BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF025B13

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795633.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    347   1e-116   Nicotiana sylvestris
gb|ABI14552.1|  PPi-dependent phosphofructokinase beta subunit          332   2e-112   Cuscuta pentagona
sp|P21343.3|PFPB_SOLTU  RecName: Full=Pyrophosphate--fructose 6-p...    336   6e-109   Solanum tuberosum [potatoes]
ref|XP_011096009.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    323   9e-104   Sesamum indicum [beniseed]
gb|EYU27733.1|  hypothetical protein MIMGU_mgv1a003746mg                317   1e-101   Erythranthe guttata [common monkey flower]
gb|EYU33871.1|  hypothetical protein MIMGU_mgv1a003790mg                306   2e-97    Erythranthe guttata [common monkey flower]
gb|KJB67270.1|  hypothetical protein B456_010G184300                    300   8e-96    Gossypium raimondii
gb|KJB67275.1|  hypothetical protein B456_010G184300                    300   2e-95    Gossypium raimondii
ref|XP_007026198.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    298   3e-95    
ref|XP_008810438.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    288   4e-95    
ref|XP_008440051.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    300   8e-95    Cucumis melo [Oriental melon]
gb|KJB67269.1|  hypothetical protein B456_010G184300                    299   9e-95    Gossypium raimondii
gb|KJB67273.1|  hypothetical protein B456_010G184300                    299   1e-94    Gossypium raimondii
ref|XP_008458989.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    299   1e-94    Cucumis melo [Oriental melon]
ref|XP_007026197.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    299   1e-94    
ref|XP_010529463.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    298   3e-94    Tarenaya hassleriana [spider flower]
ref|XP_006449816.1|  hypothetical protein CICLE_v10014760mg             298   4e-94    Citrus clementina [clementine]
ref|XP_010099150.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    297   6e-94    Morus notabilis
ref|XP_006467368.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    297   6e-94    Citrus sinensis [apfelsine]
ref|XP_004169324.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    297   6e-94    
gb|KDO78376.1|  hypothetical protein CISIN_1g008424mg                   297   6e-94    Citrus sinensis [apfelsine]
gb|AAC67586.1|  pyrophosphate-dependent phosphofructokinase beta ...    297   7e-94    Citrus x paradisi [grapefruit]
ref|XP_004134783.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    297   7e-94    Cucumis sativus [cucumbers]
ref|XP_010529462.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    297   7e-94    Tarenaya hassleriana [spider flower]
gb|KJB69224.1|  hypothetical protein B456_011G011600                    295   1e-93    Gossypium raimondii
emb|CDP04453.1|  unnamed protein product                                296   1e-93    Coffea canephora [robusta coffee]
gb|KHG11353.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    293   1e-93    Gossypium arboreum [tree cotton]
gb|ADZ96379.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    296   2e-93    Eriobotrya japonica [loquat]
ref|XP_006383850.1|  hypothetical protein POPTR_0004s00550g             296   2e-93    Populus trichocarpa [western balsam poplar]
gb|KHG16419.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    294   3e-93    Gossypium arboreum [tree cotton]
gb|KJB69225.1|  hypothetical protein B456_011G011600                    295   4e-93    Gossypium raimondii
gb|KJB69223.1|  hypothetical protein B456_011G011600                    295   5e-93    Gossypium raimondii
ref|XP_004507660.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    295   7e-93    Cicer arietinum [garbanzo]
ref|XP_008364088.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    294   9e-93    Malus domestica [apple tree]
ref|XP_008805585.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    293   2e-92    Phoenix dactylifera
ref|XP_008224722.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    293   2e-92    Prunus mume [ume]
ref|XP_004293328.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    293   2e-92    Fragaria vesca subsp. vesca
gb|KDP20694.1|  hypothetical protein JCGZ_21165                         293   4e-92    Jatropha curcas
ref|XP_010928237.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    292   5e-92    Elaeis guineensis
ref|XP_009356464.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    292   6e-92    Pyrus x bretschneideri [bai li]
ref|XP_003529650.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    292   8e-92    Glycine max [soybeans]
ref|XP_009414122.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    291   9e-92    Musa acuminata subsp. malaccensis [pisang utan]
gb|AIE47260.1|  pyrophosphate-dependent phosphofructokinase             291   9e-92    Hevea brasiliensis [jebe]
gb|KCW75230.1|  hypothetical protein EUGRSUZ_E03983                     294   9e-92    Eucalyptus grandis [rose gum]
ref|XP_002269934.2|  PREDICTED: pyrophosphate--fructose 6-phospha...    291   1e-91    Vitis vinifera
ref|XP_007211880.1|  hypothetical protein PRUPE_ppa003518mg             291   1e-91    Prunus persica
ref|XP_003610482.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    291   2e-91    Medicago truncatula
emb|CDX98086.1|  BnaA06g08370D                                          290   3e-91    
ref|XP_009357501.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    290   3e-91    Pyrus x bretschneideri [bai li]
ref|XP_009148623.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    290   3e-91    Brassica rapa
ref|XP_007147679.1|  hypothetical protein PHAVU_006G145300g             290   3e-91    Phaseolus vulgaris [French bean]
ref|XP_003547272.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    290   3e-91    Glycine max [soybeans]
ref|XP_008384111.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    290   4e-91    
emb|CDY30046.1|  BnaC05g09740D                                          289   7e-91    Brassica napus [oilseed rape]
ref|XP_010057883.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    290   7e-91    Eucalyptus grandis [rose gum]
ref|XP_009391474.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    288   9e-91    
ref|XP_010476153.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    289   9e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010035533.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    289   1e-90    Eucalyptus grandis [rose gum]
ref|XP_011047000.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    288   1e-90    Populus euphratica
ref|XP_011002542.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    288   2e-90    Populus euphratica
ref|XP_010913416.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    288   2e-90    Elaeis guineensis
ref|XP_006417279.1|  hypothetical protein EUTSA_v10007237mg             288   2e-90    Eutrema salsugineum [saltwater cress]
ref|XP_009391472.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    288   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP11324.1|  unnamed protein product                                287   3e-90    Coffea canephora [robusta coffee]
ref|XP_010458622.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    288   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_002892669.1|  hypothetical protein ARALYDRAFT_888516             288   3e-90    Arabidopsis lyrata subsp. lyrata
ref|XP_010493617.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    286   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_004486196.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    286   1e-89    Cicer arietinum [garbanzo]
gb|KHN40852.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    283   1e-89    Glycine soja [wild soybean]
ref|XP_010533788.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    286   1e-89    Tarenaya hassleriana [spider flower]
ref|XP_006307130.1|  hypothetical protein CARUB_v10008719mg             286   2e-89    Capsella rubella
gb|KFK43462.1|  hypothetical protein AALP_AA1G128500                    285   2e-89    Arabis alpina [alpine rockcress]
ref|XP_009408423.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    285   3e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006287381.1|  hypothetical protein CARUB_v10000587mg             285   3e-89    Capsella rubella
ref|XP_010244159.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    285   4e-89    Nelumbo nucifera [Indian lotus]
ref|XP_002518416.1|  phosphofructokinase, putative                      285   4e-89    Ricinus communis
ref|NP_192313.3|  pyrophosphate--fructose-6-phosphate 1-phosphotr...    285   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001148574.1|  LOC100282190                                       285   5e-89    Zea mays [maize]
ref|XP_010546562.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    284   7e-89    Tarenaya hassleriana [spider flower]
ref|XP_002872678.1|  hypothetical protein ARALYDRAFT_490075             284   8e-89    
ref|XP_002317160.2|  pyrophosphate--fructose-6-phosphate 1-phosph...    284   8e-89    
ref|XP_003534704.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    284   9e-89    Glycine max [soybeans]
ref|XP_006826755.1|  hypothetical protein AMTR_s00136p00065750          284   9e-89    Amborella trichopoda
ref|NP_001168412.1|  ppi-phosphofructokinase                            284   1e-88    Zea mays [maize]
ref|XP_004145428.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    284   1e-88    Cucumis sativus [cucumbers]
ref|XP_007153992.1|  hypothetical protein PHAVU_003G082000g             283   2e-88    Phaseolus vulgaris [French bean]
sp|Q41141.1|PFPB_RICCO  RecName: Full=Pyrophosphate--fructose 6-p...    283   2e-88    Ricinus communis
ref|XP_002438147.1|  hypothetical protein SORBIDRAFT_10g008850          283   2e-88    Sorghum bicolor [broomcorn]
ref|XP_010686769.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    283   2e-88    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB67274.1|  hypothetical protein B456_010G184300                    282   3e-88    Gossypium raimondii
ref|NP_172664.1|  pyrophosphate--fructose-6-phosphate 1-phosphotr...    282   4e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004157729.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    282   4e-88    
ref|XP_010433059.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    281   1e-87    Camelina sativa [gold-of-pleasure]
gb|KDO54283.1|  hypothetical protein CISIN_1g042388mg                   281   1e-87    Citrus sinensis [apfelsine]
ref|XP_010496159.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    279   9e-87    Camelina sativa [gold-of-pleasure]
ref|XP_006447627.1|  hypothetical protein CICLE_v10017788mg             280   1e-86    
gb|AIE88316.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    278   1e-86    Eriobotrya japonica [loquat]
ref|XP_008379662.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    278   2e-86    
ref|XP_004965128.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    277   3e-86    Setaria italica
ref|XP_010422248.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    277   3e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006469757.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    277   4e-86    Citrus sinensis [apfelsine]
ref|XP_009365098.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    277   4e-86    
ref|XP_010422247.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    278   5e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006656840.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    276   6e-86    Oryza brachyantha
ref|XP_009788354.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    275   7e-86    Nicotiana sylvestris
ref|XP_006396720.1|  hypothetical protein EUTSA_v10028543mg             274   7e-86    
ref|XP_010252536.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    276   9e-86    Nelumbo nucifera [Indian lotus]
ref|XP_010089437.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    276   1e-85    Morus notabilis
ref|XP_009620787.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    275   1e-85    Nicotiana tomentosiformis
ref|XP_003594152.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    275   2e-85    Medicago truncatula
ref|XP_009788347.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    275   2e-85    Nicotiana sylvestris
ref|XP_006396719.1|  hypothetical protein EUTSA_v10028543mg             274   6e-85    Eutrema salsugineum [saltwater cress]
ref|XP_008230005.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    274   1e-84    Prunus mume [ume]
gb|AAC28214.1|  contains similarity to phosphofructokinases (Pfam...    274   1e-84    Arabidopsis thaliana [mouse-ear cress]
gb|KFK30957.1|  hypothetical protein AALP_AA6G049400                    273   1e-84    Arabis alpina [alpine rockcress]
ref|NP_001057284.1|  Os06g0247500                                       273   2e-84    
gb|ABK26333.1|  unknown                                                 265   3e-84    Picea sitchensis
ref|XP_007215516.1|  hypothetical protein PRUPE_ppa003662mg             271   5e-84    Prunus persica
gb|AAC17614.1|  Similar to pyrophosphate-dependent phosphofuctoki...    271   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114586.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    270   2e-83    Brassica rapa
ref|XP_003564006.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    270   3e-83    Brachypodium distachyon [annual false brome]
ref|XP_004243522.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    269   3e-83    Solanum lycopersicum
gb|KDO54287.1|  hypothetical protein CISIN_1g008310mg                   270   3e-83    Citrus sinensis [apfelsine]
ref|XP_007049157.1|  Phosphofructokinase family protein                 269   5e-83    
gb|KJB69226.1|  hypothetical protein B456_011G011600                    268   7e-83    Gossypium raimondii
ref|XP_006447633.1|  hypothetical protein CICLE_v10014750mg             268   9e-83    Citrus clementina [clementine]
ref|XP_006357957.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    267   2e-82    Solanum tuberosum [potatoes]
emb|CDX94541.1|  BnaC09g22950D                                          269   2e-82    
ref|XP_002271059.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    267   3e-82    Vitis vinifera
ref|XP_004305986.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    266   5e-82    Fragaria vesca subsp. vesca
dbj|BAJ85690.1|  predicted protein                                      266   6e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07581.1|  predicted protein                                      266   8e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004955203.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    264   4e-81    Setaria italica
gb|KHN03504.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    250   3e-77    Glycine soja [wild soybean]
ref|XP_001773466.1|  predicted protein                                  247   1e-74    
gb|KJB42857.1|  hypothetical protein B456_007G170900                    245   9e-74    Gossypium raimondii
ref|XP_002984967.1|  hypothetical protein SELMODRAFT_234662             244   1e-73    Selaginella moellendorffii
ref|XP_002986153.1|  hypothetical protein SELMODRAFT_234963             243   4e-73    Selaginella moellendorffii
ref|XP_001770321.1|  predicted protein                                  241   3e-72    
ref|XP_001774878.1|  predicted protein                                  238   4e-71    
gb|EPS65871.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    233   8e-70    Genlisea aurea
ref|XP_009610530.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    231   9e-69    
gb|AGR67383.1|  pyrophosphate-dependent phosphofructokinase beta ...    216   1e-67    Citrus reshni [Cleopatra mandarin]
ref|XP_011086211.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    214   1e-66    Sesamum indicum [beniseed]
ref|NP_001275324.1|  pyrophosphate--fructose 6-phosphate 1-phosph...    224   2e-66    Solanum tuberosum [potatoes]
ref|XP_010316565.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    222   2e-65    
gb|AGY61468.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    214   8e-65    Rorippa sylvestris
gb|AGY61467.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    214   1e-64    Rorippa amphibia
gb|KHN27784.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    206   1e-62    Glycine soja [wild soybean]
emb|CDY34604.1|  BnaC08g41630D                                          205   4e-59    Brassica napus [oilseed rape]
gb|EMT25675.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    206   4e-59    
gb|KJB67271.1|  hypothetical protein B456_010G184300                    192   2e-54    Gossypium raimondii
ref|XP_005707151.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    176   7e-48    Galdieria sulphuraria
ref|XP_008788881.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    145   4e-40    
ref|WP_007133749.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   1e-38    Prevotella salivae
gb|EFB33295.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    149   5e-38    Prevotella oris F0302
emb|CBJ31829.1|  RecName: Full=Pyrophosphate--fructose 6-phosphat...    151   9e-38    Ectocarpus siliculosus
ref|WP_004376175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   1e-37    Prevotella oris
ref|WP_036890490.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   2e-37    Prevotella oris
ref|WP_026285932.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   2e-37    Prevotella
ref|WP_021896515.1|  pyrophosphate-dependent phosphofructokinase        147   2e-37    
ref|WP_024989602.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   4e-37    Prevotella albensis
ref|WP_025790489.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   4e-37    Prevotella histicola
ref|WP_022311541.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   4e-37    
ref|WP_025839858.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   1e-36    Prevotella scopos
ref|WP_009010591.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   1e-36    Prevotella
ref|WP_007366298.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   2e-36    Prevotella multiformis
ref|XP_011402204.1|  ATP-dependent zinc metalloprotease FTSH 5, m...    147   2e-36    Auxenochlorella protothecoides
ref|WP_036927708.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   2e-36    Prevotella timonensis
ref|WP_009434216.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   2e-36    Prevotella sp. oral taxon 306
gb|EGV34403.1|  diphosphate-fructose-6-phosphate 1-phosphotransfe...    144   2e-36    Prevotella oulorum F0390
ref|WP_040561026.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   2e-36    Prevotella oulorum
ref|WP_036869025.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   2e-36    Prevotella histicola
ref|WP_008822440.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   2e-36    Prevotella histicola
ref|WP_004383638.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   3e-36    Prevotella veroralis
ref|WP_018909818.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   3e-36    Prevotella veroralis
gb|ERK00034.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    144   3e-36    Prevotella pleuritidis F0068
ref|WP_025877362.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   4e-36    Prevotella corporis
ref|WP_018464632.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   4e-36    Prevotella paludivivens
ref|WP_008121761.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   4e-36    Prevotella timonensis
ref|WP_022252312.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   4e-36    
ref|WP_028909804.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   5e-36    Prevotella sp. AGR2160
ref|WP_028896044.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   5e-36    Prevotella sp. HUN102
gb|KJB67272.1|  hypothetical protein B456_010G184300                    142   6e-36    Gossypium raimondii
ref|WP_021940332.1|  hypothetical protein                               142   7e-36    
ref|WP_013265533.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   7e-36    Prevotella melaninogenica
ref|WP_036925131.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   7e-36    Prevotella sp. ICM33
ref|WP_036865072.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   8e-36    Prevotella melaninogenica
ref|WP_024467519.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   8e-36    Treponema pedis
ref|WP_036872035.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   9e-36    Prevotella buccalis
ref|WP_039876710.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   9e-36    Prevotella pleuritidis
ref|WP_025065627.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   9e-36    Prevotella enoeca
ref|WP_024991268.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   9e-36    Prevotella pleuritidis
ref|WP_028912949.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   1e-35    Prevotella sp. MA2016
ref|WP_021854968.1|  phosphofructokinase                                142   1e-35    
ref|WP_020966487.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   1e-35    Treponema pedis
ref|WP_025071710.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   1e-35    Prevotella timonensis
ref|WP_007172919.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   1e-35    Prevotella bergensis
ref|WP_004290431.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   1e-35    Bacteroides eggerthii
ref|WP_013672124.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   2e-35    Prevotella denticola
ref|WP_004292707.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   2e-35    Bacteroides eggerthii
ref|WP_008564004.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   2e-35    Prevotella maculosa
ref|WP_021671600.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   2e-35    Prevotella sp. F0091
ref|WP_010663795.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   2e-35    Marinilabilia salmonicolor
ref|WP_004359492.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   2e-35    Prevotella melaninogenica
ref|WP_018028382.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   2e-35    Porphyromonas somerae
ref|WP_025067563.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   2e-35    Prevotella denticola
ref|WP_036854388.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   2e-35    Prevotella denticola
ref|WP_004353492.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   2e-35    Prevotella denticola
ref|WP_019967261.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   3e-35    Prevotella maculosa
ref|WP_038563379.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   3e-35    Draconibacterium orientale
ref|WP_023058711.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    140   3e-35    Prevotella
ref|WP_007574011.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   3e-35    Prevotella multisaccharivorax
ref|WP_036897542.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   3e-35    Prevotella sp. S7 MS 2
ref|WP_009229809.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   3e-35    Prevotella sp. oral taxon 317
ref|WP_007412056.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   3e-35    Prevotella
ref|WP_004345857.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   3e-35    Prevotella buccae
ref|WP_025070337.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   3e-35    Prevotella oulorum
ref|WP_004340656.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   4e-35    Prevotella buccae
ref|WP_019893247.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   4e-35    Allobaculum stercoricanis
ref|WP_013758252.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   5e-35    Treponema brennaborense
ref|WP_021964522.1|  phosphofructokinase                                140   5e-35    
gb|KJF43929.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    140   5e-35    Draconibacterium sediminis
