTDFREATCRQYEE +C RGGYCNFMHLK IS  L
Sbjct  114  QAGKALRNLQGRFYAGRPIIVDFSPVTDFREATCRQYEEETCKRGGYCNFMHLKSISSGL  173

Query  607  XRHLFGRY  630
             R L+GRY
Sbjct  174  RRQLYGRY  181



>gb|KDP36729.1| hypothetical protein JCGZ_08020 [Jatropha curcas]
Length=280

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED+FEELSK+GEIESLNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIFEELSKFGEIESLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I R+L
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQFEENNCNRGGYCNFMHVKLIGRDL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>gb|AAL06331.1|AF409139_1 U2 auxiliary factor small subunit [Arabidopsis thaliana]
Length=296

 Score =   299 bits (766),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+F+EDLFEEL K+GEIESLN+CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFFEDLFEELGKFGEIESLNICDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+C RGGYCNFMH+K +SREL
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCYRGGYCNFMHVKLVSREL  180

Query  607  XRHL  618
             R L
Sbjct  181  RRKL  184



>ref|XP_004498197.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498198.1| PREDICTED: splicing factor U2af small subunit B-like isoform 
X2 [Cicer arietinum]
Length=278

 Score =   298 bits (762),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPD+ITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDIITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD  G+PIDP ++Q+HFE+FYED+F ELSK+G IE+LNVCDNLADHM+GNVYV FREE+
Sbjct  61   GVDPNGQPIDPRQIQQHFEDFYEDIFLELSKFGYIETLNVCDNLADHMIGNVYVLFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL +L GRFY+GRPI+ DFSPVTDFREATCRQYEENSCNRGGYCNFMH+K+I REL
Sbjct  121  HAAAALASLHGRFYSGRPILADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKKIGREL  180

Query  607  XRHLFG  624
             R LF 
Sbjct  181  RRKLFA  186



>gb|AAL06332.1|AF409140_1 U2 auxiliary factor small subunit [Arabidopsis thaliana]
Length=283

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q+HFE+FYED+FEEL+K+GE+ESLNVC NLADHM+GNVYV F+EE+
Sbjct  61   GVDPQGQPLDPSKIQDHFEDFYEDIFEELNKFGEVESLNVCVNLADHMIGNVYVLFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEENSCNRGG CNFMH+K+ISREL
Sbjct  121  HAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENSCNRGGCCNFMHVKQISREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>ref|XP_006435479.1| hypothetical protein CICLE_v10003384mg [Citrus clementina]
 gb|ESR48719.1| hypothetical protein CICLE_v10003384mg [Citrus clementina]
 gb|KDO85273.1| hypothetical protein CISIN_1g040106mg [Citrus sinensis]
Length=324

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  61   VSMAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMI  240
            ++MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMI
Sbjct  57   LAMAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMI  116

Query  241  TPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFRE  420
            TPGVDAQG+PIDP K+QEHFE+FYED+FEELSK+GEIE LNVCDNLADHM+GNVYVQFRE
Sbjct  117  TPGVDAQGQPIDPRKIQEHFEDFYEDIFEELSKFGEIECLNVCDNLADHMIGNVYVQFRE  176

Query  421  EEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISR  600
            EEQAA AL  L GRFY+GRPIIV+FSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I R
Sbjct  177  EEQAAAALHALQGRFYSGRPIIVEFSPVTDFREATCRQFEENNCNRGGYCNFMHVKLIGR  236

Query  601  ELXRHLFG  624
            +L   LFG
Sbjct  237  DLRNKLFG  244



>ref|XP_002961487.1| hypothetical protein SELMODRAFT_230014 [Selaginella moellendorffii]
 gb|EFJ36747.1| hypothetical protein SELMODRAFT_230014 [Selaginella moellendorffii]
Length=200

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KP+ISPT+LLSNMYQRPDM TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPTISPTLLLSNMYQRPDMATP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+D  G+ +D  K+QEHFE+FYED+FEELSKYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GMDLNGQTMDQKKIQEHFEDFYEDMFEELSKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRI  594
            +AA ALK LSGRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMHL+RI
Sbjct  121  EAAAALKALSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLRRI  176



>ref|XP_006495305.1| PREDICTED: splicing factor U2af small subunit A-like [Citrus 
sinensis]
Length=266

 Score =   295 bits (756),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED+FEELSK+GEIE LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIFEELSKFGEIECLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL  L GRFY+GRPIIV+FSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I R+L
Sbjct  121  QAAAALHALQGRFYSGRPIIVEFSPVTDFREATCRQFEENNCNRGGYCNFMHVKLIGRDL  180

Query  607  XRHLFG  624
               LFG
Sbjct  181  RNKLFG  186



>ref|XP_003634337.1| PREDICTED: splicing factor U2af small subunit B [Vitis vinifera]
 ref|XP_010664026.1| PREDICTED: splicing factor U2af small subunit B [Vitis vinifera]
 ref|XP_010664027.1| PREDICTED: splicing factor U2af small subunit B [Vitis vinifera]
 ref|XP_010664028.1| PREDICTED: splicing factor U2af small subunit B [Vitis vinifera]
 ref|XP_010664029.1| PREDICTED: splicing factor U2af small subunit B [Vitis vinifera]
 ref|XP_010664030.1| PREDICTED: splicing factor U2af small subunit B [Vitis vinifera]
 ref|XP_010664031.1| PREDICTED: splicing factor U2af small subunit B [Vitis vinifera]
Length=272

 Score =   295 bits (756),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP K+QEHFE+FYED+FEEL K+GEIESLNVCDNLADHM+GNVYVQF+EEE
Sbjct  61   GVDAQGQPIDPRKIQEHFEDFYEDIFEELGKFGEIESLNVCDNLADHMIGNVYVQFKEEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I R+L
Sbjct  121  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQFEENNCNRGGYCNFMHVKLIGRDL  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|XP_004494140.1| PREDICTED: splicing factor U2af small subunit A-like [Cicer arietinum]
Length=321

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 173/201 (86%), Gaps = 11/201 (5%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM---  237
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPT++LSNMYQRPDM   
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTLVLSNMYQRPDMNLN  60

Query  238  --------ITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMV  393
                      P    Q   +DP K+QEHF++FYEDLFEELSKYG+I+SLN+CDNLADHMV
Sbjct  61   FINPTPNQPQPPQPPQPESLDPDKLQEHFDDFYEDLFEELSKYGQIQSLNICDNLADHMV  120

Query  394  GNVYVQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCN  573
            GNVYVQ++EE+ AANAL NL+GRFY+GRPIIVDFSPVTDFREATCRQYEEN CNRGGYCN
Sbjct  121  GNVYVQYKEEDHAANALMNLTGRFYSGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCN  180

Query  574  FMHLKRISRELXRHLFGRYHR  636
            FMHLK+ISR+L + LFGR  R
Sbjct  181  FMHLKKISRDLRKRLFGRSRR  201



>gb|KEH24121.1| splicing factor U2af small subunit A-like protein [Medicago truncatula]
Length=327

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 173/204 (85%), Gaps = 14/204 (7%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM---  237
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPT++LSNMYQRPDM   
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTLVLSNMYQRPDMNLN  60

Query  238  -----------ITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLAD  384
                         P    Q   +DP K+QEHF++FYEDLFEELSKYG+I+SLN+CDNLAD
Sbjct  61   FINPTPNQPQQPQPPQPPQPESLDPDKLQEHFDDFYEDLFEELSKYGQIQSLNICDNLAD  120

Query  385  HMVGNVYVQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGG  564
            HMVGNVYVQ++EE+ AANAL NL+GRFY+GRPIIVDFSPVTDFREATCRQYEEN CNRGG
Sbjct  121  HMVGNVYVQYKEEDHAANALMNLTGRFYSGRPIIVDFSPVTDFREATCRQYEENVCNRGG  180

Query  565  YCNFMHLKRISRELXRHLFGRYHR  636
            YCNFMHLK+ISR+L + LFGR  R
Sbjct  181  YCNFMHLKKISRDLRKRLFGRSSR  204



>ref|XP_006849930.1| hypothetical protein AMTR_s00022p00118880 [Amborella trichopoda]
 gb|ERN11511.1| hypothetical protein AMTR_s00022p00118880 [Amborella trichopoda]
Length=284

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMMTP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+ ++P K+QEHFE+FYED++EELSK+GEIESLNVCDNLADHMVGNVYVQF+EEE
Sbjct  61   GVDPQGQAMEPQKIQEHFEDFYEDIYEELSKFGEIESLNVCDNLADHMVGNVYVQFKEEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ +  R+Y+GRPII+DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K+I REL
Sbjct  121  QAAAALQAMQYRYYSGRPIIIDFSPVTDFREATCRQYEENNCNRGGYCNFMHVKQIGREL  180