ref|WP_009036817.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    137   5e-35    
ref|WP_036650726.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   6e-35    Parabacteroides
ref|WP_009123978.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   6e-35    Bacteroides fluxus
ref|WP_005798671.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   6e-35    Bacteroides fragilis
ref|WP_036613717.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   6e-35    Parabacteroides distasonis
ref|WP_008771783.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   6e-35    Bacteroidales
ref|WP_005855923.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    140   6e-35    Bacteroidales
ref|WP_014223699.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   8e-35    Tannerella forsythia
ref|WP_025798196.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   8e-35    Prevotella saccharolytica
ref|WP_022150455.1|  phosphofructokinase                                139   9e-35    
ref|WP_026625143.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   9e-35    Dysgonomonas capnocytophagoides
ref|WP_009161991.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   9e-35    Prevotella saccharolytica
ref|WP_005815165.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   1e-34    Bacteroides fragilis
ref|WP_032583802.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   1e-34    Bacteroides fragilis
ref|WP_005788903.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    139   1e-34    Bacteroides
ref|WP_007658653.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    139   1e-34    Parabacteroides
ref|WP_032590268.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   1e-34    Bacteroides fragilis
ref|WP_005780146.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    139   1e-34    Bacteroides
gb|EXZ67313.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    139   1e-34    Bacteroides fragilis str. 3783N1-8
ref|WP_019188428.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   1e-34    Prevotella conceptionensis
ref|WP_028727537.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   2e-34    Parabacteroides
ref|WP_004350381.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   2e-34    Prevotella buccalis
ref|WP_036787718.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   2e-34    Phocaeicola abscessus
ref|WP_006798230.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   2e-34    Dysgonomonas gadei
ref|WP_035455514.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   2e-34    Bacteroidetes bacterium oral taxon 272
ref|WP_036877364.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   2e-34    Prevotella oryzae
gb|EPT34726.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    138   2e-34    Bacteroidetes bacterium oral taxon 272 str. F0290
ref|WP_018669292.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   2e-34    Bacteroides gallinarum
ref|WP_006952714.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   2e-34    Prevotella micans
ref|WP_005846772.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   2e-34    Prevotella dentalis
ref|WP_027951653.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   2e-34    [Hallella] seregens
ref|WP_021851985.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   2e-34    
ref|WP_022163440.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    138   3e-34    
ref|WP_024752338.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   3e-34    Treponema phagedenis
ref|WP_025002795.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   3e-34    Prevotella dentasini
ref|WP_002701079.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   3e-34    Treponema phagedenis
ref|WP_036893684.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   4e-34    Prevotella sp. S7-1-8
ref|WP_008158638.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   4e-34    Parabacteroides johnsonii
ref|WP_023983193.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    137   4e-34    Prevotella
ref|WP_022322946.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   4e-34    Parabacteroides merdae
ref|WP_005647732.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   5e-34    Parabacteroides merdae
ref|WP_009235627.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   5e-34    Prevotella sp. oral taxon 472
emb|CBK24494.2|  unnamed protein product                                137   5e-34    Blastocystis hominis
ref|WP_005826644.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    137   5e-34    Bacteroides
ref|WP_009346441.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   6e-34    Alloprevotella rava
ref|WP_009317720.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    137   6e-34    Bacteroidales
ref|WP_009227259.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   6e-34    Prevotella sp. oral taxon 299
ref|WP_044468201.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   6e-34    Bacteroides uniformis
ref|WP_018966518.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   6e-34    Prevotella loescheii
ref|WP_008145850.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    137   7e-34    Parabacteroides johnsonii
ref|WP_037983302.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   7e-34    
ref|WP_037997392.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   7e-34    
ref|WP_004362686.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    137   7e-34    Prevotella nigrescens
ref|WP_028908471.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   9e-34    Prevotella ruminicola
ref|WP_004370527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   9e-34    Prevotella oralis
ref|WP_013064630.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   9e-34    Prevotella ruminicola
ref|WP_033149315.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   9e-34    
ref|WP_009216741.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   9e-34    
ref|WP_018361565.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_022491531.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_008448175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_036856523.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_019036414.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_009120576.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_013182152.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
emb|CCB91524.1|  pyrophosphate--fructose 6-phosphate 1-phosphotra...    136   1e-33    
ref|WP_022023024.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_022458553.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_006255527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_013548412.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_014271836.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_022454393.1|  phosphofructokinase                                136   1e-33    
ref|WP_028899167.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_021916966.1|  diphosphate--fructose-6-phosphate 1-phosphot...    136   1e-33    
ref|WP_028903737.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    135   1e-33    
ref|WP_018358521.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
ref|WP_022217804.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
ref|WP_021990869.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
ref|WP_036866222.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
ref|WP_022482432.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
ref|WP_005640886.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
ref|WP_027470899.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
ref|WP_004337289.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
ref|WP_022040715.1|  diphosphate/fructose-6-phosphate 1-phosphotr...    135   2e-33    
ref|WP_029901822.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
ref|WP_013617020.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
ref|WP_036864816.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   2e-33    
emb|CEA17138.1|  Pyrophosphate-fructose 6-phosphate 1-phosphotran...    135   2e-33    
ref|WP_021945700.1|  diphosphate/fructose-6-phosphate1-phosphotra...    135   3e-33    
ref|WP_023924546.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    135   3e-33    
ref|WP_022081702.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    135   3e-33    
ref|WP_022437430.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    135   3e-33    
ref|WP_022480045.1|  diphosphate--fructose-6-phosphate 1-phosphot...    135   3e-33    
ref|XP_005850148.1|  hypothetical protein CHLNCDRAFT_34452              135   3e-33    
ref|WP_025081450.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   4e-33    
ref|WP_022458961.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   4e-33    
ref|WP_022511727.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   4e-33    
gb|EMS58307.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    134   5e-33    
ref|WP_021663363.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   5e-33    
ref|WP_013815410.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   5e-33    
ref|WP_004583807.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   5e-33    
ref|WP_012457385.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   6e-33    
ref|WP_023847292.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   6e-33    
ref|WP_021677112.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   6e-33    
ref|WP_010422435.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   7e-33    
ref|WP_016777789.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   7e-33    
ref|WP_006947947.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   7e-33    
ref|WP_022328315.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   8e-33    
ref|WP_025863645.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   8e-33    
ref|WP_022486127.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   8e-33    
ref|WP_021947313.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   8e-33    
ref|WP_005923725.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    134   9e-33    
ref|WP_014625405.1|  diphosphate--fructose-6-phosphate 1-phosphot...    134   1e-32    
ref|WP_013314522.1|  diphosphate--fructose-6-phosphate 1-phosphot...    133   1e-32    
ref|WP_007570582.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    133   1e-32    
ref|WP_022103660.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    133   1e-32    
ref|WP_016661325.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    133   1e-32    
ref|WP_021667347.1|  diphosphate--fructose-6-phosphate 1-phosphot...    133   1e-32    
ref|WP_022406493.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    133   1e-32    
ref|WP_025001065.1|  diphosphate--fructose-6-phosphate 1-phosphot...    133   1e-32    
ref|WP_036911117.1|  diphosphate--fructose-6-phosphate 1-phosphot...    133   1e-32    
gb|EDS15317.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    133   1e-32    
ref|WP_021892263.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    133   1e-32    
ref|WP_008861193.1|  diphosphate--fructose-6-phosphate 1-phosphot...    133   1e-32    
ref|WP_022442023.1|  diphosphate--fructose-6-phosphate 1-phosphot...    133   1e-32    
ref|WP_006044710.1|  diphosphate--fructose-6-phosphate 1-phosphot...    133   1e-32    
ref|WP_010527175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    133   2e-32    
ref|WP_019540988.1|  diphosphate--fructose-6-phosphate 1-phosphot...    133   2e-32    
ref|WP_013607434.1|  diphosphate--fructose-6-phosphate 1-phosphot...    132   2e-32    
ref|XP_011133570.1|  phosphofructokinase                                135   2e-32    
gb|KHN19126.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    125   2e-32    
ref|WP_036829398.1|  diphosphate--fructose-6-phosphate 1-phosphot...    132   2e-32    
ref|WP_021909549.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   3e-32    
ref|WP_025881004.1|  diphosphate--fructose-6-phosphate 1-phosphot...    132   3e-32    
ref|WP_021589756.1|  diphosphate--fructose-6-phosphate 1-phosphot...    132   3e-32    
ref|WP_028904978.1|  diphosphate--fructose-6-phosphate 1-phosphot...    132   3e-32    
ref|WP_014709913.1|  diphosphate--fructose-6-phosphate 1-phosphot...    132   3e-32    
ref|WP_002561703.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    132   4e-32    
ref|WP_025004727.1|  diphosphate--fructose-6-phosphate 1-phosphot...    132   4e-32    
ref|WP_025079520.1|  diphosphate--fructose-6-phosphate 1-phosphot...    132   4e-32    
ref|WP_036851359.1|  diphosphate--fructose-6-phosphate 1-phosphot...    132   5e-32    
ref|WP_026475518.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   5e-32    
ref|WP_004365932.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   5e-32    
ref|WP_044233209.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   5e-32    
ref|WP_009437358.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   5e-32    
ref|WP_044190829.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   5e-32    
ref|WP_022231625.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   5e-32    
ref|WP_041419260.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   6e-32    
ref|WP_006745515.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   6e-32    
ref|XP_005711056.1|  unnamed protein product                            131   6e-32    
emb|CCB88843.1|  pyrophosphate--fructose 6-phosphate 1-phosphotra...    131   6e-32    
ref|WP_021662033.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   6e-32    
ref|WP_022102965.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   6e-32    
ref|WP_039420029.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    131   7e-32    
ref|WP_006843040.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   7e-32    
ref|WP_039426896.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   7e-32    
ref|WP_039419596.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   7e-32    
gb|AIN94596.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    131   7e-32    
ref|WP_009433397.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   8e-32    
ref|WP_022385737.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   8e-32    
ref|WP_002682935.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    131   8e-32    
ref|WP_044115791.1|  diphosphate--fructose-6-phosphate 1-phosphot...    131   8e-32    
ref|WP_013968126.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   9e-32    
ref|WP_022121202.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   9e-32    
ref|WP_025278280.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   9e-32    
ref|WP_026292223.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   1e-31    
ref|WP_006846630.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   1e-31    
ref|WP_005467407.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   1e-31    
ref|WP_022130193.1|  hypothetical protein                               130   1e-31    
ref|WP_044168564.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   1e-31    
gb|EKE04636.1|  hypothetical protein ACD_20C00035G0001                  130   1e-31    
ref|WP_002678239.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    130   1e-31    
ref|WP_021931216.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    130   1e-31    
gb|AJA89874.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    130   1e-31    
ref|WP_002669081.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   1e-31    
ref|WP_010699412.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    130   1e-31    
ref|WP_010956991.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   1e-31    
ref|WP_002693855.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    130   1e-31    
gb|EKD26922.1|  hypothetical protein ACD_79C00968G0001                  130   2e-31    
gb|KDU78280.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    131   2e-31    
ref|WP_044227866.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   2e-31    
ref|WP_021864006.1|  diphosphate--fructose-6-phosphate 1-phosphot...    130   2e-31    
ref|WP_007902847.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    129   2e-31    
ref|WP_032125634.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   2e-31    
ref|WP_022353894.1|  hypothetical protein                               129   2e-31    
ref|WP_022111322.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   3e-31    
ref|WP_044072458.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   3e-31    
ref|WP_028512698.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   3e-31    
ref|WP_004357175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   3e-31    
ref|WP_042372185.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   3e-31    
ref|WP_021687206.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   3e-31    
ref|WP_021670104.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   4e-31    
ref|WP_036881935.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   4e-31    
gb|EFW24308.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    129   4e-31    
ref|WP_011193374.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   4e-31    
ref|WP_016562813.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    129   4e-31    
ref|WP_040627712.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   4e-31    
ref|WP_022499090.1|  pyrophosphate-dependent phosphofructokinase        129   4e-31    
ref|WP_010697336.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    129   5e-31    
ref|WP_008144348.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    129   5e-31    
ref|WP_028077990.1|  diphosphate--fructose-6-phosphate 1-phosphot...    129   5e-31    
ref|WP_044533074.1|  diphosphate--fructose-6-phosphate 1-phosphot...    128   6e-31    
ref|WP_022315998.1|  MULTISPECIES: phosphofructokinase                  128   7e-31    
ref|WP_034542387.1|  diphosphate--fructose-6-phosphate 1-phosphot...    128   7e-31    
ref|WP_021980053.1|  diphosphate--fructose-6-phosphate 1-phosphot...    128   8e-31    
ref|WP_008627564.1|  diphosphate--fructose-6-phosphate 1-phosphot...    128   8e-31    
emb|CDZ81362.1|  6-phosphofructokinase                                  128   8e-31    
ref|WP_021887993.1|  diphosphate--fructose-6-phosphate 1-phosphot...    128   1e-30    
ref|WP_020613720.1|  diphosphate--fructose-6-phosphate 1-phosphot...    128   1e-30    
ref|WP_022158214.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   1e-30    
ref|WP_007663913.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   1e-30    
ref|WP_008622743.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   1e-30    
ref|WP_021966993.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   1e-30    
ref|WP_024994586.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   1e-30    
ref|WP_014455241.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   1e-30    
ref|WP_022392567.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    127   1e-30    
ref|WP_044264258.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   1e-30    
ref|WP_007214428.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    127   1e-30    
ref|WP_037547210.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   1e-30    
gb|KFH09878.1|  phosphofructokinase PFKII                               125   1e-30    
ref|WP_018109477.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   2e-30    
ref|WP_027449768.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   2e-30    
ref|WP_027456161.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   2e-30    
ref|WP_036851063.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   2e-30    
ref|WP_036848678.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   2e-30    
ref|WP_036853877.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   2e-30    
ref|WP_009131195.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    127   2e-30    
ref|WP_003865759.1|  hypothetical protein                               125   2e-30    
ref|WP_016276863.1|  MULTISPECIES: diphosphate-fructose-6-phospha...    127   2e-30    
ref|WP_031534286.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    127   2e-30    
ref|WP_013254833.1|  diphosphate--fructose-6-phosphate 1-phosphot...    127   3e-30    
ref|WP_002689303.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    127   3e-30    
ref|WP_028973346.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   3e-30    
ref|WP_025831498.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   3e-30    
ref|WP_022020075.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    126   3e-30    
ref|WP_021846571.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    126   3e-30    
ref|WP_021914328.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   3e-30    
ref|WP_014545075.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   4e-30    
ref|WP_025017895.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   4e-30    
ref|WP_008652858.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    126   4e-30    
ref|WP_007842406.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    126   4e-30    
gb|EST45668.1|  Pyrophosphate-fructose 6-phosphate 1-phosphotrans...    126   4e-30    
ref|WP_022245848.1|  hypothetical protein                               126   4e-30    
ref|WP_006189908.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   4e-30    
ref|WP_039865086.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   4e-30    
ref|WP_016518245.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    126   4e-30    
ref|WP_022356272.1|  pyrophosphate-dependent phosphofructokinase        126   4e-30    
ref|WP_007837134.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   4e-30    
ref|WP_015535442.1|  pyrophosphate-dependent phosphofructokinase        126   4e-30    
ref|WP_035646621.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   4e-30    
ref|WP_016524203.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    126   4e-30    
ref|WP_038605987.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   4e-30    
ref|WP_021645136.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   4e-30    
ref|WP_032945214.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   4e-30    
ref|WP_004798470.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   5e-30    
ref|WP_027435625.1|  diphosphate--fructose-6-phosphate 1-phosphot...    126   5e-30    
ref|WP_005846138.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    125   5e-30    
ref|WP_015711192.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   5e-30    
gb|KFG51922.1|  phosphofructokinase PFKII                               125   5e-30    
ref|WP_032985407.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   6e-30    
ref|XP_005536036.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    126   6e-30    
ref|WP_007757428.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   6e-30    
ref|WP_028507542.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   7e-30    
ref|WP_022351630.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   7e-30    
ref|WP_041572541.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   8e-30    
ref|WP_007758927.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   8e-30    
dbj|BAG83826.1|  pyrophosphate--fructose-6-phosphate 1-phosphotra...    125   8e-30    
ref|WP_006434131.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   9e-30    
ref|WP_036790212.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    125   9e-30    
ref|WP_036869019.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   9e-30    
ref|WP_022275035.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   1e-29    
ref|WP_029346829.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   1e-29    
ref|WP_034931503.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   1e-29    
ref|WP_027325820.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   1e-29    
ref|WP_004792184.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   1e-29    
ref|WP_007561750.1|  diphosphate--fructose-6-phosphate 1-phosphot...    125   1e-29    
ref|WP_022053735.1|  hypothetical protein                               125   1e-29    



>ref|XP_009795633.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Nicotiana sylvestris]
Length=306

 Score =   347 bits (890),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 177/194 (91%), Gaps = 2/194 (1%)
 Frame = +1

Query  82   APAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSA  255
            A  ISLL N D+AS+  S  TGRYASVYSEVQNSRLDHPLPLPSVL   FKVVDGP SSA
Sbjct  3    AATISLLFNGDLASSVKSQGTGRYASVYSEVQNSRLDHPLPLPSVLGSPFKVVDGPPSSA  62

Query  256  AGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDY  435
            AGHPEEI KLFP LFGQPS +LVPDDSGDVAMN +LKIGVVLSGGQAPGGHNVISGIFD+
Sbjct  63   AGHPEEIGKLFPSLFGQPSVSLVPDDSGDVAMNQSLKIGVVLSGGQAPGGHNVISGIFDF  122

Query  436  LQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQ  615
            LQ HCKGSTLYGFRGGPAGIMKCKYV+LTPEYIYPYRNQGGFDMICSGRDKIETP+QFKQ
Sbjct  123  LQTHCKGSTLYGFRGGPAGIMKCKYVVLTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQ  182

Query  616  AEETAKKLDLDGLV  657
            AEETAKKLDLDGLV
Sbjct  183  AEETAKKLDLDGLV  196



>gb|ABI14552.1| PPi-dependent phosphofructokinase beta subunit [Cuscuta pentagona]
Length=203

 Score =   332 bits (852),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = +1

Query  142  RYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAAL  321
            R ASVYSEVQNSRLDH LPLPSVLRK FKVVDGPASSAAGHPEEIAKLFP L+GQPSAAL
Sbjct  1    RVASVYSEVQNSRLDHHLPLPSVLRKPFKVVDGPASSAAGHPEEIAKLFPCLYGQPSAAL  60

Query  322  VPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMK  501
            VPDDSGDVAM  +LKIGVVLSGGQAPGGHNVISGIFDYLQ+HCKGSTLYGFRGGPAGIMK
Sbjct  61   VPDDSGDVAMGQSLKIGVVLSGGQAPGGHNVISGIFDYLQDHCKGSTLYGFRGGPAGIMK  120

Query  502  CKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            CKYV+LTPEYIYPYRNQGGFDMICSGRDKIETP+QFKQAEETA+KLDLDGLV
Sbjct  121  CKYVVLTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAQKLDLDGLV  172



>sp|P21343.3|PFPB_SOLTU RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Solanum tuberosum]
Length=569

 Score =   336 bits (862),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +1

Query  82   APAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSA  255
            A  +SLL N ++AS+  S  TGRYA+VYSEVQNSRLDHPLPLPSVL   FKVVDGP SSA
Sbjct  3    AATLSLLNNGELASSVKSPGTGRYAAVYSEVQNSRLDHPLPLPSVLGSPFKVVDGPPSSA  62

Query  256  AGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDY  435
            AGHPEEIAKLFP L+GQP  +LVPDDSGDVAMN  LKIGVVLSGGQAPGGHNVISGIFDY
Sbjct  63   AGHPEEIAKLFPSLYGQPCVSLVPDDSGDVAMNQILKIGVVLSGGQAPGGHNVISGIFDY  122

Query  436  LQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQ  615
            LQ HCKGST+YGFRGGPAG+MK KYV+LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQ
Sbjct  123  LQTHCKGSTMYGFRGGPAGVMKGKYVVLTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQ  182

Query  616  AEETAKKLDLDGLV  657
            AEETAKKLDLDGLV
Sbjct  183  AEETAKKLDLDGLV  196



>ref|XP_011096009.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit beta [Sesamum indicum]
Length=568

 Score =   323 bits (827),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = +1

Query  88   AISLLANSDIASAKT-STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGH  264
            A +++AN D A+AKT S GRYA+VYSEVQNSRLDHPLPLPSVL+ SFKVVDGP SSAAG+
Sbjct  2    AAAVVANGDYAAAKTPSAGRYAAVYSEVQNSRLDHPLPLPSVLKNSFKVVDGPPSSAAGN  61

Query  265  PEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQE  444
            P+EIAKLFP LFGQPSA LVP DS D      LKIGVVLSGGQAPGGHNVISGIFDYLQ+
Sbjct  62   PDEIAKLFPCLFGQPSADLVPADSSDSLPGRGLKIGVVLSGGQAPGGHNVISGIFDYLQD  121

Query  445  HCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEE  624
             CKGSTLYGFRGGPAGIMKCKY++LT EYIYPYRNQGGFDMICSGRDKIETP+QFKQAEE
Sbjct  122  RCKGSTLYGFRGGPAGIMKCKYIVLTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEE  181

Query  625  TAKKLDLDGLV  657
            T+ KLDLDGLV
Sbjct  182  TSVKLDLDGLV  192



>gb|EYU27733.1| hypothetical protein MIMGU_mgv1a003746mg [Erythranthe guttata]
Length=566

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = +1

Query  88   AISLLANSDIASAKT-STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGH  264
            A +L++N D A+ KT S GR A+VYSEVQNSRLDHPLPLPSVL+ SFKVVDGP SSAAG+
Sbjct  3    AATLVSNGDHAAFKTPSAGRQAAVYSEVQNSRLDHPLPLPSVLKNSFKVVDGPPSSAAGN  62

Query  265  PEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQE  444
            P+EIAKLFP LFGQPSA LVP DS D +++ +LKIGVVLSGGQAPGGHNVISGIFDYLQ+
Sbjct  63   PDEIAKLFPSLFGQPSANLVPGDSTDNSLSKSLKIGVVLSGGQAPGGHNVISGIFDYLQD  122

Query  445  HCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEE  624
             CKGSTLYGFRGGPAGIMK KYV+LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQAE+
Sbjct  123  RCKGSTLYGFRGGPAGIMKGKYVVLTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAED  182

Query  625  TAKKLDLDGLV  657
            T+ KLDLDGLV
Sbjct  183  TSVKLDLDGLV  193



>gb|EYU33871.1| hypothetical protein MIMGU_mgv1a003790mg [Erythranthe guttata]
Length=564

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 171/194 (88%), Gaps = 4/194 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTST-GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSA  255
            MAP  +L+AN ++A  K+ T GRYA+VYSEVQNSRLDHPLPLPSVL+K FKVVDGP SSA
Sbjct  1    MAPP-ALVANGNVADVKSPTAGRYAAVYSEVQNSRLDHPLPLPSVLKKPFKVVDGPPSSA  59

Query  256  AGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDY  435
            AG+P+EIAKLFP LFGQPSAALVPD +   +    LKIGVVLSGGQAPGGHNVISGIFDY
Sbjct  60   AGNPDEIAKLFPCLFGQPSAALVPDSNN--SSGQALKIGVVLSGGQAPGGHNVISGIFDY  117

Query  436  LQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQ  615
            LQ+ CKGSTLYGFRGGPAGIMK KYV+L  ++IYPYRNQGGFDMICSGRDKIETP+QFKQ
Sbjct  118  LQDRCKGSTLYGFRGGPAGIMKGKYVVLNSDFIYPYRNQGGFDMICSGRDKIETPEQFKQ  177

Query  616  AEETAKKLDLDGLV  657
            AE+T+ KLDLDGLV
Sbjct  178  AEDTSVKLDLDGLV  191



>gb|KJB67270.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=480

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 165/195 (85%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAP  S + N D+A+ KT+   GR ASVYSEVQ SR+DH LP+PSVLR  FK+VDGPASS
Sbjct  1    MAP--SFVTNGDVAAVKTTPFAGRLASVYSEVQTSRIDHALPVPSVLRSPFKIVDGPASS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPS+ LVP+   ++  +  LKIGVVLSGGQAPGGHNVISGIFD
Sbjct  59   AAGNPDEIAKLFPNLFGQPSSMLVPNGVDNIGSDQKLKIGVVLSGGQAPGGHNVISGIFD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQE   GSTLYGF+GGPAGIMK KYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQERAPGSTLYGFKGGPAGIMKGKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QAEETA KLDLDGLV
Sbjct  179  QAEETAAKLDLDGLV  193



>gb|KJB67275.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=502

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 165/195 (85%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAP  S + N D+A+ KT+   GR ASVYSEVQ SR+DH LP+PSVLR  FK+VDGPASS
Sbjct  1    MAP--SFVTNGDVAAVKTTPFAGRLASVYSEVQTSRIDHALPVPSVLRSPFKIVDGPASS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPS+ LVP+   ++  +  LKIGVVLSGGQAPGGHNVISGIFD
Sbjct  59   AAGNPDEIAKLFPNLFGQPSSMLVPNGVDNIGSDQKLKIGVVLSGGQAPGGHNVISGIFD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQE   GSTLYGF+GGPAGIMK KYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQERAPGSTLYGFKGGPAGIMKGKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QAEETA KLDLDGLV
Sbjct  179  QAEETAAKLDLDGLV  193



>ref|XP_007026198.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta isoform 2 [Theobroma cacao]
 gb|EOY28820.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta isoform 2 [Theobroma cacao]
Length=491

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 166/195 (85%), Gaps = 3/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            M+P++ +  N D+A+ KT+   GR A+VYSEVQ SR+DH LPLPSVLR  FK+VDGP SS
Sbjct  1    MSPSL-VTNNGDVATVKTAPVAGRLAAVYSEVQTSRIDHALPLPSVLRNPFKIVDGPPSS  59

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPSA LVP+ +  +  +  LKIGVVLSGGQAPGGHNVISGIFD
Sbjct  60   AAGNPDEIAKLFPNLFGQPSAMLVPNGADSIGSDQKLKIGVVLSGGQAPGGHNVISGIFD  119

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQ+  KGS LYGFRGGPAGIMKCKYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  120  YLQDCAKGSILYGFRGGPAGIMKCKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFK  179

Query  613  QAEETAKKLDLDGLV  657
            QAEETA KLDLDGL+
Sbjct  180  QAEETAVKLDLDGLL  194



>ref|XP_008810438.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Phoenix dactylifera]
Length=205

 Score =   288 bits (738),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 159/189 (84%), Gaps = 2/189 (1%)
 Frame = +1

Query  97   LLANSDIASAKT--STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPE  270
            + ANS +A+     S GR A+VYSEVQ SRL+H LPLPSV+R  FK+VDGP SSAAG+P+
Sbjct  1    MAANSILANGGKGPSPGRLAAVYSEVQTSRLNHSLPLPSVVRGPFKIVDGPLSSAAGNPD  60

Query  271  EIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHC  450
            EI KLFP LFGQPSA LVP  S    M  +LK+GVVLSGGQAPGGHNVISGIFDYLQ+  
Sbjct  61   EIKKLFPNLFGQPSATLVPTGSAPSEMAGSLKVGVVLSGGQAPGGHNVISGIFDYLQDRA  120

Query  451  KGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETA  630
            KGSTLYGF+GGPAGIMKCKY+ LT EYIYPYRNQGGFDMICSGRDKIETP+QFKQAEETA
Sbjct  121  KGSTLYGFKGGPAGIMKCKYMELTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETA  180

Query  631  KKLDLDGLV  657
             KLDLDGLV
Sbjct  181  LKLDLDGLV  189



>ref|XP_008440051.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Cucumis melo]
Length=567

 Score =   300 bits (767),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 167/194 (86%), Gaps = 5/194 (3%)
 Frame = +1

Query  88   AISLLANSDIASAKTS----TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSA  255
            +IS ++N + A+ K++    +GR +SVYSEVQ+SR++H LPLPSVLR SF +VDGP SSA
Sbjct  2    SISFISNGE-AAVKSNYPPLSGRVSSVYSEVQSSRINHNLPLPSVLRSSFTIVDGPPSSA  60

Query  256  AGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDY  435
            AG+P+EIAKLFP LFGQPSA LVP DS     +  LKIGVVLSGGQAPGGHNVISGIFDY
Sbjct  61   AGNPDEIAKLFPNLFGQPSAKLVPSDSSKGQPDKKLKIGVVLSGGQAPGGHNVISGIFDY  120

Query  436  LQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQ  615
            LQ+H KGS LYGFRGGPAGIMKCKY+ LT EYIYPYRNQGGFDMICSGRDKIETP+QFKQ
Sbjct  121  LQDHAKGSVLYGFRGGPAGIMKCKYIELTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQ  180

Query  616  AEETAKKLDLDGLV  657
            AEETAKKLDLDGLV
Sbjct  181  AEETAKKLDLDGLV  194



>gb|KJB67269.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=566

 Score =   299 bits (766),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 165/195 (85%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAP  S + N D+A+ KT+   GR ASVYSEVQ SR+DH LP+PSVLR  FK+VDGPASS
Sbjct  1    MAP--SFVTNGDVAAVKTTPFAGRLASVYSEVQTSRIDHALPVPSVLRSPFKIVDGPASS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPS+ LVP+   ++  +  LKIGVVLSGGQAPGGHNVISGIFD
Sbjct  59   AAGNPDEIAKLFPNLFGQPSSMLVPNGVDNIGSDQKLKIGVVLSGGQAPGGHNVISGIFD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQE   GSTLYGF+GGPAGIMK KYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQERAPGSTLYGFKGGPAGIMKGKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QAEETA KLDLDGLV
Sbjct  179  QAEETAAKLDLDGLV  193



>gb|KJB67273.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=556

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 165/195 (85%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAP  S + N D+A+ KT+   GR ASVYSEVQ SR+DH LP+PSVLR  FK+VDGPASS
Sbjct  1    MAP--SFVTNGDVAAVKTTPFAGRLASVYSEVQTSRIDHALPVPSVLRSPFKIVDGPASS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPS+ LVP+   ++  +  LKIGVVLSGGQAPGGHNVISGIFD
Sbjct  59   AAGNPDEIAKLFPNLFGQPSSMLVPNGVDNIGSDQKLKIGVVLSGGQAPGGHNVISGIFD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQE   GSTLYGF+GGPAGIMK KYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQERAPGSTLYGFKGGPAGIMKGKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QAEETA KLDLDGLV
Sbjct  179  QAEETAAKLDLDGLV  193



>ref|XP_008458989.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Cucumis melo]
Length=569

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 165/190 (87%), Gaps = 4/190 (2%)
 Frame = +1

Query  100  LANSDIAS----AKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP  267
            +AN+D++     + + TGR +SVYSEVQ  R+D PLP PSVL+  F++VDGP SSAAG+P
Sbjct  6    IANADVSPVIPPSPSLTGRVSSVYSEVQAYRIDQPLPFPSVLKNRFQIVDGPPSSAAGNP  65

Query  268  EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            +EIAKLFP LFGQPSA LVP DSG V +N  LKIGVVLSGGQAPGGHNVISG+FDYLQ+H
Sbjct  66   DEIAKLFPSLFGQPSAMLVPSDSGYVQVNKKLKIGVVLSGGQAPGGHNVISGLFDYLQDH  125