Query  607  XRHLFG  624
             R LFG
Sbjct  181  RRKLFG  186



>gb|AFK48647.1| unknown [Medicago truncatula]
Length=327

 Score =   292 bits (747),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 172/204 (84%), Gaps = 14/204 (7%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM---  237
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPT++LSNMYQRPDM   
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTLVLSNMYQRPDMNLN  60

Query  238  -----------ITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLAD  384
                         P    Q   +DP K+QEHF++FYEDLFEELSKYG+I+SLN+CDNLAD
Sbjct  61   FINPTPNQPQQPQPPQPPQPESLDPDKLQEHFDDFYEDLFEELSKYGQIQSLNICDNLAD  120

Query  385  HMVGNVYVQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGG  564
            HMVGNVYVQ++EE+ AANAL NL+GRFY+GRPIIV FSPVTDFREATCRQYEEN CNRGG
Sbjct  121  HMVGNVYVQYKEEDHAANALMNLTGRFYSGRPIIVGFSPVTDFREATCRQYEENVCNRGG  180

Query  565  YCNFMHLKRISRELXRHLFGRYHR  636
            YCNFMHLK+ISR+L + LFGR  R
Sbjct  181  YCNFMHLKKISRDLRKRLFGRSSR  204



>ref|XP_001754868.1| predicted protein [Physcomitrella patens]
 gb|EDQ80322.1| predicted protein, partial [Physcomitrella patens]
Length=283

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 167/191 (87%), Gaps = 3/191 (2%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM-IT  243
            MAEHLASIFGTEKDRVNCPFYFKIG CRHGDRCSRLH +P+ S T+LL+NMYQ PD    
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGVCRHGDRCSRLHNRPTASQTLLLANMYQSPDAGFH  60

Query  244  PGVDAQG--RPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFR  417
             GVD  G  +  DP K+QEHFE+FYED+FEELSKYGEIE+LNVCDNLADHM+GNVYV+FR
Sbjct  61   GGVDQHGNIQQSDPRKLQEHFEDFYEDIFEELSKYGEIENLNVCDNLADHMIGNVYVKFR  120

Query  418  EEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRIS  597
            EEE AA AL  LSGRFYAGRPII+DFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+IS
Sbjct  121  EEEHAAAALNALSGRFYAGRPIILDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKIS  180

Query  598  RELXRHLFGRY  630
            REL R LFG Y
Sbjct  181  RELRRKLFGNY  191



>ref|XP_001777116.1| predicted protein [Physcomitrella patens]
 gb|EDQ58109.1| predicted protein [Physcomitrella patens]
Length=304

 Score =   290 bits (742),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 167/191 (87%), Gaps = 3/191 (2%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM-IT  243
            MAEHLASIFGTEKDRVNCPFYFKIG CRHGDRCSRLH +P+ S T+LL+NMYQ PD    
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGVCRHGDRCSRLHNRPTASQTLLLANMYQSPDAGFH  60

Query  244  PGVDAQG--RPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFR  417
             GVD  G  +  DP K+QEHFE+FYED+FEELSKYGEIE+LNVCDNLADHM+GNVYV+FR
Sbjct  61   GGVDQHGNIQQSDPRKLQEHFEDFYEDIFEELSKYGEIENLNVCDNLADHMIGNVYVKFR  120

Query  418  EEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRIS  597
            EEE AA AL  LSGRFYAGRPII+DFSPVTDFREATCRQYEEN+CNRGGYCNFMHLK+IS
Sbjct  121  EEEHAAAALNALSGRFYAGRPIILDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKKIS  180

Query  598  RELXRHLFGRY  630
            REL R LFG Y
Sbjct  181  RELRRKLFGNY  191



>ref|XP_007153127.1| hypothetical protein PHAVU_003G009100g [Phaseolus vulgaris]
 ref|XP_007153128.1| hypothetical protein PHAVU_003G009100g [Phaseolus vulgaris]
 ref|XP_007153129.1| hypothetical protein PHAVU_003G009100g [Phaseolus vulgaris]
 gb|ESW25121.1| hypothetical protein PHAVU_003G009100g [Phaseolus vulgaris]
 gb|ESW25122.1| hypothetical protein PHAVU_003G009100g [Phaseolus vulgaris]
 gb|ESW25123.1| hypothetical protein PHAVU_003G009100g [Phaseolus vulgaris]
Length=258

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 163/190 (86%), Gaps = 11/190 (6%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIG+CRHGDRCSRLH +PSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGSCRHGDRCSRLHNRPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q+HFE+FYED+F EL+K+GEIESLNVCDNLADHM+GNV        
Sbjct  61   GVDPQGQPLDPRKIQQHFEDFYEDIFTELAKFGEIESLNVCDNLADHMIGNV--------  112

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
                AL  L GRFY  RPII DFSPVTDFREATCRQ+EENSCNRGGYCNFMH+K I R+L
Sbjct  113  ---KALHALHGRFYNARPIIADFSPVTDFREATCRQFEENSCNRGGYCNFMHVKLIGRDL  169

Query  607  XRHLFGRYHR  636
             R LFGR HR
Sbjct  170  RRRLFGRNHR  179



>gb|AFK41187.1| unknown [Lotus japonicus]
Length=318

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 172/196 (88%), Gaps = 6/196 (3%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM---  237
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPT++LSNMYQRPDM   
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTLVLSNMYQRPDMNLN  60

Query  238  -ITPGVDAQGRPIDP--HKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYV  408
             IT     Q +P      K+Q+HF++FYEDLF+ELSKYG+I+SLN+CDNLADHMVGNVYV
Sbjct  61   IITQPNQPQHQPQPLDPDKLQDHFDDFYEDLFQELSKYGQIQSLNICDNLADHMVGNVYV  120

Query  409  QFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLK  588
            Q++EE+ AANAL NL+GRFY+GRPII DFSPVTDFREATCRQYEEN CNRGGYCNFMHLK
Sbjct  121  QYKEEDHAANALTNLTGRFYSGRPIIADFSPVTDFREATCRQYEENVCNRGGYCNFMHLK  180

Query  589  RISRELXRHLFGRYHR  636
            +ISR+L R LFGR  R
Sbjct  181  KISRDLRRRLFGRNKR  196



>ref|XP_002971319.1| hypothetical protein SELMODRAFT_67301, partial [Selaginella moellendorffii]
 gb|EFJ27917.1| hypothetical protein SELMODRAFT_67301, partial [Selaginella moellendorffii]
Length=275

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KP+ISPT+LLSNMYQRPDM TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPTISPTLLLSNMYQRPDMATP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            G+D  G+ +D  K+QEHFE+FYED+FEELSKYGEIESLNVCDNLADHMVGNVYVQFREEE
Sbjct  61   GMDLNGQTMDQKKIQEHFEDFYEDMFEELSKYGEIESLNVCDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMH  582
            +AA ALK LSGRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNFMH
Sbjct  121  EAAAALKALSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMH  172



>gb|KHF98869.1| Splicing factor U2af small subunit B [Gossypium arboreum]
Length=292

 Score =   285 bits (729),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG PIDP K+Q+HFE FYEDLFEELSKYG+IESLN+CDNLADHMVGNVYVQFREEE
Sbjct  61   GVDAQGNPIDPRKIQQHFEAFYEDLFEELSKYGQIESLNICDNLADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQ  534
             AANA+KNLSGRFYA RPIIVDFSPVTDFREATCRQ
Sbjct  121  HAANAVKNLSGRFYAARPIIVDFSPVTDFREATCRQ  156



>tpg|DAA55289.1| TPA: hypothetical protein ZEAMMB73_300759 [Zea mays]
Length=172

 Score =   280 bits (717),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKDRVNCPFYFKIG CRHGDRCSRLH +P+ISPT++L+NMYQRPDMITP
Sbjct  1    MAEYLASIFGTEKDRVNCPFYFKIGVCRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP KMQEHFE+FYED++EEL K+GEIE+LNVCDNLADHM+GNVYVQFREEE
Sbjct  61   GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGG  564
            QAA A   L GRFY+GRPIIV++SPVTDFREATCRQ+EENSCNRGG
Sbjct  121  QAAVAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGG  166



>emb|CDX90100.1| BnaA08g18840D [Brassica napus]
Length=286

 Score =   283 bits (725),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASI+GTEKDRVNCPFY K+GACRHGDRCSR+H +P+ISPT+LL+NMYQRPDMITP
Sbjct  1    MAEHLASIYGTEKDRVNCPFYNKMGACRHGDRCSRIHNRPAISPTLLLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+F+EDLFEEL K+GEIESLN+CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFFEDLFEELGKFGEIESLNICDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA ALK L GR Y GRPII +FSPVTDFREATCRQYEE +C+RGGYCNFMH+K +SRE+
Sbjct  121  QAAAALKALQGRSYLGRPIIGEFSPVTDFREATCRQYEEENCSRGGYCNFMHVKLVSREM  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|XP_005847929.1| hypothetical protein CHLNCDRAFT_57737 [Chlorella variabilis]
 gb|EFN55827.1| hypothetical protein CHLNCDRAFT_57737 [Chlorella variabilis]
Length=395

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MA HLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPTILL NMYQ P +  P
Sbjct  1    MANHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTILLQNMYQNPILNAP  60

Query  247  -GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
             G D    P+DP K+QE FE+FYED+F EL+K+GE+E LNVCDNLADHMVGNVYV+FR+E
Sbjct  61   LGPDGLPMPVDPKKVQEFFEDFYEDIFLELAKFGEVEYLNVCDNLADHMVGNVYVKFRDE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E+AA AL+ + GR+YAG+PI+V+FSPVTDFREATCRQYEEN+C+RGGYCNFMH++ +SRE
Sbjct  121  EEAARALQGMQGRYYAGKPIVVEFSPVTDFREATCRQYEENNCSRGGYCNFMHVRPVSRE  180

Query  604  LXRHLFGRY  630
            L + LFGRY
Sbjct  181  LRKQLFGRY  189



>emb|CDY11775.1| BnaC03g58030D [Brassica napus]
Length=290

 Score =   281 bits (720),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASI+GTEKDRVNCPFY K+GACRHGDRCSR+H +P+ISPT+LL+NMYQRPDMITP
Sbjct  1    MAEHLASIYGTEKDRVNCPFYNKMGACRHGDRCSRIHNRPAISPTLLLANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+F+EDLFEEL K+GEIESLN+CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFFEDLFEELGKFGEIESLNICDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GR Y GRPII ++SPVTDFREATCRQYEE +C+RGGYCNFMH+K +SRE+
Sbjct  121  QAAAALRALQGRSYLGRPIIGEYSPVTDFREATCRQYEEENCSRGGYCNFMHVKLVSREM  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|XP_009109791.1| PREDICTED: splicing factor U2af small subunit A [Brassica rapa]
Length=286

 Score =   280 bits (717),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASI+GTEKDRVNCPFY K+GACRHGDRCSR+H +P+ISPT+LL+NMYQRPDMI P
Sbjct  1    MAEHLASIYGTEKDRVNCPFYNKMGACRHGDRCSRIHNRPAISPTLLLANMYQRPDMIPP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+P+DP K+QEHFE+F+EDLFEEL K+GEIESLN+CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDAQGQPLDPRKIQEHFEDFFEDLFEELGKFGEIESLNICDNLADHMIGNVYVQFKEED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA ALK L GR Y GRPII +FSPVTDFREATCRQYEE +C+RGGYCNFMH+K +SRE+
Sbjct  121  QAAAALKALQGRSYLGRPIIGEFSPVTDFREATCRQYEEENCSRGGYCNFMHVKLVSREM  180

Query  607  XRHLF  621
             R LF
Sbjct  181  RRKLF  185



>ref|XP_009102962.1| PREDICTED: LOW QUALITY PROTEIN: splicing factor U2af small subunit 
A-like [Brassica rapa]
Length=289

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 165/185 (89%), Gaps = 8/185 (4%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDA G+P+DP K+QEHFE+F+EDLFEEL K         CDNLADHM+GNVYVQF+EE+
Sbjct  61   GVDANGQPLDPRKIQEHFEDFFEDLFEELGK--------XCDNLADHMIGNVYVQFKEED  112

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN+CNRGGYCNFMH+K +SREL
Sbjct  113  QAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENNCNRGGYCNFMHVKLVSREL  172

Query  607  XRHLF  621
             R LF
Sbjct  173  RRKLF  177



>ref|XP_005652312.1| RNA-binding domain-containing protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27768.1| RNA-binding domain-containing protein [Coccomyxa subellipsoidea 
C-169]
Length=248

 Score =   276 bits (706),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM-IT  243
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LL N+YQ P +   
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLPNLYQNPALNAP  60

Query  244  PGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
            PG D    P+D  K QEHFE+FYED+FEE+ KYG+IE LNVCDNLADHMVGNVY++F +E
Sbjct  61   PGPDGLPMPVDARKSQEHFEDFYEDIFEEMDKYGQIEHLNVCDNLADHMVGNVYIKFVDE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            + AA AL+ L+GRFYAGRPI+++FSPVTDFREATCRQYEEN+C RGGYCNFMHL+ IS+ 
Sbjct  121  DAAARALQGLTGRFYAGRPIMIEFSPVTDFREATCRQYEENTCTRGGYCNFMHLRPISKG  180

Query  604  LXRHLFGRYHR  636
            L + LFGRY +
Sbjct  181  LRKDLFGRYKK  191



>ref|XP_001696419.1| U2 snRNP auxiliary factor, small subunit [Chlamydomonas reinhardtii]
 gb|EDP08396.1| U2 snRNP auxiliary factor, small subunit [Chlamydomonas reinhardtii]
Length=273

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPTIL++NMYQ P +  P
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTILMANMYQNPLLNAP  60

Query  247  -GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
             G D     +DP   QEHFE+FYED+FEEL+ +GE+E+LNVCDN ADHMVGNVY +FR+E
Sbjct  61   LGPDGLPIRVDPRAAQEHFEDFYEDVFEELAAHGELENLNVCDNFADHMVGNVYAKFRDE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            + AA AL  L GR+Y GRPIIV+FSPVTDFREATCRQYEEN+CNRGGYCNFMHLK ISRE
Sbjct  121  DAAARALTALQGRYYDGRPIIVEFSPVTDFREATCRQYEENTCNRGGYCNFMHLKPISRE  180

Query  604  LXRHLFGRY  630
            L + LFGRY
Sbjct  181  LRKKLFGRY  189



>ref|XP_011401279.1| Splicing factor U2af small subunit A [Auxenochlorella protothecoides]
 gb|KFM28265.1| Splicing factor U2af small subunit A [Auxenochlorella protothecoides]
Length=202

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LL NMYQ P +  P
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLQNMYQNPILNAP  60

Query  247  -GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
             G D    P+DP K+QE FE+FYED+FEEL+K GEIE LNVCDNLADHMVGN YV+FR+E
Sbjct  61   LGADGLPLPVDPKKVQEFFEDFYEDIFEELAKAGEIEYLNVCDNLADHMVGNCYVKFRDE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E AA AL+    RFYAG+PI+ +FSPVTDFREATCRQYEE +C RGGYCNFMH++ +S++
Sbjct  121  EAAARALQLFQARFYAGKPIVAEFSPVTDFREATCRQYEEGTCGRGGYCNFMHVRPVSKQ  180

Query  604  LXRHLFGRY  630
            L + LFGRY
Sbjct  181  LRKQLFGRY  189



>gb|KCW48367.1| hypothetical protein EUGRSUZ_K02078 [Eucalyptus grandis]
Length=273

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 158/180 (88%), Gaps = 16/180 (9%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKP+ISPTILLSNMYQRPDM+TP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTILLSNMYQRPDMLTP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD Q + +DP K+Q+HFE+FYEDLFEELSKYG+IE+LN+CDN+ADHMVGNVYVQFREEE
Sbjct  61   GVDPQAQNLDPRKVQDHFEDFYEDLFEELSKYGDIENLNICDNIADHMVGNVYVQFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             AANA++NL+GRFYA                ATCRQYEEN CNRGGYCNFMHLK+ISREL
Sbjct  121  HAANAVQNLTGRFYA----------------ATCRQYEENVCNRGGYCNFMHLKKISREL  164



>gb|KDD73606.1| hypothetical protein H632_c2013p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=253

 Score =   270 bits (690),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 161/189 (85%), Gaps = 1/189 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MA+HLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT+LL N YQ P +  P
Sbjct  1    MADHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLQNSYQNPVLNAP  60