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
             +GSTLYGF+GGPAGIMKCKYV LT E+IYPYRNQGGFDMICSGRDKIETP+QFKQAEET
Sbjct  126  ARGSTLYGFKGGPAGIMKCKYVELTAEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEET  185

Query  628  AKKLDLDGLV  657
            A++LDLDGLV
Sbjct  186  AQRLDLDGLV  195



>ref|XP_007026197.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta isoform 1 [Theobroma cacao]
 gb|EOY28819.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta isoform 1 [Theobroma cacao]
Length=567

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 166/195 (85%), Gaps = 3/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            M+P++ +  N D+A+ KT+   GR A+VYSEVQ SR+DH LPLPSVLR  FK+VDGP SS
Sbjct  1    MSPSL-VTNNGDVATVKTAPVAGRLAAVYSEVQTSRIDHALPLPSVLRNPFKIVDGPPSS  59

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPSA LVP+ +  +  +  LKIGVVLSGGQAPGGHNVISGIFD
Sbjct  60   AAGNPDEIAKLFPNLFGQPSAMLVPNGADSIGSDQKLKIGVVLSGGQAPGGHNVISGIFD  119

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQ+  KGS LYGFRGGPAGIMKCKYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  120  YLQDCAKGSILYGFRGGPAGIMKCKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFK  179

Query  613  QAEETAKKLDLDGLV  657
            QAEETA KLDLDGL+
Sbjct  180  QAEETAVKLDLDGLL  194



>ref|XP_010529463.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like isoform X2 [Tarenaya hassleriana]
Length=546

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 162/195 (83%), Gaps = 2/195 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTG--RYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAPA  L  ++       ST   R A+V+SEVQ  R+DH LPLPSVL+K F++VDGP SS
Sbjct  1    MAPAFVLSGDTVTGDPAISTASLRVAAVHSEVQAKRIDHALPLPSVLKKPFRIVDGPPSS  60

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAGHPEEI KLFP +FGQPSA+LV + SG V ++ NLK+GVVLSGGQAPGGHNVI GIFD
Sbjct  61   AAGHPEEIEKLFPNMFGQPSASLVTEHSGAVPIDSNLKVGVVLSGGQAPGGHNVICGIFD  120

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQE+ KGSTLYGFRGGPAGIMKCKYV LT +Y+YPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  121  YLQEYAKGSTLYGFRGGPAGIMKCKYVELTADYVYPYRNQGGFDMICSGRDKIETPEQFK  180

Query  613  QAEETAKKLDLDGLV  657
            QAEET  KLDLDGLV
Sbjct  181  QAEETTTKLDLDGLV  195



>ref|XP_006449816.1| hypothetical protein CICLE_v10014760mg [Citrus clementina]
 gb|ESR63056.1| hypothetical protein CICLE_v10014760mg [Citrus clementina]
Length=566

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 167/195 (86%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIA--SAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            M+P  SL+AN+D++  ++ T  GR ASVYSE+Q SR+DH LPLPSVL+  FK+VDGPASS
Sbjct  1    MSP--SLVANADLSPVTSGTVKGRVASVYSELQTSRIDHALPLPSVLKNPFKIVDGPASS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPSA LVP+ +  V  +  LKIGVVLSGGQAPGGHNVISGI+D
Sbjct  59   AAGNPDEIAKLFPNLFGQPSALLVPNGADAVRSDEKLKIGVVLSGGQAPGGHNVISGIYD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQ+  KGS LYGFRGGPAGIMKCKYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQDRAKGSVLYGFRGGPAGIMKCKYVELTSDYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QA ETA KLDLDGLV
Sbjct  179  QATETAVKLDLDGLV  193



>ref|XP_010099150.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Morus notabilis]
 gb|EXB77022.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Morus notabilis]
Length=565

 Score =   297 bits (761),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = +1

Query  94   SLLANSDIASAKT---STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGH  264
            +L+AN D+ + K+   +TGR +SVYSEVQ SR+DH LPLP+VL   FK+VDGP SSAAG+
Sbjct  4    ALVANGDLLAGKSPSPATGRVSSVYSEVQASRIDHALPLPAVLINPFKIVDGPPSSAAGN  63

Query  265  PEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQE  444
            P+EIAKLFP LFGQPSA LVP DS   A    LKIGVVLSGGQAPGGHNVISGI+DYLQ+
Sbjct  64   PDEIAKLFPNLFGQPSAKLVPSDSD--ANQQKLKIGVVLSGGQAPGGHNVISGIYDYLQD  121

Query  445  HCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEE  624
              KGSTLYGFRGGPAGIMKCKYV LT EYIYPYRNQGGFDMICSGRDKIETP+QFKQAEE
Sbjct  122  RAKGSTLYGFRGGPAGIMKCKYVELTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEE  181

Query  625  TAKKLDLDGLV  657
            TA KLDLDGLV
Sbjct  182  TALKLDLDGLV  192



>ref|XP_006467368.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Citrus sinensis]
 gb|ABY25306.1| pyrophosphate-dependent phosphofructokinase beta subunit [Citrus 
sinensis x Citrus trifoliata]
Length=565

 Score =   297 bits (761),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 166/195 (85%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIA--SAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            M+P  SL+AN+D++  ++ T  GR ASVYSE+Q SR+DH LPLPSVL+  FK+VDGPASS
Sbjct  1    MSP--SLVANADLSPVTSGTVKGRVASVYSELQTSRIDHALPLPSVLKNPFKIVDGPASS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPSA LVP+ +  V  +  LKIGVVLSGGQAPGGHNVISGI+D
Sbjct  59   AAGNPDEIAKLFPNLFGQPSALLVPNGADAVRSDEKLKIGVVLSGGQAPGGHNVISGIYD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQ+  KGS LYGFRGGPAGIMKCKYV LT  YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQDRAKGSVLYGFRGGPAGIMKCKYVELTSNYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QA ETA KLDLDGLV
Sbjct  179  QATETAVKLDLDGLV  193



>ref|XP_004169324.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Cucumis sativus]
Length=567

 Score =   297 bits (761),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 3/193 (2%)
 Frame = +1

Query  88   AISLLANSDIASAKTS---TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            +IS ++N + A   +S   +GR +SVYSEVQ+SR++H LPLPSVLR  F +VDGP SSAA
Sbjct  2    SISFISNGEAAVKSSSPPLSGRVSSVYSEVQSSRINHNLPLPSVLRSPFTIVDGPPSSAA  61

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSA LVP DS     +  LKIGVVLSGGQAPGGHNVISGIFDYL
Sbjct  62   GNPDEIAKLFPNLFGQPSAKLVPSDSNKGQPDKKLKIGVVLSGGQAPGGHNVISGIFDYL  121

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            Q+H KGS LYGFRGGPAGIMKCKY+ LT +YIYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  122  QDHAKGSVLYGFRGGPAGIMKCKYLELTSDYIYPYRNQGGFDMICSGRDKIETPEQFKQA  181

Query  619  EETAKKLDLDGLV  657
            EETAKKLDLDGLV
Sbjct  182  EETAKKLDLDGLV  194



>gb|KDO78376.1| hypothetical protein CISIN_1g008424mg [Citrus sinensis]
Length=566

 Score =   297 bits (761),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 166/195 (85%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIA--SAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            M+P  SL+AN+D++  ++ T  GR ASVYSE+Q SR+DH LPLPSVL+  FK+VDGPASS
Sbjct  1    MSP--SLVANADLSPVTSGTVKGRVASVYSELQTSRIDHALPLPSVLKNPFKIVDGPASS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPSA LVP+ +  V  +  LKIGVVLSGGQAPGGHNVISGI+D
Sbjct  59   AAGNPDEIAKLFPNLFGQPSALLVPNGADAVRSDEKLKIGVVLSGGQAPGGHNVISGIYD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQ+  KGS LYGFRGGPAGIMKCKYV LT  YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQDRAKGSVLYGFRGGPAGIMKCKYVELTSNYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QA ETA KLDLDGLV
Sbjct  179  QATETAVKLDLDGLV  193



>gb|AAC67586.1| pyrophosphate-dependent phosphofructokinase beta subunit [Citrus 
x paradisi]
Length=566

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 166/195 (85%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIA--SAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            M+P  SL+AN+D++  ++ T  GR ASVYSE+Q SR+DH LPLPSVL+  FK+VDGPASS
Sbjct  1    MSP--SLVANADLSPVTSGTVKGRVASVYSELQTSRIDHALPLPSVLKNPFKIVDGPASS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPSA LVP+ +  V  +  LKIGVVLSGGQAPGGHNVISGI+D
Sbjct  59   AAGNPDEIAKLFPNLFGQPSALLVPNGADAVRSDEKLKIGVVLSGGQAPGGHNVISGIYD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQ+  KGS LYGFRGGPAGIMKCKYV LT  YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQDRAKGSVLYGFRGGPAGIMKCKYVELTSNYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QA ETA KLDLDGLV
Sbjct  179  QATETAVKLDLDGLV  193



>ref|XP_004134783.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Cucumis sativus]
 gb|KGN49075.1| hypothetical protein Csa_6G512900 [Cucumis sativus]
Length=567

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 3/193 (2%)
 Frame = +1

Query  88   AISLLANSDIASAKTS---TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            +IS ++N + A   +S   +GR +SVYSEVQ+SR++H LPLPSVLR  F +VDGP SSAA
Sbjct  2    SISFISNGEAAVKSSSPPLSGRVSSVYSEVQSSRINHNLPLPSVLRSPFTIVDGPPSSAA  61

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSA LVP DS     +  LKIGVVLSGGQAPGGHNVISGIFDYL
Sbjct  62   GNPDEIAKLFPNLFGQPSAKLVPSDSNKGQPDKKLKIGVVLSGGQAPGGHNVISGIFDYL  121

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            Q+H KGS LYGFRGGPAGIMKCKY+ LT +YIYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  122  QDHAKGSVLYGFRGGPAGIMKCKYLELTSDYIYPYRNQGGFDMICSGRDKIETPEQFKQA  181

Query  619  EETAKKLDLDGLV  657
            EETAKKLDLDGLV
Sbjct  182  EETAKKLDLDGLV  194



>ref|XP_010529462.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like isoform X1 [Tarenaya hassleriana]
Length=569

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 162/195 (83%), Gaps = 2/195 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTG--RYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAPA  L  ++       ST   R A+V+SEVQ  R+DH LPLPSVL+K F++VDGP SS
Sbjct  1    MAPAFVLSGDTVTGDPAISTASLRVAAVHSEVQAKRIDHALPLPSVLKKPFRIVDGPPSS  60

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAGHPEEI KLFP +FGQPSA+LV + SG V ++ NLK+GVVLSGGQAPGGHNVI GIFD
Sbjct  61   AAGHPEEIEKLFPNMFGQPSASLVTEHSGAVPIDSNLKVGVVLSGGQAPGGHNVICGIFD  120

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQE+ KGSTLYGFRGGPAGIMKCKYV LT +Y+YPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  121  YLQEYAKGSTLYGFRGGPAGIMKCKYVELTADYVYPYRNQGGFDMICSGRDKIETPEQFK  180

Query  613  QAEETAKKLDLDGLV  657
            QAEET  KLDLDGLV
Sbjct  181  QAEETTTKLDLDGLV  195



>gb|KJB69224.1| hypothetical protein B456_011G011600 [Gossypium raimondii]
Length=501

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 163/190 (86%), Gaps = 2/190 (1%)
 Frame = +1

Query  94   SLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP  267
            SL  N + A+ +T   +GR+A+VYSEVQNSR+DH LPLPSVLR  FKVV+GP SSAAG+P
Sbjct  4    SLNTNGNAAAFETGPVSGRFAAVYSEVQNSRIDHALPLPSVLRNPFKVVEGPPSSAAGNP  63

Query  268  EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            +EIAKLFP LFGQPSA LVP+++  +  +  LKIGVVLSGGQAPGGHNVISGIFDYLQ+ 
Sbjct  64   DEIAKLFPNLFGQPSAMLVPNEADSLRSDLKLKIGVVLSGGQAPGGHNVISGIFDYLQDR  123

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
             KGS LYGFRGGPAGIMKCKY+ L  +YIYPYRNQGGFDMICSGRDKIETP+QFKQAEET
Sbjct  124  AKGSILYGFRGGPAGIMKCKYIELNADYIYPYRNQGGFDMICSGRDKIETPEQFKQAEET  183

Query  628  AKKLDLDGLV  657
            A KLDLDGLV
Sbjct  184  AVKLDLDGLV  193



>emb|CDP04453.1| unnamed protein product [Coffea canephora]
Length=563

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 165/192 (86%), Gaps = 4/192 (2%)
 Frame = +1

Query  82   APAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAG  261
            A A +LL+N D  +   +TGR+ASVYSEVQN+RLDH L LP+VLRKSF+VVDGP SSAAG
Sbjct  3    AAAATLLSNGD--AKPQNTGRFASVYSEVQNNRLDHSLSLPAVLRKSFQVVDGPPSSAAG  60

Query  262  HPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQ  441
            +P+EI KLFP LFGQPSA LVP D+G+     +LK+GVVLSGGQAPGGHNVISGI+DYLQ
Sbjct  61   NPDEIKKLFPCLFGQPSAVLVPGDAGNAP--QSLKVGVVLSGGQAPGGHNVISGIYDYLQ  118

Query  442  EHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAE  621
            + CKGSTLYGFRGGPAGIMKCKY +L  EYIYP+RNQGGFDMI SGRDKIETP+QFKQA 
Sbjct  119  DRCKGSTLYGFRGGPAGIMKCKYTVLNSEYIYPFRNQGGFDMIRSGRDKIETPEQFKQAA  178

Query  622  ETAKKLDLDGLV  657
            ETA KLDLDGLV
Sbjct  179  ETALKLDLDGLV  190



>gb|KHG11353.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Gossypium arboreum]
Length=465

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 162/190 (85%), Gaps = 2/190 (1%)
 Frame = +1

Query  94   SLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP  267
            SL  N + A+ +T   +GR+A+VYSEVQNSR+DH LPLPSVLR  FKVV+GP SSAAG+P
Sbjct  4    SLNTNGNAAAFETGPVSGRFAAVYSEVQNSRIDHALPLPSVLRNPFKVVEGPPSSAAGNP  63

Query  268  EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            +EIAKLFP LFGQPSA LVP++   +  +  LKIGVVLSGGQAPGGHNVISGIFDYLQ+ 
Sbjct  64   DEIAKLFPNLFGQPSAMLVPNEVDSLRSDLKLKIGVVLSGGQAPGGHNVISGIFDYLQDR  123

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
             KGS LYGFRGGPAGIMKCKY+ L  +YIYPYRNQGGFDMICSGRDKIETP+QFKQAEET
Sbjct  124  AKGSILYGFRGGPAGIMKCKYIELNADYIYPYRNQGGFDMICSGRDKIETPEQFKQAEET  183

Query  628  AKKLDLDGLV  657
            A KLDLDGLV
Sbjct  184  AVKLDLDGLV  193



>gb|ADZ96379.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Eriobotrya 
japonica]
Length=569

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 161/194 (83%), Gaps = 4/194 (2%)
 Frame = +1

Query  88   AISLLANSDIASAKTS----TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSA  255
            A SL+AN   A  +      TGR+ASVYSEVQ SR+DH LPLPSVLRK FKVVDGPASSA
Sbjct  3    APSLVANGGAAGVEAVPGPVTGRFASVYSEVQASRIDHALPLPSVLRKPFKVVDGPASSA  62

Query  256  AGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDY  435
            AG+PEEIAKLFP +FGQPSA L P  S        LKIGVVLSGGQAPGGHNVISGIFDY
Sbjct  63   AGNPEEIAKLFPNVFGQPSALLAPSASDSGLPEQKLKIGVVLSGGQAPGGHNVISGIFDY  122

Query  436  LQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQ  615
            LQ+  KGST+YGFRGGPAGIMK KY+ LTPEYIYPYRNQGGFDMICSGRDKIETP+QFKQ
Sbjct  123  LQDRAKGSTMYGFRGGPAGIMKNKYIELTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQ  182

Query  616  AEETAKKLDLDGLV  657
            A+ETA KLDLDGLV
Sbjct  183  AQETAVKLDLDGLV  196



>ref|XP_006383850.1| hypothetical protein POPTR_0004s00550g [Populus trichocarpa]
 gb|ABK93074.1| unknown [Populus trichocarpa]
 gb|ERP61647.1| hypothetical protein POPTR_0004s00550g [Populus trichocarpa]
Length=561

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 5/193 (3%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MAPA   + N D A A   +GR+ASVYSEVQ+SR+DH LPLPSVL+  FK+VDG  SSAA
Sbjct  1    MAPA--FVINGDSARA---SGRFASVYSEVQSSRIDHALPLPSVLKNPFKIVDGTRSSAA  55