Query  247  -GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
             G D    P+DP ++QE +E+FYED+FEEL+K+GE+E LNVCDNLADH+VGN Y +FR+E
Sbjct  61   LGSDGLPVPVDPKRVQEFYEDFYEDVFEELAKFGEVEYLNVCDNLADHLVGNAYAKFRDE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E AA AL+ L GR+YAG+P+ V+FSPVTDFREATCRQYEE +C RGGYCNFMHL+ +SR+
Sbjct  121  EGAARALQGLQGRYYAGKPLHVEFSPVTDFREATCRQYEEGTCTRGGYCNFMHLRPVSRD  180

Query  604  LXRHLFGRY  630
            L + LFGRY
Sbjct  181  LRKQLFGRY  189



>ref|XP_002506572.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO67830.1| predicted protein, partial [Micromonas sp. RCC299]
Length=224

 Score =   267 bits (682),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHG+RCSRLH KP++S TIL+SNMYQ P     
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGERCSRLHNKPTLSQTILMSNMYQSPAAAAI  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
               +     DP  +QEHFE+FYED+FEEL+KYGEIE LNVCDN +DH++GNVYV+FREEE
Sbjct  61   ANPSAQINTDPRAIQEHFEDFYEDIFEELAKYGEIEGLNVCDNTSDHLIGNVYVKFREEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A  AL  LSGRFY+GRPI+ +FSPVTDFRE+TCRQYEEN+CNRGGYCNFMHLK ISR+L
Sbjct  121  SALAALNALSGRFYSGRPILCEFSPVTDFRESTCRQYEENTCNRGGYCNFMHLKPISRQL  180

Query  607  XRHLFGRY  630
             + LFGRY
Sbjct  181  RKILFGRY  188



>ref|XP_003063225.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52361.1| predicted protein [Micromonas pusilla CCMP1545]
Length=324

 Score =   268 bits (686),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 159/192 (83%), Gaps = 4/192 (2%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KP++S TIL+SNMYQ P+    
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPTLSQTILMSNMYQSPEAAMA  60

Query  247  GVDAQGRPI----DPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQF  414
               A    +    D  KMQEHFE+FYED+FEEL+ YGEIE LN+CDNLADH+VGNVYV++
Sbjct  61   AQAATSGAVPEAPDARKMQEHFEDFYEDIFEELATYGEIEGLNICDNLADHLVGNVYVKY  120

Query  415  REEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRI  594
            REEE A  AL  LSGRFYAGRPI+ +FSPVTDFRE+TCRQYEEN+C RGGYCNFMHLK I
Sbjct  121  REEESALAALNALSGRFYAGRPILCEFSPVTDFRESTCRQYEENTCTRGGYCNFMHLKPI  180

Query  595  SRELXRHLFGRY  630
            SR L + LFGRY
Sbjct  181  SRNLRKILFGRY  192



>ref|XP_002955007.1| hypothetical protein VOLCADRAFT_83022 [Volvox carteri f. nagariensis]
 gb|EFJ43995.1| hypothetical protein VOLCADRAFT_83022 [Volvox carteri f. nagariensis]
Length=288

 Score =   267 bits (683),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPTIL++NMYQ P +  P
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTILMANMYQNPLLNAP  60

Query  247  -GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
             G D     +DP   QEHFE+FYED+FEEL+++GE+E+LNVCDN ADHMVGNVY +FR+E
Sbjct  61   LGPDGLPIRVDPKAAQEHFEDFYEDVFEELAQHGELENLNVCDNFADHMVGNVYAKFRDE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            + AA AL+ L GR+Y GRPI+V+FSPVTDFREATCRQYEEN+CNRGGYCNFMHLK I RE
Sbjct  121  DAAARALQALQGRYYDGRPIVVEFSPVTDFREATCRQYEENTCNRGGYCNFMHLKPIGRE  180

Query  604  LXRHLFGRYH  633
            L R LFGRYH
Sbjct  181  LRRKLFGRYH  190



>gb|EAY75306.1| hypothetical protein OsI_03197 [Oryza sativa Indica Group]
Length=263

 Score =   266 bits (681),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 158/190 (83%), Gaps = 17/190 (9%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++ +NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTVVFANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP +MQEHFE+FYED+FEELSK+GEIE+LNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRQMQEHFEDFYEDIFEELSKFGEIENLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIVDFSPVTDFREATCRQ                   + R+L
Sbjct  121  QAAAAHTALQGRFYSGRPIIVDFSPVTDFREATCRQLG-----------------LGRDL  163

Query  607  XRHLFGRYHR  636
             + LFG Y +
Sbjct  164  RKKLFGHYRK  173



>gb|EAY75311.1| hypothetical protein OsI_03202 [Oryza sativa Indica Group]
Length=265

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 158/190 (83%), Gaps = 17/190 (9%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPT++ +NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTVVFANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP +MQEHFE+FYED+FEELSK+GEIE+LNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRQMQEHFEDFYEDIFEELSKFGEIENLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIVDFSPVTDFREATCRQ                   + R+L
Sbjct  121  QAAAAHTALQGRFYSGRPIIVDFSPVTDFREATCRQLG-----------------LGRDL  163

Query  607  XRHLFGRYHR  636
             + LFG Y +
Sbjct  164  RKKLFGHYRK  173



>gb|EEE55149.1| hypothetical protein OsJ_02948 [Oryza sativa Japonica Group]
Length=263

 Score =   261 bits (668),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 157/190 (83%), Gaps = 17/190 (9%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKD+VNCPFYFKIGACRHGDRCS LH +P+ISPT++ +NMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDKVNCPFYFKIGACRHGDRCSCLHNRPTISPTVVFANMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDAQG+PIDP +MQEHFE+FYED+FEELSK+GEIE+LNVCDNLADHM+GNVYVQFREE+
Sbjct  61   GVDAQGQPIDPRQMQEHFEDFYEDIFEELSKFGEIENLNVCDNLADHMIGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
            QAA A   L GRFY+GRPIIVDFSPVTDFREATCRQ                   + R+L
Sbjct  121  QAAAAHTALQGRFYSGRPIIVDFSPVTDFREATCRQLG-----------------LGRDL  163

Query  607  XRHLFGRYHR  636
             + LFG Y +
Sbjct  164  RKKLFGHYRK  173



>gb|AIB09599.1| mRNA splicing factor U2 associated factor [Lotharella sp. CCMP622]
Length=195

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE LASI GTEKDRVNCPFYFKIGACRHG +CSRLH KPS S T+++ N+YQ P +I P
Sbjct  1    MAEQLASILGTEKDRVNCPFYFKIGACRHGAKCSRLHNKPSSSSTLIIINLYQNPALIAP  60

Query  247  -GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
             G+D   +P+DP+ +++ FEEFYED+FEE + +G+IE++N+CDNL+DHM+GNVYV+FR E
Sbjct  61   IGIDGLPKPMDPYNLEKKFEEFYEDIFEEFAIFGQIENINICDNLSDHMIGNVYVKFRNE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            + A  ALK+++GRFY GR II + SPVTDFREATCRQ+++N+C RGGYCNFMHLK I R 
Sbjct  121  KSAMKALKSINGRFYNGRIIIAETSPVTDFREATCRQFQDNTCTRGGYCNFMHLKSIKRS  180

Query  604  LXRHLFGRY  630
            L + +F RY
Sbjct  181  LRKKMFDRY  189



>ref|XP_007508626.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20243.1| predicted protein [Bathycoccus prasinos]
Length=307

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 155/191 (81%), Gaps = 3/191 (2%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMI-T  243
            MAEHLASIFGTEKDRVNCPFYFKIGACRHG+RCSRLH KP++S T+LL NMYQ P+    
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGERCSRLHNKPTVSQTLLLINMYQSPEQARL  60

Query  244  PGVDAQG-RPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFRE  420
             G +AQG R  +P  +QEH+E+F  D+FEEL+ +GEIE LNVCDNLADHMVGNVYV+F +
Sbjct  61   LGGNAQGARTSEPQDVQEHYEDFCHDIFEELAIHGEIEELNVCDNLADHMVGNVYVKFAD  120

Query  421  EEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISR  600
            E+ A  A ++L GR+Y GRPI  +FSPVTDFRE+TCRQYEEN+C RGGYCNFMH++ I  
Sbjct  121  EDDAMKAKQSLDGRYYMGRPIKCEFSPVTDFRESTCRQYEENTCTRGGYCNFMHVRPIKN  180

Query  601  ELXRH-LFGRY  630
            +   H LFGRY
Sbjct  181  QTLAHALFGRY  191



>emb|CDP10321.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 163/199 (82%), Gaps = 6/199 (3%)
 Frame = +1

Query  28   RQQLNLKFEVSVSMAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTIL  207
            R  L+ KF V +   + LASIFGTEKDRVNCPFYFKIGA R+GDRCSRLH +P+ISPT+L
Sbjct  157  RCLLSHKFLV-ICEVKQLASIFGTEKDRVNCPFYFKIGAWRYGDRCSRLHNRPTISPTLL  215

Query  208  LSNMYQRPDMITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADH  387
            LSNMYQRPDMITPGVD QG+PI+  K+QEHFE+FYED+FEEL K+ EIESLN+CDNLADH
Sbjct  216  LSNMYQRPDMITPGVDPQGQPIEHRKIQEHFEDFYEDIFEELGKFDEIESLNICDNLADH  275

Query  388  MVGNVYVQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGY  567
            M+ N YVQF+EE+QAA AL+ L G FY+G  II DFSPVTDFREAT R+      +RGGY
Sbjct  276  MISNAYVQFKEEDQAAAALRALQGHFYSGCTIIADFSPVTDFREATYRR-----SSRGGY  330

Query  568  CNFMHLKRISRELXRHLFG  624
            CNFMH+K I R+L R LFG
Sbjct  331  CNFMHIKMIGRDLRRKLFG  349



>emb|CEG00329.1| U2 auxiliary factor small subunit [Ostreococcus tauri]
Length=247

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 147/199 (74%), Gaps = 19/199 (10%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPS S T+LL+NMY+       
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSASQTVLLTNMYR-------  53

Query  247  GVDAQGRPIDPHKM-----------QehfeefyedlfeeLSKYGEIESLNVCDNLADHMV  393
              +  G  +DP              Q HFE F EDLFEEL + GEIE +NVCDN  DHM 
Sbjct  54   -AEGAGGTVDPRDAASGKSASASAGQGHFEAFVEDLFEELDECGEIEGVNVCDNATDHMA  112

Query  394  GNVYVQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCN  573
            GNVYV+F +E+ A  AL+ L GR+Y GRPI+V++SPVTDF+E+TCRQYEENSC RGGYCN
Sbjct  113  GNVYVKFVDEDGARRALEKLQGRYYDGRPILVEYSPVTDFKESTCRQYEENSCTRGGYCN  172

Query  574  FMHLKRISRELXRHLFGRY  630
            FMHL+ I R + + L+GRY
Sbjct  173  FMHLRPIGRSMRKQLYGRY  191



>emb|CDP15354.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   235 bits (599),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPT+LLSNMYQRPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVD QG+P+DP K+Q HFE+FYEDLFEELSKYGEI++LN+CDNLADHMVGNVYVQFREE+
Sbjct  61   GVDPQGQPLDPKKIQHHFEDFYEDLFEELSKYGEIQNLNICDNLADHMVGNVYVQFREED  120

Query  427  QAANALKNLSGRFYAGR  477
             AA AL+NLSGRFYAG 
Sbjct  121  HAAAALQNLSGRFYAGE  137



>ref|XP_001421585.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99878.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=243

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 143/185 (77%), Gaps = 4/185 (2%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDM---  237
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KP+ S TILL+N+Y RPD+   
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPTASQTILLTNLY-RPDVEVA  59

Query  238  ITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFR  417
              P     G      + QE FE F ED+FEEL + GEIE +NVCDN+ DHM+GNVYV+F 
Sbjct  60   ADPRAATSGAASRAGRGQEGFEAFVEDVFEELDECGEIEGVNVCDNVTDHMMGNVYVKFV  119

Query  418  EEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRIS  597
            EEE A  A++ L GR+Y GRPI  +FSPVTDFRE+TCRQYEENSC RGGYCNFMHLK I 
Sbjct  120  EEEAAGRAVEKLRGRYYDGRPIAAEFSPVTDFRESTCRQYEENSCTRGGYCNFMHLKPIG  179

Query  598  RELXR  612
            R + +
Sbjct  180  RGMRK  184



>ref|XP_001712926.1| mRNA splicing factor U2 associated factor [Bigelowiella natans]
 gb|ABA27314.1| mRNA splicing factor U2 associated factor [Bigelowiella natans]
Length=193

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MA+HLASI GTEKDRVNCPFYFKIGACRHG +CSRLH KP+ S TIL  N+YQ P +  P
Sbjct  1    MADHLASIHGTEKDRVNCPFYFKIGACRHGSKCSRLHNKPTSSQTILFVNLYQNPALKAP  60

Query  247  -GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
             G D   +P +P+K Q+ FE FYEDLF+E+S +G+I+++ VCDNL+DH++GNVYV+F ++
Sbjct  61   VGKDGLPKPKNPYKSQKQFEFFYEDLFQEMSFFGDIDNIYVCDNLSDHLIGNVYVKFLKD  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            + A  ALK++SGRFY  R I+ + SPVTDFRE+TCRQYE+N+CNRGGYCNFMHLK + R 
Sbjct  121  KSAMKALKSVSGRFYDKRLIVAETSPVTDFRESTCRQYEDNTCNRGGYCNFMHLKPLKRS  180

Query  604  LXRHLFG  624
                +F 
Sbjct  181  FRNKIFS  187



>ref|XP_011417404.1| PREDICTED: splicing factor U2AF 26 kDa subunit-like isoform X3 
[Crassostrea gigas]
Length=245

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 141/186 (76%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHG+RCSRLH KP+ S T+L+ N+Y  P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGERCSRLHNKPTFSQTVLIENLYMNPQNTAL  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
              D     +D  ++Q+ ++EF+E+++ EL KYGEIE +NVCDNL DH+VGNVYV+FR EE
Sbjct  61   TADGSHIQMDDTELQQFYDEFFEEVYVELEKYGEIEEMNVCDNLGDHLVGNVYVKFRYEE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A  A+  L+ R++ GRP+  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISREL
Sbjct  121  DAEKAVNELNNRWFNGRPVHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISREL  180

Query  607  XRHLFG  624
             R L+G
Sbjct  181  RRELYG  186



>emb|CDP19362.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +1

Query  121  PFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITPGVDAQGRPIDPHKMQehf  300
            PF  +  A  +GDRCSRLH +P+ISPT+LLSNMYQRPDMITPGVD QG+PI+P K+QEHF
Sbjct  20   PFLLQDCAWCYGDRCSRLHNRPTISPTLLLSNMYQRPDMITPGVDPQGQPIEPRKIQEHF  79

Query  301  eefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEEQAANALKNLSGRFYAGRP  480
            E+FYED+FEEL K+ EIESLN+CDNLADHM+ NVYVQF+EE+QAA AL+ L G FY+GRP
Sbjct  80   EDFYEDIFEELGKFDEIESLNICDNLADHMISNVYVQFKEEDQAAAALQALQGHFYSGRP  139

Query  481  IIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRELXRHLFGRY  630
            II DFSPVTDFREATCRQ+EEN+CNRGGYCNFMH+K I R+L R LFG +
Sbjct  140  IIADFSPVTDFREATCRQFEENNCNRGGYCNFMHVKMIGRDLKRKLFGSH  189



>gb|ACF24526.1| mRNA splicing factor U2 associated factor [Gymnochlora stellata]
Length=182

 Score =   231 bits (588),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 147/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  103  KDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP-GVDAQGRPIDP  279
            KDRVNCPFYFKIGACRHGD+CSR+H +P+ S T+L  NMYQ P +  P G D   +P++P
Sbjct  1    KDRVNCPFYFKIGACRHGDKCSRMHNRPATSQTLLFINMYQNPALTAPLGKDGLPKPLNP  60

Query  280  HKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEEQAANALKNLSG  459
            + +Q HF++FY+D++EEL+ +G+IE+LNVCDNL+DHM+GNVYV++R+E+ A  ALK+++G
Sbjct  61   YNLQSHFQKFYKDIYEELNFFGDIENLNVCDNLSDHMIGNVYVKYRQEKSAMKALKSING  120

Query  460  RFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRELXRHLFGR  627
            RFYAGR I+ + SPVTDFRE+TCRQY++N+C+RGGYCNFMHLK I R L + LF R
Sbjct  121  RFYAGRIIVAETSPVTDFRESTCRQYDDNTCSRGGYCNFMHLKPIKRSLRKELFTR  176



>emb|CCI44589.1| unnamed protein product [Albugo candida]
Length=331

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = +1

Query  70   AEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITPG  249
            AEHLA I GTE+DRVNCPFYFKIGACRHGDRCSRLH KP  S TIL+S+MYQ P      
Sbjct  51   AEHLARIHGTEEDRVNCPFYFKIGACRHGDRCSRLHNKPVFSQTILVSHMYQNPLSQIIA  110