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSA LVP+D   ++ +  LKIGVVLSGGQAPGGHNVISGIFDYL
Sbjct  56   GNPDEIAKLFPNLFGQPSAKLVPNDVDTLSSDQKLKIGVVLSGGQAPGGHNVISGIFDYL  115

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            Q+  KGS LYGF+GGPAGIMKCKYV L  +YIYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  116  QDRAKGSVLYGFKGGPAGIMKCKYVELNADYIYPYRNQGGFDMICSGRDKIETPEQFKQA  175

Query  619  EETAKKLDLDGLV  657
            EETAKKLDLDGL+
Sbjct  176  EETAKKLDLDGLL  188



>gb|KHG16419.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Gossypium arboreum]
Length=509

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 162/195 (83%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAP  S + N  +A+ KT+   GR ASVYSEVQ SR+DH LP+PSVLR  FK+VDGPASS
Sbjct  1    MAP--SFVTNGGVAAVKTTPFAGRLASVYSEVQTSRIDHALPVPSVLRSPFKIVDGPASS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPS+ LVP+    +  +  LKIGVVLSGGQAPGGHNVI GIFD
Sbjct  59   AAGNPDEIAKLFPNLFGQPSSMLVPNGIDSIGSDQKLKIGVVLSGGQAPGGHNVICGIFD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQE   GSTLYGFRGGPAG+MK KYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQERAPGSTLYGFRGGPAGVMKGKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QAEETA KLDLDGLV
Sbjct  179  QAEETAAKLDLDGLV  193



>gb|KJB69225.1| hypothetical protein B456_011G011600 [Gossypium raimondii]
Length=545

 Score =   295 bits (754),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 163/190 (86%), Gaps = 2/190 (1%)
 Frame = +1

Query  94   SLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP  267
            SL  N + A+ +T   +GR+A+VYSEVQNSR+DH LPLPSVLR  FKVV+GP SSAAG+P
Sbjct  4    SLNTNGNAAAFETGPVSGRFAAVYSEVQNSRIDHALPLPSVLRNPFKVVEGPPSSAAGNP  63

Query  268  EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            +EIAKLFP LFGQPSA LVP+++  +  +  LKIGVVLSGGQAPGGHNVISGIFDYLQ+ 
Sbjct  64   DEIAKLFPNLFGQPSAMLVPNEADSLRSDLKLKIGVVLSGGQAPGGHNVISGIFDYLQDR  123

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
             KGS LYGFRGGPAGIMKCKY+ L  +YIYPYRNQGGFDMICSGRDKIETP+QFKQAEET
Sbjct  124  AKGSILYGFRGGPAGIMKCKYIELNADYIYPYRNQGGFDMICSGRDKIETPEQFKQAEET  183

Query  628  AKKLDLDGLV  657
            A KLDLDGLV
Sbjct  184  AVKLDLDGLV  193



>gb|KJB69223.1| hypothetical protein B456_011G011600 [Gossypium raimondii]
Length=566

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 163/190 (86%), Gaps = 2/190 (1%)
 Frame = +1

Query  94   SLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP  267
            SL  N + A+ +T   +GR+A+VYSEVQNSR+DH LPLPSVLR  FKVV+GP SSAAG+P
Sbjct  4    SLNTNGNAAAFETGPVSGRFAAVYSEVQNSRIDHALPLPSVLRNPFKVVEGPPSSAAGNP  63

Query  268  EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            +EIAKLFP LFGQPSA LVP+++  +  +  LKIGVVLSGGQAPGGHNVISGIFDYLQ+ 
Sbjct  64   DEIAKLFPNLFGQPSAMLVPNEADSLRSDLKLKIGVVLSGGQAPGGHNVISGIFDYLQDR  123

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
             KGS LYGFRGGPAGIMKCKY+ L  +YIYPYRNQGGFDMICSGRDKIETP+QFKQAEET
Sbjct  124  AKGSILYGFRGGPAGIMKCKYIELNADYIYPYRNQGGFDMICSGRDKIETPEQFKQAEET  183

Query  628  AKKLDLDGLV  657
            A KLDLDGLV
Sbjct  184  AVKLDLDGLV  193



>ref|XP_004507660.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Cicer arietinum]
Length=567

 Score =   295 bits (754),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 161/194 (83%), Gaps = 1/194 (1%)
 Frame = +1

Query  79   MAPAISLLANS-DIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSA  255
            MAP+ +   +S D     + TGR+ASVYSEVQNSR+ H LPLPSVL+  FK++DGP SSA
Sbjct  1    MAPSFTNGGSSVDTVVPPSVTGRFASVYSEVQNSRIFHTLPLPSVLKTHFKIIDGPLSSA  60

Query  256  AGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDY  435
            AG+P+EIAKLFP LFGQPSA LVP  S  V  N  LKIGVVLSGGQAPGGHNVISGIFDY
Sbjct  61   AGNPDEIAKLFPNLFGQPSAVLVPSGSDTVQPNQKLKIGVVLSGGQAPGGHNVISGIFDY  120

Query  436  LQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQ  615
            LQ+  KGSTLYGFRGGPAGIMKCKYV LT EYIYPYRNQGGFDMI SGRDKIETP+QFKQ
Sbjct  121  LQDRAKGSTLYGFRGGPAGIMKCKYVELTSEYIYPYRNQGGFDMIRSGRDKIETPEQFKQ  180

Query  616  AEETAKKLDLDGLV  657
            AEET  KLDLDGLV
Sbjct  181  AEETVLKLDLDGLV  194



>ref|XP_008364088.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Malus domestica]
Length=569

 Score =   294 bits (753),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 161/192 (84%), Gaps = 4/192 (2%)
 Frame = +1

Query  94   SLLANSDIASAKTS----TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAG  261
            SL+AN   A  ++     TGR+ASVYSEVQ SR+DH LPLPSVLRK FKVVDGPASSAAG
Sbjct  5    SLIANGGAAGVESVPAPVTGRFASVYSEVQASRIDHALPLPSVLRKPFKVVDGPASSAAG  64

Query  262  HPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQ  441
            +PEEIAKLFP +FGQPSA L P DS        LKIGVVLSGGQAPGGHNVISGIFDYLQ
Sbjct  65   NPEEIAKLFPNVFGQPSALLAPSDSDSGLPEQKLKIGVVLSGGQAPGGHNVISGIFDYLQ  124

Query  442  EHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAE  621
            +  KGST+YGFRGGPAGIMK KY+ LTPEYIYPYRNQGGFDMI SGRDKIE+P+QFKQA+
Sbjct  125  DRAKGSTMYGFRGGPAGIMKNKYIELTPEYIYPYRNQGGFDMIRSGRDKIESPEQFKQAQ  184

Query  622  ETAKKLDLDGLV  657
            ETA KLDLDGLV
Sbjct  185  ETAVKLDLDGLV  196



>ref|XP_008805585.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Phoenix dactylifera]
Length=562

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 161/190 (85%), Gaps = 3/190 (2%)
 Frame = +1

Query  88   AISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP  267
            A S+LAN    S   S+GR A+VYSEVQ SRL+HPLPLPSV+R  FK+VDGP SSAAG+P
Sbjct  3    ANSVLAN---GSKGRSSGRLAAVYSEVQTSRLNHPLPLPSVVRGPFKIVDGPPSSAAGNP  59

Query  268  EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            +EI KLFP LFGQPSA LVP  +    M  +LKIGVVLSGGQAPGGHNVISGIFDYL++ 
Sbjct  60   DEIKKLFPNLFGQPSATLVPTGAVPSEMAGSLKIGVVLSGGQAPGGHNVISGIFDYLEDR  119

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
             KGSTLYGF+GGPAGIMKCKYV LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQAEET
Sbjct  120  AKGSTLYGFKGGPAGIMKCKYVELTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEET  179

Query  628  AKKLDLDGLV  657
              KLDLDGLV
Sbjct  180  VLKLDLDGLV  189



>ref|XP_008224722.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Prunus mume]
Length=568

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +1

Query  136  TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSA  315
            TGR A+VYSEVQ+SR+DH LPLPSVL K FKVVDGPASSAAG+P+EIAKLFP +FGQPSA
Sbjct  22   TGRVAAVYSEVQSSRIDHALPLPSVLTKPFKVVDGPASSAAGNPDEIAKLFPNVFGQPSA  81

Query  316  ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI  495
             LVP DS        LKIGVVLSGGQAPGGHNVISGIFDYLQ+  KGSTLYGFRGGPAGI
Sbjct  82   LLVPSDSDSALPQQKLKIGVVLSGGQAPGGHNVISGIFDYLQDRAKGSTLYGFRGGPAGI  141

Query  496  MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            MK KYV L  EYIYPYRNQGGFDMICSGRDKIETP+QFKQAEETA KLDLDGLV
Sbjct  142  MKNKYVELNSEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAVKLDLDGLV  195



>ref|XP_004293328.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 162/193 (84%), Gaps = 5/193 (3%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            M+P  SL+ N  ++S      R ASVYSEVQ SR+DH LPLPSVL+K FK++DGPASSAA
Sbjct  1    MSP--SLVQNGGVSSPAP---RVASVYSEVQASRIDHALPLPSVLKKPFKLIDGPASSAA  55

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+PEEIAKLFP +FGQPSA LV  DSG    N  LKIGVVLSGGQAPGGHNVISGIFDYL
Sbjct  56   GNPEEIAKLFPNVFGQPSAQLVESDSGSALPNQKLKIGVVLSGGQAPGGHNVISGIFDYL  115

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            Q+   GSTLYGFRGGPAGIMK KYV LTPEY+YPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  116  QDRAPGSTLYGFRGGPAGIMKGKYVELTPEYVYPYRNQGGFDMICSGRDKIETPEQFKQA  175

Query  619  EETAKKLDLDGLV  657
            +ETA KLDLDGLV
Sbjct  176  QETAVKLDLDGLV  188



>gb|KDP20694.1| hypothetical protein JCGZ_21165 [Jatropha curcas]
Length=566

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 164/195 (84%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAP  S + N ++ + K+S   GR ASVYSEVQ SR+DH LPLPSVL+  FK+V+GP SS
Sbjct  1    MAP--SFVLNGELPAIKSSPAVGRVASVYSEVQASRIDHALPLPSVLKNPFKIVEGPPSS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPSA LVP+ +  V  +  LKIGVVLSGGQAPGGHNVISGI+D
Sbjct  59   AAGNPDEIAKLFPNLFGQPSAMLVPNGADSVNPDQKLKIGVVLSGGQAPGGHNVISGIYD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQ+  KGS LYGFRGGPAGIMKCKYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQDRAKGSILYGFRGGPAGIMKCKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QAEETA KLDLDGLV
Sbjct  179  QAEETALKLDLDGLV  193



>ref|XP_010928237.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Elaeis guineensis]
Length=563

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 160/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  97   LLANSDIASA--KTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPE  270
            + ANS +A+   + S GR A+VYSEVQ SRL+HPLPLPSV+R  FK+VDGP SSA G+P+
Sbjct  1    MAANSVLANGGKRPSPGRLAAVYSEVQTSRLNHPLPLPSVVRGPFKIVDGPPSSACGNPD  60

Query  271  EIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHC  450
            EI KLFP LFGQPSA LVP  S    M  +LK+GVVLSGGQAPGGHNVISGIFDYLQ+  
Sbjct  61   EIKKLFPNLFGQPSATLVPTGSAPSEMAGSLKVGVVLSGGQAPGGHNVISGIFDYLQDRA  120

Query  451  KGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETA  630
            KGST+YGF GGPAGIMKCKYV LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQAEETA
Sbjct  121  KGSTMYGFMGGPAGIMKCKYVELTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETA  180

Query  631  KKLDLDGLV  657
             KLDLDGLV
Sbjct  181  LKLDLDGLV  189



>ref|XP_009356464.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Pyrus x bretschneideri]
Length=569

 Score =   292 bits (748),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 163/197 (83%), Gaps = 5/197 (3%)
 Frame = +1

Query  79   MAPAISLLANSDIASAK----TSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPA  246
            MAP  SL+ N   A A+    T TGR+ SVYSEVQ SR+DH LPLPSVL+K FKVVDGPA
Sbjct  1    MAPP-SLIVNGGAAGAELVPATVTGRFVSVYSEVQASRIDHVLPLPSVLKKPFKVVDGPA  59

Query  247  SSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGI  426
            SSAAG+PEEIAKLFP +FGQPSA L P DS        LKIGVVLSGGQAPGGHNVISGI
Sbjct  60   SSAAGNPEEIAKLFPNVFGQPSALLEPSDSDSGLPEQKLKIGVVLSGGQAPGGHNVISGI  119

Query  427  FDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ  606
            FDYLQ+  KGST+YGFRGGPAGIMK KY+ LTPEYIYPYRNQGGFDMI SGRDKIE+P+Q
Sbjct  120  FDYLQDRAKGSTMYGFRGGPAGIMKNKYIELTPEYIYPYRNQGGFDMIRSGRDKIESPEQ  179

Query  607  FKQAEETAKKLDLDGLV  657
            FKQA+ETA KLDLDGLV
Sbjct  180  FKQAQETAVKLDLDGLV  196



>ref|XP_003529650.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Glycine max]
Length=568

 Score =   292 bits (747),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 164/197 (83%), Gaps = 6/197 (3%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS----TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPA  246
            MAP+ ++  N     A+ +    TGR+A+VYSEVQNSR+DH LPLPSVL+  F +VDGP 
Sbjct  1    MAPSFAI--NGGFPGARVTPPSVTGRFAAVYSEVQNSRIDHELPLPSVLKNPFIIVDGPQ  58

Query  247  SSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGI  426
            SSAAG+PEEIAKLFP LFGQPSAALVP DS     N  LKIGVVLSGGQAPGGHNVISGI
Sbjct  59   SSAAGNPEEIAKLFPKLFGQPSAALVPSDSHAPHANRKLKIGVVLSGGQAPGGHNVISGI  118

Query  427  FDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ  606
            FDYLQ+  +GSTLYGFRGGPAGIMKCKYV LT +YIYPYRNQGGFDMI SGRDKIETP+Q
Sbjct  119  FDYLQDLAEGSTLYGFRGGPAGIMKCKYVELTSDYIYPYRNQGGFDMIRSGRDKIETPEQ  178

Query  607  FKQAEETAKKLDLDGLV  657
            FKQAEET +KL+LDGLV
Sbjct  179  FKQAEETVQKLNLDGLV  195



>ref|XP_009414122.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185} [Musa 
acuminata subsp. malaccensis]
Length=564

 Score =   291 bits (746),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 160/193 (83%), Gaps = 2/193 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MA A S LAN        S GR +SVYSEVQ SRL+HPLPLPSVL+  FK+VDGP SSAA
Sbjct  1    MATANSALANG--CDNGPSPGRLSSVYSEVQTSRLNHPLPLPSVLKGHFKLVDGPPSSAA  58

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSA +VP  S       +LKIGVVLSGGQAPGGHNVISGIFDYL
Sbjct  59   GNPDEIAKLFPNLFGQPSAKVVPTGSDPSDSAGSLKIGVVLSGGQAPGGHNVISGIFDYL  118

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            QE  KGS LYGF+GGPAGIMKCKYV LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  119  QERAKGSILYGFKGGPAGIMKCKYVQLTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQA  178

Query  619  EETAKKLDLDGLV  657
            EETA KLDLDGLV
Sbjct  179  EETAVKLDLDGLV  191



>gb|AIE47260.1| pyrophosphate-dependent phosphofructokinase, partial [Hevea brasiliensis]
Length=560

 Score =   291 bits (746),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 160/186 (86%), Gaps = 2/186 (1%)
 Frame = +1

Query  106  NSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIA  279
            N ++ + K+S  TGR+ASVYSE+Q SR+DH LP+PSVL+  FKVV+GP SSAAG+P+EIA
Sbjct  2    NGEVPTVKSSPATGRFASVYSELQASRIDHSLPVPSVLKNPFKVVEGPPSSAAGNPDEIA  61

Query  280  KLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGS  459
            KLFP LFGQPS+  VP+ +  V  N  LKIGVVLSGGQAPGGHNVISGIFDYLQE  KGS
Sbjct  62   KLFPNLFGQPSSMFVPNGADAVHSNLKLKIGVVLSGGQAPGGHNVISGIFDYLQERAKGS  121

Query  460  TLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKL  639
             LYGFRGGPAGIMKCKYV LT ++IYPYRNQGGFDMICSGRDKIETP+QFKQAEETA KL
Sbjct  122  ILYGFRGGPAGIMKCKYVELTADFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETALKL  181

Query  640  DLDGLV  657
            DLDGLV
Sbjct  182  DLDGLV  187



>gb|KCW75230.1| hypothetical protein EUGRSUZ_E03983 [Eucalyptus grandis]
Length=642

 Score =   294 bits (752),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 169/211 (80%), Gaps = 7/211 (3%)
 Frame = +1

Query  40   LPHSLFPLGENQS-MAPAISLLANSDIASAKTSTG----RYASVYSEVQNSRLDHPLPLP  204
            LP SL  LG   + M+P  S + N D+A+A         R ASVYS+VQ SR+DH LPLP
Sbjct  61   LPRSLAALGTTGTPMSP--SFVYNGDLAAAAGGKPAGTGRVASVYSDVQTSRIDHDLPLP  118

Query  205  SVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLS  384
            SVL+   KVVDGP SSAAG+P EIAKLFP +FGQPSA +VP DS     +  LKIGVVLS
Sbjct  119  SVLKGPIKVVDGPPSSAAGNPGEIAKLFPCVFGQPSAMVVPSDSASDGPSQKLKIGVVLS  178

Query  385  GGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFD  564
            GGQAPGGHNVI+GIFDYLQ+  KGSTLYGFRGGPAGIMKCKYV LTPEYIYPYRNQGGFD
Sbjct  179  GGQAPGGHNVIAGIFDYLQDRAKGSTLYGFRGGPAGIMKCKYVELTPEYIYPYRNQGGFD  238

Query  565  MICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            MICSGRDKIETP+QFKQAEETAKKLDLDGLV
Sbjct  239  MICSGRDKIETPEQFKQAEETAKKLDLDGLV  269



>ref|XP_002269934.2| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Vitis vinifera]
 emb|CBI33004.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 3/193 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            M+P+I   AN   ++  ++TGR+A+VYSEVQ SRL+H LPLPSVL+  FK+V+GP SSAA
Sbjct  1    MSPSID--ANGGASAGNSTTGRFAAVYSEVQTSRLNHSLPLPSVLKSPFKIVEGPPSSAA  58

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P EIAKLFP +FGQPSA LVP +S  +  +  LKIGVVLSGGQAPGGHNVISGIFDYL
Sbjct  59   GNPGEIAKLFPNMFGQPSAMLVPSESA-LPSDQKLKIGVVLSGGQAPGGHNVISGIFDYL  117

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            Q H KGSTLYGF+GGPAGIMKCKYV L  E+IYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  118  QNHVKGSTLYGFKGGPAGIMKCKYVELDSEFIYPYRNQGGFDMICSGRDKIETPEQFKQA  177

Query  619  EETAKKLDLDGLV  657
            EETA KLDLDGL+
Sbjct  178  EETAVKLDLDGLL  190



>ref|XP_007211880.1| hypothetical protein PRUPE_ppa003518mg [Prunus persica]
 gb|EMJ13079.1| hypothetical protein PRUPE_ppa003518mg [Prunus persica]
Length=568

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +1

Query  136  TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSA  315
            TGR A+VYSEVQ+SR+DH LPLPSVL K FKVVDGPASSAAG+P+EIAKLFP +FGQPSA
Sbjct  22   TGRVAAVYSEVQSSRIDHALPLPSVLTKPFKVVDGPASSAAGNPDEIAKLFPNVFGQPSA  81

Query  316  ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI  495
             LVP DS        LKIGVVLSGGQAPGGHNVISGIFDYLQ+  KGSTLYGFRGGPAGI
Sbjct  82   LLVPSDSDSALPQQKLKIGVVLSGGQAPGGHNVISGIFDYLQDRAKGSTLYGFRGGPAGI  141

Query  496  MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            MK K++ L  EYIYPYRNQGGFDMICSGRDKIETP+QFKQAEETA KLDLDGLV
Sbjct  142  MKNKFIELNSEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAVKLDLDGLV  195



>ref|XP_003610482.1| Pyrophosphate-fructose 6-phosphate 1-phosphotransferase subunit 
beta [Medicago truncatula]
 gb|AES92679.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Medicago 
truncatula]
Length=569

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 161/196 (82%), Gaps = 3/196 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAK---TSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPAS  249
            MAP+ +L   SD   A    + TGR+ASVYSEVQNSR+ H LPLPSVL+  F ++DGP S
Sbjct  1    MAPSFALDGGSDANRAPPPPSVTGRFASVYSEVQNSRIFHTLPLPSVLKTPFTIIDGPPS  60

Query  250  SAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF  429
            SAAG+P+EIAKLFP LFGQ SA LVP  S  V +N  LKIGVVLSGGQAPGGHNVISGIF
Sbjct  61   SAAGNPDEIAKLFPNLFGQSSAMLVPGGSETVQLNQKLKIGVVLSGGQAPGGHNVISGIF  120

Query  430  DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQF  609
            DYLQ+  KGSTLYGFRGGPAGIMKCKYV LT +YIYPYRNQGGFDMI SGRDKIETP+QF
Sbjct  121  DYLQDRAKGSTLYGFRGGPAGIMKCKYVELTSDYIYPYRNQGGFDMIRSGRDKIETPEQF  180

Query  610  KQAEETAKKLDLDGLV  657
            KQAEET  KL+LDGLV
Sbjct  181  KQAEETVHKLELDGLV  196



>emb|CDX98086.1| BnaA06g08370D [Brassica napus]
Length=566

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 170/197 (86%), Gaps = 7/197 (4%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKT----STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPA  246
            MAP+++ + N D+A+A      + GR ASVYSEVQ+SR+++ LPLPSVL+ +FK+V+GPA
Sbjct  1    MAPSLAAV-NRDLAAASPDNAPAKGR-ASVYSEVQSSRINNALPLPSVLKGAFKIVEGPA  58

Query  247  SSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGI  426
            SSAAG+P+EIAKLFPGL+GQPS ++VPD S D++    LKIGVVLSGGQAPGGHNVISG+
Sbjct  59   SSAAGNPDEIAKLFPGLYGQPSVSVVPDQSADLS-GQKLKIGVVLSGGQAPGGHNVISGL  117

Query  427  FDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ  606
            FDYLQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETP+Q
Sbjct  118  FDYLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYILPYRNQGGFDMICSGRDKIETPEQ  177

Query  607  FKQAEETAKKLDLDGLV  657
            FKQAEETAKKLDLDGLV
Sbjct  178  FKQAEETAKKLDLDGLV  194



>ref|XP_009357501.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Pyrus x bretschneideri]
Length=570

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = +1

Query  136  TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSA  315
            TGR+ASVYSEVQ SR+DH LPLPSVL+K FKVV+GPASSAAG+PEEIAKLFP +FGQPSA
Sbjct  22   TGRFASVYSEVQASRIDHELPLPSVLKKPFKVVEGPASSAAGNPEEIAKLFPNVFGQPSA  81

Query  316  ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI  495
             L P DS        LKIGVVLSGGQAPGGHNVISGIFDYLQ+  KGSTLYGFRGGPAGI
Sbjct  82   LLEPSDSDSGLPEQKLKIGVVLSGGQAPGGHNVISGIFDYLQDRAKGSTLYGFRGGPAGI  141

Query  496  MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            MK KY+ LTPEYIYPYRNQGGFDMI SGRDKIETP+QFKQA+ETA KLDLDGLV
Sbjct  142  MKNKYIELTPEYIYPYRNQGGFDMIRSGRDKIETPEQFKQAQETAVKLDLDGLV  195



>ref|XP_009148623.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1 [Brassica rapa]
Length=566

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 170/197 (86%), Gaps = 7/197 (4%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKT----STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPA  246
            MAP+++ + N D+A+A      + GR ASVYSEVQ+SR+++ LPLPSVL+ +FK+V+GPA
Sbjct  1    MAPSLAAV-NRDLAAASPDNAPAKGR-ASVYSEVQSSRINNALPLPSVLKGAFKIVEGPA  58

Query  247  SSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGI  426
            SSAAG+P+EIAKLFPGL+GQPS ++VPD S D++    LKIGVVLSGGQAPGGHNVISG+
Sbjct  59   SSAAGNPDEIAKLFPGLYGQPSVSVVPDQSADLS-GQKLKIGVVLSGGQAPGGHNVISGL  117

Query  427  FDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ  606
            FDYLQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETP+Q
Sbjct  118  FDYLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYILPYRNQGGFDMICSGRDKIETPEQ  177

Query  607  FKQAEETAKKLDLDGLV  657
            FKQAEETAKKLDLDGLV
Sbjct  178  FKQAEETAKKLDLDGLV  194



>ref|XP_007147679.1| hypothetical protein PHAVU_006G145300g [Phaseolus vulgaris]
 gb|ESW19673.1| hypothetical protein PHAVU_006G145300g [Phaseolus vulgaris]
Length=561

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MAP    + N  + SA   TGR +SVYSEVQ  R+DH LPLPSVL+  F ++DGP SSAA
Sbjct  1    MAP----VPNGTVPSAPV-TGRLSSVYSEVQKKRVDHALPLPSVLKHPFTLLDGPPSSAA  55

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPS ALVP D      +  LKIGVVLSGGQAPGGHNVISGIFDYL
Sbjct  56   GNPDEIAKLFPHLFGQPSVALVPSDPRVAQTHQKLKIGVVLSGGQAPGGHNVISGIFDYL  115

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            QE   GSTLYGFRGGPAGIMKCKYV LT EYIYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  116  QERAPGSTLYGFRGGPAGIMKCKYVELTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQA  175

Query  619  EETAKKLDLDGLV  657
            EETAKKLDLDGLV
Sbjct  176  EETAKKLDLDGLV  188



>ref|XP_003547272.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Glycine max]
 gb|KHN32989.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Glycine soja]
Length=562

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 152/174 (87%), Gaps = 2/174 (1%)
 Frame = +1

Query  136  TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSA  315
            TGR ASVYSEVQ +R+DH LPLPSVL+  F ++DGP SSAAG+P+EIAKLFP LFGQPSA
Sbjct  18   TGRLASVYSEVQKTRVDHALPLPSVLKHPFTILDGPPSSAAGNPDEIAKLFPHLFGQPSA  77

Query  316  ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI  495
            AL P  SG V     LKIGVVLSGGQAPGGHNVISGIFDYLQE   GSTLYGF+GGPAGI
Sbjct  78   ALAP--SGAVQTQKKLKIGVVLSGGQAPGGHNVISGIFDYLQERAPGSTLYGFKGGPAGI  135

Query  496  MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            MKCKYV LT EYIYPYRNQGGFDMICSGRDKIETP+QFKQAEETAKKLDLDGLV
Sbjct  136  MKCKYVELTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLV  189



>ref|XP_008384111.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Malus domestica]
Length=565

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +1

Query  136  TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSA  315
            TGR ASVYSEVQ SR+DH LPLPSVL+K FKVV+GPASSAAG+PEEIAKLFP +FGQPSA
Sbjct  24   TGRVASVYSEVQASRIDHALPLPSVLKKPFKVVEGPASSAAGNPEEIAKLFPNVFGQPSA  83

Query  316  ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI  495
             L P DS        LKIGVVLSGGQAPGGHNVISGIFDYLQ+  KGST+YGF GGPAGI
Sbjct  84   LLAPSDSVSGLPEQKLKIGVVLSGGQAPGGHNVISGIFDYLQDRAKGSTMYGFXGGPAGI  143

Query  496  MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            MK KY+ LTPEYIYPYRNQGGFDMICSGRDKIETP+QFKQA+ETA KLDLDGLV
Sbjct  144  MKNKYIELTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQAQETAVKLDLDGLV  197



>emb|CDY30046.1| BnaC05g09740D [Brassica napus]
Length=566

 Score =   289 bits (740),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 169/197 (86%), Gaps = 7/197 (4%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKT----STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPA  246
            MAP+++ + N D+A+A      + GR ASVYSEVQ+SR+++ LPLPSVL+ +FK V+GPA
Sbjct  1    MAPSLAAV-NRDLAAASPDNAPAKGR-ASVYSEVQSSRINNALPLPSVLKGAFKTVEGPA  58

Query  247  SSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGI  426
            SSAAG+P+EIAKLFPGL+GQPS ++VPD S D++    LKIGVVLSGGQAPGGHNVISG+
Sbjct  59   SSAAGNPDEIAKLFPGLYGQPSVSVVPDQSADLS-GQKLKIGVVLSGGQAPGGHNVISGL  117

Query  427  FDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ  606
            FDYLQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETP+Q
Sbjct  118  FDYLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYILPYRNQGGFDMICSGRDKIETPEQ  177

Query  607  FKQAEETAKKLDLDGLV  657
            FKQAEETAKKLDLDGLV
Sbjct  178  FKQAEETAKKLDLDGLV  194



>ref|XP_010057883.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Eucalyptus grandis]
Length=568

 Score =   290 bits (741),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +1

Query  142  RYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAAL  321
            R ASVYS+VQ SR+DH LPLPSVL+   KVVDGP SSAAG+P EIAKLFP +FGQPSA +
Sbjct  24   RVASVYSDVQTSRIDHDLPLPSVLKGPIKVVDGPPSSAAGNPGEIAKLFPCVFGQPSAMV  83

Query  322  VPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMK  501
            VP DS     +  LKIGVVLSGGQAPGGHNVI+GIFDYLQ+  KGSTLYGFRGGPAGIMK
Sbjct  84   VPSDSASDGPSQKLKIGVVLSGGQAPGGHNVIAGIFDYLQDRAKGSTLYGFRGGPAGIMK  143

Query  502  CKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            CKYV LTPEYIYPYRNQGGFDMICSGRDKIETP+QFKQAEETAKKLDLDGLV
Sbjct  144  CKYVELTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLV  195



>ref|XP_009391474.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=520

 Score =   288 bits (736),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 160/193 (83%), Gaps = 2/193 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MA A S+LAN    +   +  R ASVYSEVQ SRL+HPLPLPSVL+  FK+VDGP SSAA
Sbjct  1    MATANSVLAND--GAKGPAPPRLASVYSEVQTSRLNHPLPLPSVLKGPFKLVDGPPSSAA  58

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSA LVP  S    +   L+IGVVLSGGQAPGGHNVISGIFDYL
Sbjct  59   GNPDEIAKLFPNLFGQPSANLVPTGSDPSDLAGGLRIGVVLSGGQAPGGHNVISGIFDYL  118

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            QE   GS LYGF+GGPAGIMKCKYV LTP++IYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  119  QERTNGSILYGFKGGPAGIMKCKYVELTPDFIYPYRNQGGFDMICSGRDKIETPEQFKQA  178

Query  619  EETAKKLDLDGLV  657
            EETA KLDLDGLV
Sbjct  179  EETAMKLDLDGLV  191



>ref|XP_010476153.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Camelina sativa]
Length=567

 Score =   289 bits (740),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 168/199 (84%), Gaps = 10/199 (5%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTST------GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDG  240
            MAPA+++    D+A+A  S+      GR ASVYSEVQ+SR+++ LPLPSVL+ +FK+V+G
Sbjct  1    MAPALAV--TRDLAAAAVSSENAPAKGR-ASVYSEVQSSRINNALPLPSVLKGAFKIVEG  57

Query  241  PASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVIS  420
            PAS+AAG+P+EIAKLFPGL+GQPS A+VPD +   +    LKIGVVLSGGQAPGGHNVIS
Sbjct  58   PASTAAGNPDEIAKLFPGLYGQPSVAVVPDQNAPTSA-QKLKIGVVLSGGQAPGGHNVIS  116

Query  421  GIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETP  600
            G+FDYLQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETP
Sbjct  117  GLFDYLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIQPYRNQGGFDMICSGRDKIETP  176

Query  601  DQFKQAEETAKKLDLDGLV  657
            DQFKQAEETAKKLDLDGLV
Sbjct  177  DQFKQAEETAKKLDLDGLV  195



>ref|XP_010035533.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Eucalyptus grandis]
 gb|KCW46957.1| hypothetical protein EUGRSUZ_K00768 [Eucalyptus grandis]
Length=566

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = +1

Query  100  LANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIA  279
            L+N   A  + + GR A++Y EVQ SRL HPLPLPSVLR SF VVDGP SSAAG P+E+A
Sbjct  6    LSNGRAAPEQAALGRCAALYGEVQRSRLHHPLPLPSVLRGSFHVVDGPPSSAAGDPDEMA  65

Query  280  KLFPGLFGQPSAALVPDDS--GDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCK  453
            KLFP LFGQPSA+LVP  S  G       LKIGVVLSGGQAPGGHNVISGIFDYLQEH  
Sbjct  66   KLFPNLFGQPSASLVPSTSSTGATKDQKALKIGVVLSGGQAPGGHNVISGIFDYLQEHTS  125