Query  250  VDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEEQ  429
             +     +D  K+ E FE+FYE++FEEL K+G++E LN+CDNL DH+VGNVYV++ +EE 
Sbjct  111  QNGDPSALDQKKVDEDFEDFYEEVFEELCKFGKVEELNICDNLGDHLVGNVYVKYEDEEH  170

Query  430  AANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRELX  609
            AA A K+L GRFYAGRP++ +FSPVTDFREA CRQ++E +CNRGGYCNFMH+K +SR + 
Sbjct  171  AAAAQKSLYGRFYAGRPLVCEFSPVTDFREARCRQFDEGTCNRGGYCNFMHVKTVSRSMQ  230

Query  610  RHLFGRYHR  636
            R L   Y+R
Sbjct  231  RELERLYNR  239



>ref|XP_006379326.1| hypothetical protein POPTR_0009s15180g [Populus trichocarpa]
 gb|ERP57123.1| hypothetical protein POPTR_0009s15180g [Populus trichocarpa]
Length=183

 Score =   230 bits (587),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 131/168 (78%), Gaps = 25/168 (15%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKI ACRH        TKPSIS T+LLSNMY+RPDMITP
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIRACRH--------TKPSISRTLLLSNMYRRPDMITP  52

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
            GVDA G  IDP K+Q++                  ESLNVCDNLA+HMVGNVYV+FRE+E
Sbjct  53   GVDALGNTIDPRKIQQY-----------------FESLNVCDNLAEHMVGNVYVRFREQE  95

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYC  570
            +A+NALK+L+GRF+ GR IIV FSPVTDF EATC+QYEEN CNRGGYC
Sbjct  96   RASNALKDLTGRFFPGRLIIVGFSPVTDFCEATCKQYEENVCNRGGYC  143



>ref|XP_003747118.1| PREDICTED: splicing factor U2af 38 kDa subunit-like [Metaseiulus 
occidentalis]
Length=229

 Score =   232 bits (591),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 142/186 (76%), Gaps = 1/186 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSR+H KP+ S TILL N+Y  P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTILLQNLYHNPQNTAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEHF+ F+ED+F EL  KYGEIE +NVCDNL DH+VGNVYV+FR+E
Sbjct  61   TADGSHTNMTEEEMQEHFDNFFEDVFVELEDKYGEIEEMNVCDNLGDHLVGNVYVKFRKE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            + A  A+K L+ R++AGRP++ + SPVTDFREA CRQYE   C R G+CNFMHL+ ISRE
Sbjct  121  DDAEKAVKELNNRWFAGRPVVAELSPVTDFREACCRQYEMGECTRSGFCNFMHLRPISRE  180

Query  604  LXRHLF  621
            L + L+
Sbjct  181  LRKELY  186



>ref|XP_002999307.1| splicing factor U2AF 35 kDa subunit [Phytophthora infestans T30-4]
 gb|EEY69453.1| splicing factor U2AF 35 kDa subunit [Phytophthora infestans T30-4]
Length=340

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 149/191 (78%), Gaps = 4/191 (2%)
 Frame = +1

Query  52   EVSVSMAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRP  231
            E S   AEHLA I GTE+DRVNCPFYFKIGACRHGDRCSRLH KP  S TIL+S+MYQ P
Sbjct  51   EQSGGGAEHLARIHGTEEDRVNCPFYFKIGACRHGDRCSRLHNKPVFSQTILVSHMYQNP  110

Query  232  DMITPGVDAQGRP--IDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVY  405
              I   +   G P  +D  ++ E FE+FYE++FEEL K+G++E LN+CDNL DH+VGNVY
Sbjct  111  --IAQVIAQNGDPASLDQRQVDEDFEDFYEEVFEELCKFGKVEELNICDNLGDHLVGNVY  168

Query  406  VQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHL  585
             ++ +EE AA A K+L GRFYAGRP++ +FSPVTDFREA CRQ++E +CNRGGYCNFMH+
Sbjct  169  AKYEDEEHAAAAQKSLYGRFYAGRPLVCEFSPVTDFREARCRQFDEGTCNRGGYCNFMHI  228

Query  586  KRISRELXRHL  618
            K +SR + R L
Sbjct  229  KTVSRSMQREL  239



>emb|CCA15308.1| splicing factor U2AF 35 kDa subunit putative [Albugo laibachii 
Nc14]
Length=331

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 151/191 (79%), Gaps = 4/191 (2%)
 Frame = +1

Query  70   AEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRP--DMIT  243
            AEHLA I GTE+DRVNCPFYFKIGACRHGDRCSRLH KP  S TIL+S+MYQ P   +I 
Sbjct  51   AEHLARIHGTEEDRVNCPFYFKIGACRHGDRCSRLHNKPVFSQTILVSHMYQNPLSQIIA  110

Query  244  PGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREE  423
               D  G  +D  K+ E FE+FYE++FEEL K+G++E LN+CDNL DH+VGNVYV++ +E
Sbjct  111  QNGDPSG--LDQKKVDEDFEDFYEEVFEELCKFGKVEELNICDNLGDHLVGNVYVKYEDE  168

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E AA A K+L GRFYAGRP++ +FSPVTDFREA CRQ++E +CNRGGYCNFMH+K +SR 
Sbjct  169  EHAAAAQKSLYGRFYAGRPLVCEFSPVTDFREARCRQFDEGTCNRGGYCNFMHVKTVSRS  228

Query  604  LXRHLFGRYHR  636
            + R L   Y+R
Sbjct  229  MQRELERLYNR  239



>ref|XP_001630436.1| predicted protein [Nematostella vectensis]
 gb|EDO38373.1| predicted protein [Nematostella vectensis]
Length=208

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 140/186 (75%), Gaps = 1/186 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TILL NMYQ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILLQNMYQNPQSAAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     I   + QEH++ F+ED+F EL  KYGEIE +NVCDNL DH+VGNVYV+FR E
Sbjct  61   VADGTSNAISDVEAQEHYDRFFEDVFLELEEKYGEIEEMNVCDNLGDHLVGNVYVKFRYE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R+Y G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHL+ ISR+
Sbjct  121  EDAEKAVNDLNNRWYNGQPIYAELSPVTDFREACCRQYEMGECTRGGFCNFMHLRPISRD  180

Query  604  LXRHLF  621
            + R L+
Sbjct  181  VRRELY  186



>ref|XP_004696963.1| PREDICTED: splicing factor U2AF 35 kDa subunit isoform X2 [Echinops 
telfairi]
 ref|XP_006005853.1| PREDICTED: splicing factor U2AF 35 kDa subunit isoform X2 [Latimeria 
chalumnae]
Length=192

 Score =   230 bits (587),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADGSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>gb|EFX79448.1| hypothetical protein DAPPUDRAFT_52589 [Daphnia pulex]
Length=237

 Score =   231 bits (588),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 132/194 (68%), Gaps = 5/194 (3%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSR+H KP+ S TI L N Y  P   T 
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTICLQNFYVNPQNATK  60

Query  247  GVDAQGRP-----IDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQ  411
              D    P      D    +     F +   E   KYGEIE +NVCDNL DH+VGNVY++
Sbjct  61   TADGTAVPGIVTMSDEEAQEHFDNFFEDVFAECEDKYGEIEEMNVCDNLGDHLVGNVYIK  120

Query  412  FREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKR  591
            FR EE A  A+ +L+ R++AGRP+  + SPVTDFREA CRQYE   C R G+CNFMHLK 
Sbjct  121  FRREEDAEKAVNDLNNRWFAGRPVYAELSPVTDFREACCRQYELGECTRSGFCNFMHLKP  180

Query  592  ISRELXRHLFGRYH  633
            ISREL R L+GR H
Sbjct  181  ISRELRRELYGRKH  194



>emb|CAF98200.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=227

 Score =   230 bits (587),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              DA    +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADASRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVMDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFG  624
            L R L+G
Sbjct  181  LRRELYG  187



>ref|XP_010752203.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like [Larimichthys 
crocea]
Length=227

 Score =   230 bits (587),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              DA    +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADASRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVMDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFG  624
            L R L+G
Sbjct  181  LRRELYG  187



>ref|XP_003456044.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like [Oreochromis 
niloticus]
 ref|XP_004570221.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like isoform X2 
[Maylandia zebra]
 ref|XP_005747399.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like [Pundamilia 
nyererei]
 ref|XP_005948445.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like [Haplochromis 
burtoni]
 ref|XP_006792830.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like isoform X1 
[Neolamprologus brichardi]
Length=227

 Score =   230 bits (587),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              DA    +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADASRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRHE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVMDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFG  624
            L R L+G
Sbjct  181  LRRELYG  187



>ref|XP_006260531.1| PREDICTED: splicing factor U2AF 35 kDa subunit isoform X1 [Alligator 
mississippiensis]
Length=263

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADGSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>ref|XP_008285544.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like isoform X1 
[Stegastes partitus]
Length=230

 Score =   230 bits (587),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              DA    +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADASRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVMDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFG  624
            L R L+G
Sbjct  181  LRRELYG  187



>gb|ETM49098.1| hypothetical protein L914_06545 [Phytophthora parasitica]
 gb|ETM49099.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETP47155.1| hypothetical protein F442_06797 [Phytophthora parasitica P10297]
 gb|ETP47156.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=340

 Score =   234 bits (596),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 148/191 (77%), Gaps = 4/191 (2%)
 Frame = +1

Query  52   EVSVSMAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRP  231
            E S   AEHLA I GTE+DRVNCPFYFKIGACRHGDRCSRLH KP  S TIL+S+MYQ P
Sbjct  51   EQSGGGAEHLARIHGTEEDRVNCPFYFKIGACRHGDRCSRLHNKPVFSQTILVSHMYQNP  110

Query  232  DMITPGVDAQGRP--IDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVY  405
              I   +   G P  +D  ++ E FE+FYE++FEEL K+G++E LN+CDNL DH+VGNVY
Sbjct  111  --IAQVIAQNGDPASLDQRQVDEDFEDFYEEVFEELCKFGKLEELNICDNLGDHLVGNVY  168

Query  406  VQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHL  585
             ++ +EE AA A K L GRFYAGRP++ +FSPVTDFREA CRQ++E +CNRGGYCNFMH+
Sbjct  169  AKYEDEEHAAAAQKALYGRFYAGRPLVCEFSPVTDFREARCRQFDEGTCNRGGYCNFMHI  228

Query  586  KRISRELXRHL  618
            K +SR + R L
Sbjct  229  KTVSRSMQREL  239



>ref|XP_008892402.1| hypothetical protein PPTG_02849 [Phytophthora parasitica INRA-310]
 ref|XP_008892403.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI49453.1| hypothetical protein F443_06761 [Phytophthora parasitica P1569]
 gb|ETI49454.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK89331.1| hypothetical protein L915_06634 [Phytophthora parasitica]
 gb|ETK89332.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL42656.1| hypothetical protein L916_06573 [Phytophthora parasitica]
 gb|ETL42657.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL95821.1| hypothetical protein L917_06444 [Phytophthora parasitica]
 gb|ETL95822.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN23208.1| hypothetical protein PPTG_02849 [Phytophthora parasitica INRA-310]
 gb|ETN23209.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETO78188.1| hypothetical protein F444_06828 [Phytophthora parasitica P1976]
 gb|ETO78189.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP19226.1| hypothetical protein F441_06764 [Phytophthora parasitica CJ01A1]
 gb|ETP19227.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
Length=340

 Score =   234 bits (596),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 148/191 (77%), Gaps = 4/191 (2%)
 Frame = +1

Query  52   EVSVSMAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRP  231
            E S   AEHLA I GTE+DRVNCPFYFKIGACRHGDRCSRLH KP  S TIL+S+MYQ P
Sbjct  51   EQSGGGAEHLARIHGTEEDRVNCPFYFKIGACRHGDRCSRLHNKPVFSQTILVSHMYQNP  110

Query  232  DMITPGVDAQGRP--IDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVY  405
              I   +   G P  +D  ++ E FE+FYE++FEEL K+G++E LN+CDNL DH+VGNVY
Sbjct  111  --IAQVIAQNGDPASLDQRQVDEDFEDFYEEVFEELCKFGKLEELNICDNLGDHLVGNVY  168

Query  406  VQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHL  585
             ++ +EE AA A K L GRFYAGRP++ +FSPVTDFREA CRQ++E +CNRGGYCNFMH+
Sbjct  169  AKYEDEEHAAAAQKALYGRFYAGRPLVCEFSPVTDFREARCRQFDEGTCNRGGYCNFMHI  228

Query  586  KRISRELXRHL  618
            K +SR + R L
Sbjct  229  KTVSRSMQREL  239



>ref|XP_006638939.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like [Lepisosteus 
oculatus]
Length=192

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TI L N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNTAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   SADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVMDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>ref|XP_006424345.1| hypothetical protein CICLE_v10029043mg [Citrus clementina]
 ref|XP_006424347.1| hypothetical protein CICLE_v10029043mg [Citrus clementina]
 gb|ESR37585.1| hypothetical protein CICLE_v10029043mg [Citrus clementina]
 gb|ESR37587.1| hypothetical protein CICLE_v10029043mg [Citrus clementina]
Length=272

 Score =   231 bits (590),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +1

Query  217  MYQRPDMITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVG  396
            MYQR DMITPGVDAQG P+DP K+QEHFE+FYEDLFEEL+KYGEIESLN+CDNLADHMVG
Sbjct  1    MYQRLDMITPGVDAQGNPLDPRKIQEHFEDFYEDLFEELNKYGEIESLNICDNLADHMVG  60

Query  397  NVYVQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNF  576
            NVYVQFREEEQAA ALK+LSGRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNF
Sbjct  61   NVYVQFREEEQAARALKSLSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNF  120

Query  577  MHLKRISRELXRHLFG  624
            MHLKRISR+L R LFG
Sbjct  121  MHLKRISRDLRRQLFG  136



>ref|XP_007906997.1| PREDICTED: splicing factor U2AF 35 kDa subunit isoform X2 [Callorhinchus 
milii]
Length=269

 Score =   231 bits (589),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEH++EF+E++F E+  KYGEIE +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADGSHCAVGDVEMQEHYDEFFEEVFTEMEEKYGEIEEMNVCDNLGDHLVGNVYVKFRHE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVNDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>ref|XP_003083571.1| U2 snRNP auxiliary factor, small subunit (ISS) [Ostreococcus 
tauri]
Length=246

 Score =   230 bits (587),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 143/195 (73%), Gaps = 19/195 (10%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH KPS S T+LL+NMY+       
Sbjct  1    MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSASQTVLLTNMYR-------  53

Query  247  GVDAQGRPIDPHKM-----------QehfeefyedlfeeLSKYGEIESLNVCDNLADHMV  393
              +  G  +DP              Q HFE F EDLFEEL + GEIE +NVCDN  DHM 
Sbjct  54   -AEGAGGTVDPRDAASGKSASASAGQGHFEAFVEDLFEELDECGEIEGVNVCDNATDHMA  112

Query  394  GNVYVQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCN  573
            GNVYV+F +E+ A  AL+ L GR+Y GRPI+V++SPVTDF+E+TCRQYEENSC RGGYCN
Sbjct  113  GNVYVKFVDEDGARRALEKLQGRYYDGRPILVEYSPVTDFKESTCRQYEENSCTRGGYCN  172

Query  574  FMHLKRISRELXRHL  618
            FMHL+ I R + + L
Sbjct  173  FMHLRPIGRSMRKQL  187



>gb|KDO45605.1| hypothetical protein CISIN_1g024141mg [Citrus sinensis]
 gb|KDO45606.1| hypothetical protein CISIN_1g024141mg [Citrus sinensis]
 gb|KDO45607.1| hypothetical protein CISIN_1g024141mg [Citrus sinensis]
Length=272

 Score =   231 bits (589),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +1

Query  217  MYQRPDMITPGVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVG  396
            MYQR DMITPGVDAQG P+DP K+QEHFE+FYEDLFEEL+KYGEIESLN+CDNLADHMVG
Sbjct  1    MYQRLDMITPGVDAQGNPLDPRKIQEHFEDFYEDLFEELNKYGEIESLNICDNLADHMVG  60

Query  397  NVYVQFREEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNF  576
            NVYVQFREEEQAA ALK+LSGRFYAGRPIIVDFSPVTDFREATCRQYEEN+CNRGGYCNF
Sbjct  61   NVYVQFREEEQAARALKSLSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNF  120

Query  577  MHLKRISRELXRHLFG  624
            MHLKRISR+L R LFG
Sbjct  121  MHLKRISRDLRRQLFG  136



>ref|XP_004696962.1| PREDICTED: splicing factor U2AF 35 kDa subunit isoform X1 [Echinops 
telfairi]
 ref|XP_010596973.1| PREDICTED: splicing factor U2AF 35 kDa subunit isoform X3 [Loxodonta 
africana]
Length=192