Query  454  GSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAK  633
            GSTLYGFRGGPAGIMKCKY+ L+ E+IYPYRNQGGFDM+CSGRDKIETP+QFKQAEET K
Sbjct  126  GSTLYGFRGGPAGIMKCKYIELSSEFIYPYRNQGGFDMLCSGRDKIETPEQFKQAEETTK  185

Query  634  KLDLDGLV  657
            KLDLDGL+
Sbjct  186  KLDLDGLL  193



>ref|XP_011047000.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Populus euphratica]
Length=561

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 160/193 (83%), Gaps = 5/193 (3%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MAPA  +  +S  AS     GR+ASVYSEVQ+ R++H LPLPSVL+  FK+VDG  SSAA
Sbjct  1    MAPAFVITGDSARAS-----GRFASVYSEVQSCRINHALPLPSVLKHPFKIVDGTRSSAA  55

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSA LVP+D   ++ +  LKI VVLSGGQAPGGHNVISGIFDYL
Sbjct  56   GNPDEIAKLFPNLFGQPSAKLVPNDVDTLSSDQKLKIAVVLSGGQAPGGHNVISGIFDYL  115

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            Q+  KGS LYGF+GGPAGIMKCKYV L  +YIYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  116  QDRAKGSVLYGFKGGPAGIMKCKYVELNADYIYPYRNQGGFDMICSGRDKIETPEQFKQA  175

Query  619  EETAKKLDLDGLV  657
            EET KKLDLDGL+
Sbjct  176  EETVKKLDLDGLL  188



>ref|XP_011002542.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit beta-like [Populus euphratica]
Length=568

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  121  SAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLF  300
            ++  +TGR ASVYSEVQ+SR+DH LPLPSVL+  F++VDGP SSAAG+P+EIAKLFP +F
Sbjct  17   NSAQATGRVASVYSEVQSSRIDHALPLPSVLQNPFQIVDGPPSSAAGNPDEIAKLFPNMF  76

Query  301  GQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRG  480
            GQPSA LVP++   ++ +  L+IGVVLSGGQAPGGHNVISGI+DYLQE  KGS LYGFRG
Sbjct  77   GQPSAMLVPNNVDTLSSDQKLRIGVVLSGGQAPGGHNVISGIYDYLQERAKGSVLYGFRG  136

Query  481  GPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            GPAGIMKCKYV L  +YIYPYRNQGGFDMI SGRDKIETP+QFKQAEETAKKLDLDGLV
Sbjct  137  GPAGIMKCKYVELNADYIYPYRNQGGFDMIASGRDKIETPEQFKQAEETAKKLDLDGLV  195



>ref|XP_010913416.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Elaeis guineensis]
Length=562

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 158/189 (84%), Gaps = 2/189 (1%)
 Frame = +1

Query  97   LLANSDIASAKT--STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPE  270
            + ANS +A+     S GR  +VYSEVQ SRL+HPLPLPSV+R  FK+VDGP SSAAG+P+
Sbjct  1    MAANSVLANGGKGWSPGRLTAVYSEVQTSRLNHPLPLPSVVRGPFKIVDGPPSSAAGNPD  60

Query  271  EIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHC  450
            EI KLFP LFGQPS  LVP  +    M  +LK+GVVLSGGQAPGGHNVISGIFDYLQ+  
Sbjct  61   EIKKLFPNLFGQPSVTLVPTGATPSEMAGSLKVGVVLSGGQAPGGHNVISGIFDYLQDRA  120

Query  451  KGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETA  630
            KGSTLYGF+GGPAGIMKCKYV LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQAEET 
Sbjct  121  KGSTLYGFKGGPAGIMKCKYVELTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETV  180

Query  631  KKLDLDGLV  657
             KLDLDGLV
Sbjct  181  LKLDLDGLV  189



>ref|XP_006417279.1| hypothetical protein EUTSA_v10007237mg [Eutrema salsugineum]
 gb|ESQ35632.1| hypothetical protein EUTSA_v10007237mg [Eutrema salsugineum]
Length=565

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 166/194 (86%), Gaps = 2/194 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGR-YASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSA  255
            MAPA+++  +  + S   +  +  ASVYSEVQ+SR+++PLPLPSVL+ +FK+V+GPASSA
Sbjct  1    MAPALAVNRDLTVGSPDNAPAKGRASVYSEVQSSRINNPLPLPSVLKGAFKIVEGPASSA  60

Query  256  AGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDY  435
            AG+P+EIAKLFPGL+GQPS ++VPD S   +    LKIGVVLSGGQAPGGHNVISG+FDY
Sbjct  61   AGNPDEIAKLFPGLYGQPSVSVVPDQSAP-SSGQKLKIGVVLSGGQAPGGHNVISGLFDY  119

Query  436  LQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQ  615
            LQE  KGST YGF+GGPAGIMKCKYV L  EYI+PYRNQGGFDMICSGRDKIETP+QFKQ
Sbjct  120  LQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIHPYRNQGGFDMICSGRDKIETPEQFKQ  179

Query  616  AEETAKKLDLDGLV  657
            AEETAKKLDLDGLV
Sbjct  180  AEETAKKLDLDGLV  193



>ref|XP_009391472.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009391473.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 160/193 (83%), Gaps = 2/193 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MA A S+LAN    +   +  R ASVYSEVQ SRL+HPLPLPSVL+  FK+VDGP SSAA
Sbjct  1    MATANSVLAND--GAKGPAPPRLASVYSEVQTSRLNHPLPLPSVLKGPFKLVDGPPSSAA  58

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSA LVP  S    +   L+IGVVLSGGQAPGGHNVISGIFDYL
Sbjct  59   GNPDEIAKLFPNLFGQPSANLVPTGSDPSDLAGGLRIGVVLSGGQAPGGHNVISGIFDYL  118

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            QE   GS LYGF+GGPAGIMKCKYV LTP++IYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  119  QERTNGSILYGFKGGPAGIMKCKYVELTPDFIYPYRNQGGFDMICSGRDKIETPEQFKQA  178

Query  619  EETAKKLDLDGLV  657
            EETA KLDLDGLV
Sbjct  179  EETAMKLDLDGLV  191



>emb|CDP11324.1| unnamed protein product [Coffea canephora]
Length=551

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 153/174 (88%), Gaps = 1/174 (1%)
 Frame = +1

Query  139  GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAA  318
            GR AS YSE+Q SRLD  LPLPSVL+ SF VVDGP SSAAG+P+EIAKLFP LFGQPSA 
Sbjct  5    GRLASFYSELQASRLDVSLPLPSVLKNSFNVVDGPPSSAAGNPDEIAKLFPNLFGQPSAM  64

Query  319  LVP-DDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI  495
            LVP D SG ++ N +LKIGVVLSGGQAPGGHNVI GIFDYLQE  KGSTLYGFRGGPAGI
Sbjct  65   LVPGDSSGALSSNQSLKIGVVLSGGQAPGGHNVICGIFDYLQERTKGSTLYGFRGGPAGI  124

Query  496  MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            M CKYV LT ++IYPYRNQGGFDMICSGRDKIETP+QFKQAEETA+KL+LDGLV
Sbjct  125  MNCKYVELTTDFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAQKLNLDGLV  178



>ref|XP_010458622.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1 [Camelina sativa]
Length=567

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 167/199 (84%), Gaps = 10/199 (5%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS------TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDG  240
            MAPA+++    D+ASA  S       GR ASVYSEVQ+SR+++ LPLPSVL+ +FK+V+G
Sbjct  1    MAPALAV--TRDLASAAGSPDNAPAKGR-ASVYSEVQSSRINNALPLPSVLKGAFKIVEG  57

Query  241  PASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVIS  420
            PAS+AAG+P+EIAKLFPGL+GQPS A+VPD +   +    LKIGVVLSGGQAPGGHNVIS
Sbjct  58   PASTAAGNPDEIAKLFPGLYGQPSVAVVPDQNAPTSA-QKLKIGVVLSGGQAPGGHNVIS  116

Query  421  GIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETP  600
            G+FDYLQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETP
Sbjct  117  GLFDYLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIQPYRNQGGFDMICSGRDKIETP  176

Query  601  DQFKQAEETAKKLDLDGLV  657
            DQFKQAEETAKKLDLDGLV
Sbjct  177  DQFKQAEETAKKLDLDGLV  195



>ref|XP_002892669.1| hypothetical protein ARALYDRAFT_888516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68928.1| hypothetical protein ARALYDRAFT_888516 [Arabidopsis lyrata subsp. 
lyrata]
Length=566

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 168/198 (85%), Gaps = 9/198 (5%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKT-----STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGP  243
            MAPA+++    D+ +A +     + GR ASVYSEVQ+SR+++ LPLPSVL  +FK+V+GP
Sbjct  1    MAPALAV--TRDLTAAGSLENAPAKGR-ASVYSEVQSSRINNALPLPSVLNGAFKIVEGP  57

Query  244  ASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISG  423
            ASSAAG+PEEIAKLFPGL+GQPS A+VPD +  ++    LKIGVVLSGGQAPGGHNVISG
Sbjct  58   ASSAAGNPEEIAKLFPGLYGQPSVAVVPDQNASLSA-QKLKIGVVLSGGQAPGGHNVISG  116

Query  424  IFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPD  603
            +FDYLQE  KGST YGF+GGPAGI+KCKYV L  EYI+PYRNQGGFDMICSGRDKIETPD
Sbjct  117  LFDYLQERAKGSTFYGFKGGPAGIIKCKYVELNAEYIHPYRNQGGFDMICSGRDKIETPD  176

Query  604  QFKQAEETAKKLDLDGLV  657
            QFKQAEETAKKLDLDGLV
Sbjct  177  QFKQAEETAKKLDLDGLV  194



>ref|XP_010493617.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Camelina sativa]
Length=567

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 167/199 (84%), Gaps = 10/199 (5%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS------TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDG  240
            MAPA+++    D+A+A  S       GR ASVYSEVQ+SR+++ LPLPSVL+ +FK+V+G
Sbjct  1    MAPALAV--TRDLAAAAGSPDNAPAKGR-ASVYSEVQSSRINNALPLPSVLKGAFKIVEG  57

Query  241  PASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVIS  420
            PAS+AAG+P+EIAKLFPGL+GQPS A+VPD +   +    LKIGVVLSGGQAPGGHNVIS
Sbjct  58   PASTAAGNPDEIAKLFPGLYGQPSVAVVPDQNAPTSA-QKLKIGVVLSGGQAPGGHNVIS  116

Query  421  GIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETP  600
            G+FDYLQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETP
Sbjct  117  GLFDYLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIQPYRNQGGFDMICSGRDKIETP  176

Query  601  DQFKQAEETAKKLDLDGLV  657
            DQFKQAEETAKKLDLDGLV
Sbjct  177  DQFKQAEETAKKLDLDGLV  195



>ref|XP_004486196.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Cicer arietinum]
Length=562

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 161/193 (83%), Gaps = 2/193 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MAP  S++ N D+A    +T R+ASVYSEVQNSR+DH L LPSVL+K F +VDGP SSAA
Sbjct  1    MAPP-SIVTNGDVAPTSITT-RFASVYSEVQNSRVDHDLRLPSVLKKPFAIVDGPKSSAA  58

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSAA+VP D         LK+GVVLSGGQAPGGHNVISGIFDYL
Sbjct  59   GNPDEIAKLFPYLFGQPSAAVVPADLKSALPYKKLKVGVVLSGGQAPGGHNVISGIFDYL  118

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            Q+   GSTLYGF+GGPAGIMK K+V L+ +YIYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  119  QQRASGSTLYGFKGGPAGIMKSKFVELSSDYIYPYRNQGGFDMICSGRDKIETPEQFKQA  178

Query  619  EETAKKLDLDGLV  657
            EET KKLDLDGLV
Sbjct  179  EETVKKLDLDGLV  191



>gb|KHN40852.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Glycine soja]
Length=474

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 159/193 (82%), Gaps = 4/193 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MAP+ ++  N  + S  + TGR ASVYSEVQ +R+DH LPLPSVL+  F ++ GP SSAA
Sbjct  1    MAPSTTV-PNGTLPSG-SVTGRLASVYSEVQKTRVDHALPLPSVLKHPFTILHGPPSSAA  58

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSAAL   D+        LKIGVVLSGGQAPGGHNVISGIFDYL
Sbjct  59   GNPDEIAKLFPHLFGQPSAALARSDAAQT--QKKLKIGVVLSGGQAPGGHNVISGIFDYL  116

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            QE   GSTLYGF+GGPAGIMKCKYV LT EYIYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  117  QERAPGSTLYGFKGGPAGIMKCKYVELTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQA  176

Query  619  EETAKKLDLDGLV  657
            EETAKKLDLDGLV
Sbjct  177  EETAKKLDLDGLV  189



>ref|XP_010533788.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1 [Tarenaya hassleriana]
Length=565

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 163/195 (84%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLAN--SDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAPAI+L+ +  +   +   +TGR ASVYSEVQ+ R++H LPLPSVLR  F +VDGP SS
Sbjct  1    MAPAIALIPDIAAGAPANAPATGR-ASVYSEVQSCRINHALPLPSVLRCPFNIVDGPPSS  59

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPS +LV D +   +M+  LK+GVVLSGGQAPGGHNVISG+FD
Sbjct  60   AAGNPDEIAKLFPCLFGQPSVSLVADQNA-ASMDQKLKVGVVLSGGQAPGGHNVISGLFD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQ    GST YGFRGGPAGIMKCKYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  119  YLQNRANGSTFYGFRGGPAGIMKCKYVELTSDYIYPYRNQGGFDMICSGRDKIETPEQFK  178

Query  613  QAEETAKKLDLDGLV  657
            QAEETAKKLDLDGLV
Sbjct  179  QAEETAKKLDLDGLV  193



>ref|XP_006307130.1| hypothetical protein CARUB_v10008719mg [Capsella rubella]
 gb|EOA40028.1| hypothetical protein CARUB_v10008719mg [Capsella rubella]
Length=567

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 168/199 (84%), Gaps = 10/199 (5%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS------TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDG  240
            MAPA+++  + D+ +A  S       GR ASVYSEVQ+SR+++ LPLPSVL+ +FK+V+G
Sbjct  1    MAPALAV--SRDLTAAVGSPDNAPAKGR-ASVYSEVQSSRINNALPLPSVLKGAFKIVEG  57

Query  241  PASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVIS  420
            PAS+AAG+P+EIAKLFPGL+GQPS A+VPD S   +    LKIGVVLSGGQAPGGHNVIS
Sbjct  58   PASTAAGNPDEIAKLFPGLYGQPSVAVVPDQSAPSSA-QKLKIGVVLSGGQAPGGHNVIS  116

Query  421  GIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETP  600
            G+FDYLQE  KGST YGF+GGPAGIMKCKYV L  EYI+PYRNQGGFDMICSGRDKIETP
Sbjct  117  GLFDYLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIHPYRNQGGFDMICSGRDKIETP  176

Query  601  DQFKQAEETAKKLDLDGLV  657
            DQFKQAEETAKKLDLDGLV
Sbjct  177  DQFKQAEETAKKLDLDGLV  195



>gb|KFK43462.1| hypothetical protein AALP_AA1G128500 [Arabis alpina]
Length=565

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 164/194 (85%), Gaps = 2/194 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGR-YASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSA  255
            MAP+I++  +    S + +  +  ASVYSEVQ+SR+++ LPLPSVL+ SFK+V+GPASSA
Sbjct  1    MAPSIAVTRDLAAGSPENAPAKGRASVYSEVQSSRINNALPLPSVLKGSFKIVEGPASSA  60

Query  256  AGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDY  435
            AG+PEEIAKLFPGL+GQPS A+VPD +   +    LKIGVVLSGGQAPGGHNVISG+FDY
Sbjct  61   AGNPEEIAKLFPGLYGQPSVAVVPDQNA-ASSAPKLKIGVVLSGGQAPGGHNVISGLFDY  119

Query  436  LQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQ  615
            LQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETP+QFKQ
Sbjct  120  LQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIQPYRNQGGFDMICSGRDKIETPEQFKQ  179

Query  616  AEETAKKLDLDGLV  657
            AEETAKKLDLDGLV
Sbjct  180  AEETAKKLDLDGLV  193



>ref|XP_009408423.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like [Musa 
acuminata subsp. malaccensis]
Length=564

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  133  STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPS  312
            S GR ASVYSEVQ  RL HPLPLPSVL+  FK++DGP SSAAG+P+EIAKLFP +FGQPS
Sbjct  17   SPGRLASVYSEVQTDRLHHPLPLPSVLKGPFKLLDGPPSSAAGNPDEIAKLFPNMFGQPS  76

Query  313  AALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAG  492
            A LVP  S    +   LKIGVVLSGGQAPGGHNVISG+FDYLQE  + STLYGF+GGPAG
Sbjct  77   AKLVPTGSVPADLPQGLKIGVVLSGGQAPGGHNVISGVFDYLQERARRSTLYGFKGGPAG  136