 Score =   228 bits (582),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TI L N+Y+ P   + 
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   SADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>ref|XP_004570220.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like isoform X1 
[Maylandia zebra]
Length=269

 Score =   231 bits (589),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              DA    +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADASRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRHE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVMDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>ref|XP_010998043.1| PREDICTED: splicing factor U2AF 35 kDa subunit, partial [Camelus 
dromedarius]
Length=193

 Score =   228 bits (582),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TI L N+Y+ P   + 
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   SADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>ref|XP_006005852.1| PREDICTED: splicing factor U2AF 35 kDa subunit isoform X1 [Latimeria 
chalumnae]
Length=192

 Score =   228 bits (581),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TI L N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALMNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   SADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>gb|AAD13394.1| splicing factor U2AF35 [Takifugu rubripes]
Length=211

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TI L N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEHF+EF+E++F E+  KYGE+E +N+CDNL DH+VGNVYV+FR E
Sbjct  61   SADGLTCAVSDMQMQEHFDEFFEEVFSEMEEKYGEVEEMNICDNLGDHLVGNVYVKFRNE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>ref|XP_002610691.1| hypothetical protein BRAFLDRAFT_202693 [Branchiostoma floridae]
 gb|EEN66701.1| hypothetical protein BRAFLDRAFT_202693 [Branchiostoma floridae]
Length=197

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 144/188 (77%), Gaps = 2/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILMPNLYRNPQNSAQ  60

Query  247  GVD-AQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFRE  420
              D +    I   +MQEH++ F+E++F EL  KYGEIE +NVCDNL DH+VGNVYV+FR 
Sbjct  61   TADGSHCNNISDVEMQEHYDNFFEEVFTELEEKYGEIEEMNVCDNLGDHLVGNVYVKFRY  120

Query  421  EEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISR  600
            EE A  A+K+L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISR
Sbjct  121  EEDAEKAVKDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISR  180

Query  601  ELXRHLFG  624
            EL R L+G
Sbjct  181  ELRRELYG  188



>ref|XP_007253282.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like [Astyanax 
mexicanus]
Length=233

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TI L N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNTAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEE  426
              D      D    + + E F E   E   KYGE+E +NVCDNL DH+VGNVYV+FR EE
Sbjct  61   SADGLNAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREE  120

Query  427  QAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISREL  606
             A  A+ NL+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISREL
Sbjct  121  DAEKAVLNLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISREL  180

Query  607  XRHLFG  624
             R L+G
Sbjct  181  RRELYG  186



>ref|XP_005812275.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like isoform X2 
[Xiphophorus maculatus]
Length=227

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 2/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              DA  R +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADA-SRAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  119

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++  +PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  120  EDAEKAVMDLNNRWFNAQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  179

Query  604  LXRHLFG  624
            L R L+G
Sbjct  180  LRRELYG  186



>ref|XP_007906999.1| PREDICTED: splicing factor U2AF 35 kDa subunit isoform X3 [Callorhinchus 
milii]
Length=265

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TI L N+Y+ P   T 
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNLYRNPQNCTQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEH++EF+E++F E+  KYGEIE +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADGFHCAVGDVEMQEHYDEFFEEVFTEMEEKYGEIEEMNVCDNLGDHLVGNVYVKFRHE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVNDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>ref|XP_005526584.1| PREDICTED: splicing factor U2AF 35 kDa subunit isoform X5 [Pseudopodoces 
humilis]
Length=199

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADGSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFG  624
            L R L+G
Sbjct  181  LRRELYG  187



>ref|NP_001279955.1| U2 small nuclear RNA auxiliary factor 1 [Callorhinchus milii]
 gb|AFK11014.1| splicing factor U2AF35 [Callorhinchus milii]
 gb|AFM87316.1| U2 small nuclear RNA auxiliary factor 1 [Callorhinchus milii]
 gb|AFM88459.1| splicing factor [Callorhinchus milii]
 gb|AFM89041.1| splicing factor [Callorhinchus milii]
Length=269

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TI L N+Y+ P   T 
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNLYRNPQNCTQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEH++EF+E++F E+  KYGEIE +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADGFHCAVGDVEMQEHYDEFFEEVFTEMEEKYGEIEEMNVCDNLGDHLVGNVYVKFRHE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVNDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>ref|XP_008322811.1| PREDICTED: splicing factor U2AF 35 kDa subunit isoform X1 [Cynoglossus 
semilaevis]
Length=227

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TIL+ N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              DA    +   +MQEH++EF+E++F E+  KYGE+E +NVCDNL DH+VGNVYV+FR E
Sbjct  61   TADASRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++  +PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVMDLNNRWFNAQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFG  624
            L R L+G
Sbjct  181  LRRELYG  187



>ref|XP_003961766.1| PREDICTED: splicing factor U2AF 35 kDa subunit-like isoform 3 
[Takifugu rubripes]
Length=224

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHGDRCSRLH KP+ S TI L N+Y+ P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSAQ  60

Query  247  GVDAQGRPIDPHKMQehfeefyedlfeeLS-KYGEIESLNVCDNLADHMVGNVYVQFREE  423
              D     +   +MQEHF+EF+E++F E+  KYGE+E +N+CDNL DH+VGNVYV+FR E
Sbjct  61   SADGLTCAVSDMQMQEHFDEFFEEVFSEMEEKYGEVEEMNICDNLGDHLVGNVYVKFRNE  120

Query  424  EQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRE  603
            E A  A+ +L+ R++ G+PI  + SPVTDFREA CRQYE   C RGG+CNFMHLK ISRE
Sbjct  121  EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE  180

Query  604  LXRHLFGR  627
            L R L+GR
Sbjct  181  LRRELYGR  188



>ref|XP_011417402.1| PREDICTED: splicing factor U2AF 26 kDa subunit-like isoform X1 
[Crassostrea gigas]
Length=246

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 143/189 (76%), Gaps = 5/189 (3%)
 Frame = +1

Query  67   MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITP  246
            MAE+LASIFGTEKD+VNC FYFKIGACRHG+RCSRLH KP+ S T+L+ N+Y  P     
Sbjct  1    MAEYLASIFGTEKDKVNCSFYFKIGACRHGERCSRLHNKPTFSQTVLIENLYMNPQ--NT  58

Query  247  GVDAQGRPI---DPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFR  417
             + A G  I   D  ++Q+ ++EF+E+++ EL KYGEIE +NVCDNL DH+VGNVYV+FR
Sbjct  59   ALTADGSHIVQMDDTELQQFYDEFFEEVYVELEKYGEIEEMNVCDNLGDHLVGNVYVKFR  118

Query  418  EEEQAANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRIS  597
             EE A  A+  L+ R++ GRP+  + SPVTDFREA CRQYE   C RGG+CNFMHLK IS
Sbjct  119  YEEDAEKAVNELNNRWFNGRPVHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPIS  178

Query  598  RELXRHLFG  624
            REL R L+G
Sbjct  179  RELRRELYG  187



>ref|XP_009518861.1| hypothetical protein PHYSODRAFT_370516, partial [Phytophthora 
sojae]
 gb|EGZ23573.1| hypothetical protein PHYSODRAFT_370516 [Phytophthora sojae]
Length=203

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = +1

Query  70   AEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTILLSNMYQRPDMITPG  249
            AEHLA I GTE+DRVNCPFYFKIGACRHGDRCSRLH KP  S TIL+S+MYQ P      
Sbjct  1    AEHLARIHGTEEDRVNCPFYFKIGACRHGDRCSRLHNKPVFSQTILVSHMYQNPIAQVIA  60

Query  250  VDAQGRPIDPHKMQehfeefyedlfeeLSKYGEIESLNVCDNLADHMVGNVYVQFREEEQ  429
             +     +D   + E FE+FYE++FEEL K+G++E LN+CDNL DH+VGNVY ++ +EE 
Sbjct  61   QNGDPASLDQRHVDEEFEDFYEEVFEELCKFGKLEELNICDNLGDHLVGNVYAKYEDEEH  120

Query  430  AANALKNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENSCNRGGYCNFMHLKRISRELX  609
            AA A K L GRFYAGRP++ +FSPVTDFREA CRQ++E +CNRGGYCNFMH+K + R + 
Sbjct  121  AAAAQKALYGRFYAGRPLVCEFSPVTDFREARCRQFDEGTCNRGGYCNFMHIKTVPRSMQ  180

Query  610  RHLFGRYHR  636
            R L   ++R
Sbjct  181  RELERMFNR  189



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125