Query  493  IMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            IMKCKYV LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQAEETA KLDLDGL+
Sbjct  137  IMKCKYVELTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAMKLDLDGLL  191



>ref|XP_006287381.1| hypothetical protein CARUB_v10000587mg [Capsella rubella]
 gb|EOA20279.1| hypothetical protein CARUB_v10000587mg [Capsella rubella]
Length=569

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 157/196 (80%), Gaps = 3/196 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIA---SAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPAS  249
            MA  + L+    IA   S   +  R  SVYSEVQ SR++H LPLPSV +  FK++DGP S
Sbjct  1    MASQLDLIGKDYIAGISSNPRAASRVTSVYSEVQASRINHTLPLPSVFKNPFKIIDGPPS  60

Query  250  SAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF  429
            S+AGHPEEI KLFP LFGQPSA LVP+ S +V  N  LKIGVVLSGGQAPGGHNVI GIF
Sbjct  61   SSAGHPEEIEKLFPNLFGQPSALLVPNQSNEVPSNQKLKIGVVLSGGQAPGGHNVICGIF  120

Query  430  DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQF  609
            DYLQE+ KGSTL+GFRGGPAGIMK KY+ LT E++YPYRNQGGFDMICSGRDKIETP+QF
Sbjct  121  DYLQEYVKGSTLFGFRGGPAGIMKGKYIDLTSEFVYPYRNQGGFDMICSGRDKIETPEQF  180

Query  610  KQAEETAKKLDLDGLV  657
            +QAEET  K+DLDGLV
Sbjct  181  QQAEETVTKMDLDGLV  196



>ref|XP_010244159.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Nelumbo nucifera]
Length=570

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +1

Query  133  STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPS  312
            S GR+A VYSEVQ  RL H LPLPSVL+  FK+V+GP S+AAG+P+EIAKLFP +FGQPS
Sbjct  23   SPGRFAEVYSEVQTHRLKHSLPLPSVLKSPFKIVEGPPSTAAGNPDEIAKLFPNVFGQPS  82

Query  313  AALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAG  492
            + LVP DS  +A N  LKIGVVLSGGQAPGGHNVISGIFDYLQ+  KGSTLYGF+GGPAG
Sbjct  83   SMLVPSDSAALASNEKLKIGVVLSGGQAPGGHNVISGIFDYLQDRVKGSTLYGFKGGPAG  142

Query  493  IMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            IM+CK+V LTP+YIYPYRNQGGFDMI SGRDKIETP+QFKQAEET  KLDLDGLV
Sbjct  143  IMRCKFVELTPDYIYPYRNQGGFDMIRSGRDKIETPEQFKQAEETVLKLDLDGLV  197



>ref|XP_002518416.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF43803.1| phosphofructokinase, putative [Ricinus communis]
Length=552

 Score =   285 bits (728),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +1

Query  124  AKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFG  303
            A  ++GR ASVYSEVQ+SR++H LPLPSVL   FK+V GP SSAAG+P+EIAKLFP LFG
Sbjct  2    ATPNSGRAASVYSEVQSSRIEHVLPLPSVLNHPFKIVQGPPSSAAGNPDEIAKLFPNLFG  61

Query  304  QPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGG  483
            QPSA LVPD +  +  N  LKIG+VLSGGQAPGGHNVISGIFDYLQ+  KGS LYGFRGG
Sbjct  62   QPSAMLVPDVADSLDSNQQLKIGLVLSGGQAPGGHNVISGIFDYLQDRAKGSILYGFRGG  121

Query  484  PAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            PAGIMKC YV LT +YI+PYRNQGGFDMICSGRDKIETP+QFKQAEETA KLDLDGLV
Sbjct  122  PAGIMKCNYVQLTADYIHPYRNQGGFDMICSGRDKIETPEQFKQAEETAGKLDLDGLV  179



>ref|NP_192313.3| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
 sp|F4JGR5.1|PFPB2_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2; Short=PFP 2; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 2; AltName: Full=PPi-PFK 
2; AltName: Full=Protein MATERNAL EFFECT EMBRYO ARREST 
51; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
2 [Arabidopsis thaliana]
 gb|AEE82365.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
Length=569

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 157/196 (80%), Gaps = 3/196 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKT---STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPAS  249
            MA  + L+    IA       +  R  SVYSEVQ SR+DH LPLPSV +  FK++DGP S
Sbjct  1    MASQLDLIGGDYIAGISINPPTNSRVTSVYSEVQASRIDHTLPLPSVFKTPFKIIDGPPS  60

Query  250  SAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF  429
            S+AGHPEEI KLFP LFGQPSA LVP+ S +V+ +  LKIGVVLSGGQAPGGHNVI GIF
Sbjct  61   SSAGHPEEIEKLFPNLFGQPSALLVPNQSNEVSSDQKLKIGVVLSGGQAPGGHNVICGIF  120

Query  430  DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQF  609
            DYLQE+ +GS+L+GFRGGPAGIMK KY+ LT E++YPYRNQGGFDMICSGRDKIETP+QF
Sbjct  121  DYLQEYARGSSLFGFRGGPAGIMKGKYIELTSEFVYPYRNQGGFDMICSGRDKIETPEQF  180

Query  610  KQAEETAKKLDLDGLV  657
            KQAEET  K+DLDGLV
Sbjct  181  KQAEETVTKMDLDGLV  196



>ref|NP_001148574.1| LOC100282190 [Zea mays]
 gb|ACF84415.1| unknown [Zea mays]
 gb|ACG32090.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase beta 
subunit [Zea mays]
Length=564

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 158/193 (82%), Gaps = 2/193 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MA A        +A+   + GR ASVYSEVQ SRL H LPLPSVLR +F VVDGPASSAA
Sbjct  1    MAAAAVTSNGGAVAANGPAPGRLASVYSEVQTSRLLHTLPLPSVLRSNFSVVDGPASSAA  60

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSA+LVP  S + A    LK+GVVLSGGQAPGGHNVI GIFDYL
Sbjct  61   GNPDEIAKLFPNLFGQPSASLVP--SAEPAATRPLKVGVVLSGGQAPGGHNVICGIFDYL  118

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            QE  KGSTL GF+GGPAGIMKCKYV LT +++YPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  119  QERAKGSTLLGFKGGPAGIMKCKYVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFKQA  178

Query  619  EETAKKLDLDGLV  657
            E+TA KLDLDGLV
Sbjct  179  EDTANKLDLDGLV  191



>ref|XP_010546562.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Tarenaya hassleriana]
Length=565

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 164/197 (83%), Gaps = 8/197 (4%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS----TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPA  246
            MAPAI+++ N D+A+   +    TGR ASVYSEVQ+ R++H LPLPSVLR  FK+VDGP 
Sbjct  1    MAPAIAVV-NRDLAAGAPANAPATGR-ASVYSEVQSCRINHALPLPSVLRDPFKIVDGPP  58

Query  247  SSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGI  426
            SSAAG+P+EIAKLFP LFGQPS +LV D   +      LKIGVVLSGGQAPGGHNVISG+
Sbjct  59   SSAAGNPDEIAKLFPCLFGQPSVSLVSDQ--NALSGQKLKIGVVLSGGQAPGGHNVISGL  116

Query  427  FDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ  606
            FDYLQ+   GSTLYGFRGGPAGIMKCKYV LT +YIYPYRNQGGFDMICSGRDKIETP+Q
Sbjct  117  FDYLQDRANGSTLYGFRGGPAGIMKCKYVELTSDYIYPYRNQGGFDMICSGRDKIETPEQ  176

Query  607  FKQAEETAKKLDLDGLV  657
            FKQAEETA KLDLDGLV
Sbjct  177  FKQAEETANKLDLDGLV  193



>ref|XP_002872678.1| hypothetical protein ARALYDRAFT_490075 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48937.1| hypothetical protein ARALYDRAFT_490075 [Arabidopsis lyrata subsp. 
lyrata]
Length=569

 Score =   284 bits (727),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKT---STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPAS  249
            MA  + L+    IA   +   +  R  SVYSEVQ SR+DH LPLPSV +  FK++DGP S
Sbjct  1    MAAQLDLIGEEYIAGISSNPPANTRVTSVYSEVQASRIDHALPLPSVFKTPFKIIDGPPS  60

Query  250  SAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF  429
            SAAGHPEEI KLFP LFGQPSA LVP+ S +V+ +  LKIGVVLSGGQAPGGHNVI GIF
Sbjct  61   SAAGHPEEIEKLFPKLFGQPSAILVPNQSDEVSSSQKLKIGVVLSGGQAPGGHNVICGIF  120

Query  430  DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQF  609
            DYLQE+ KGS+L+GFRGGPAGIMK KY+ LT E++YPYRNQGGFDMICSGRDKIETP+QF
Sbjct  121  DYLQEYAKGSSLFGFRGGPAGIMKGKYIELTSEFVYPYRNQGGFDMICSGRDKIETPEQF  180

Query  610  KQAEETAKKLDLDGLV  657
            +QAEET  K+DLDGLV
Sbjct  181  QQAEETVTKMDLDGLV  196



>ref|XP_002317160.2| pyrophosphate--fructose-6-phosphate 1-phosphotransferase beta 
subunit family protein [Populus trichocarpa]
 gb|EEE97772.2| pyrophosphate--fructose-6-phosphate 1-phosphotransferase beta 
subunit family protein [Populus trichocarpa]
Length=565

 Score =   284 bits (726),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  133  STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPS  312
            ++GR ASVYSEVQ+SR+DH LPLPSVL+  F++VDGP SSAAG+P+EIAKLFP +FGQPS
Sbjct  21   ASGRVASVYSEVQSSRIDHALPLPSVLQNPFQIVDGPPSSAAGNPDEIAKLFPNMFGQPS  80

Query  313  AALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAG  492
            A LVP++   ++ +  L+IGVVLSGGQAPGGHNVISGI+DYLQ+  KGS LYGFRGGPAG
Sbjct  81   AMLVPNNVDTLSSDQKLRIGVVLSGGQAPGGHNVISGIYDYLQDRAKGSVLYGFRGGPAG  140

Query  493  IMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            IMKCKYV L  +YIYPYRNQGGFDMI SGRDKIE+P+QFKQAEETAKKLDLDGLV
Sbjct  141  IMKCKYVELNADYIYPYRNQGGFDMIASGRDKIESPEQFKQAEETAKKLDLDGLV  195



>ref|XP_003534704.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Glycine max]
Length=562

 Score =   284 bits (726),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 159/193 (82%), Gaps = 4/193 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MAP+ ++  N  + S  + TGR ASVYSEVQ +R+DH LPLPSVL+  F ++ GP SSAA
Sbjct  1    MAPSTTV-PNGTLPSG-SVTGRLASVYSEVQKTRVDHALPLPSVLKHPFTILHGPPSSAA  58

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSAAL   D+        LKIGVVLSGGQAPGGHNVISGIFDYL
Sbjct  59   GNPDEIAKLFPHLFGQPSAALARSDAAQT--QKKLKIGVVLSGGQAPGGHNVISGIFDYL  116

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            QE   GSTLYGF+GGPAGIMKCKYV LT EYIYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  117  QERAPGSTLYGFKGGPAGIMKCKYVELTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQA  176

Query  619  EETAKKLDLDGLV  657
            EETAKKLDLDGLV
Sbjct  177  EETAKKLDLDGLV  189



>ref|XP_006826755.1| hypothetical protein AMTR_s00136p00065750 [Amborella trichopoda]
 gb|ERM93992.1| hypothetical protein AMTR_s00136p00065750 [Amborella trichopoda]
Length=568

 Score =   284 bits (726),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  91   ISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPE  270
            +++  NS   SAK + GR ASVYSEVQ SRL+HPLPLPS+L K FK+ DGP SSAAG+P+
Sbjct  7    VNVQNNSTSGSAKANPGRLASVYSEVQTSRLNHPLPLPSILTKPFKLQDGPPSSAAGNPD  66

Query  271  EIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHC  450
            EIAKLFP LFGQPS  LV  ++  +  +  LKIGVVLSGGQAPGGHNVISGIFDY+Q   
Sbjct  67   EIAKLFPNLFGQPSTLLVSSENRALRSDQKLKIGVVLSGGQAPGGHNVISGIFDYMQGLT  126

Query  451  KGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETA  630
             GSTLYGF+GGPAGIMKCKYV LT ++IYPYRNQGGFDMICSGRDKIETP+QFKQAEET+
Sbjct  127  SGSTLYGFKGGPAGIMKCKYVELTSDFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETS  186

Query  631  KKLDLDGLV  657
             KL+LDGLV
Sbjct  187  LKLELDGLV  195



>ref|NP_001168412.1| ppi-phosphofructokinase [Zea mays]
 gb|ACN28133.1| unknown [Zea mays]
 gb|AFW76871.1| ppi-phosphofructokinase [Zea mays]
Length=564

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 158/193 (82%), Gaps = 2/193 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MA A        +A+   + GR ASVYSEVQ +RL H LPLPSVLR +F VV GPASSAA
Sbjct  1    MAAAAVTSNGGAVAANGPAPGRLASVYSEVQTNRLLHALPLPSVLRSNFSVVVGPASSAA  60

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSA+LVP  S + A    LKIGVVLSGGQAPGGHNVI GIFDYL
Sbjct  61   GNPDEIAKLFPNLFGQPSASLVP--SAEPAATRPLKIGVVLSGGQAPGGHNVICGIFDYL  118

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            QE  KGSTLYGF+GGPAGIMKCKYV LT +++YPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  119  QERAKGSTLYGFKGGPAGIMKCKYVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFKQA  178

Query  619  EETAKKLDLDGLV  657
            E+TA KLDLDGLV
Sbjct  179  EDTANKLDLDGLV  191



>ref|XP_004145428.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Cucumis sativus]
 gb|KGN66845.1| hypothetical protein Csa_1G701210 [Cucumis sativus]
Length=569

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +1

Query  136  TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSA  315
            T R +S++S+VQ  R+  PLPLPSVL+  F+++DGP SSA  +P+EIAKLFP L+GQPSA
Sbjct  22   TARVSSLFSQVQAHRIHQPLPLPSVLKNRFQILDGPPSSAVANPDEIAKLFPSLYGQPSA  81

Query  316  ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI  495
             LVP DS  V +N  LKIGVVLSGGQAPGGHNVISG+FDYLQ+H +GSTLYGF+GGPAGI
Sbjct  82   MLVPSDSSSVQVNKKLKIGVVLSGGQAPGGHNVISGLFDYLQDHARGSTLYGFKGGPAGI  141

Query  496  MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            MKCKYV LT E+IYPYRNQGGFDMICSGRDKIETP+QFKQAEETA++LDLDGLV
Sbjct  142  MKCKYVELTAEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAQRLDLDGLV  195



>ref|XP_007153992.1| hypothetical protein PHAVU_003G082000g [Phaseolus vulgaris]
 gb|ESW25986.1| hypothetical protein PHAVU_003G082000g [Phaseolus vulgaris]
Length=568

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +1

Query  130  TSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQP  309
            + TGR+A+VYSEVQNSR+DH LPLPSVL+  F +VDG  S+AAG+P+EIAKLFP LFGQP
Sbjct  20   SDTGRFAAVYSEVQNSRIDHALPLPSVLKNPFVIVDGHQSTAAGNPDEIAKLFPNLFGQP  79

Query  310  SAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPA  489
            SA+LVP DS  +  N  LKIGVVLSGGQAPGGHNVISGIFDYLQ+  +GSTLYGFRGGPA
Sbjct  80   SASLVPSDSHALHANPKLKIGVVLSGGQAPGGHNVISGIFDYLQDKAEGSTLYGFRGGPA  139

Query  490  GIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            GIMK KYV LT +YIYPYRNQGGFDMI SGRDKIETP+QF+QAEET +KLDLDGLV
Sbjct  140  GIMKSKYVELTSDYIYPYRNQGGFDMIRSGRDKIETPEQFRQAEETVQKLDLDGLV  195



>sp|Q41141.1|PFPB_RICCO RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Ricinus communis]
 emb|CAA83683.1| pyrophosphate-dependent phosphofructokinase beta subunit [Ricinus 
communis]
Length=552

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +1

Query  124  AKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFG  303
            A  ++GR ASVYSEVQ+SR++H LPLPSVL   FK+V GP SSAAG+P+EIAKLFP LFG
Sbjct  2    ATPNSGRAASVYSEVQSSRIEHVLPLPSVLNHPFKIVQGPPSSAAGNPDEIAKLFPNLFG  61

Query  304  QPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGG  483
            QPSA LVPD +  +  N  LKIG+VLSGGQAPGGHNVISGIFDYLQ+  KGS LYGFRGG
Sbjct  62   QPSAMLVPDVADSLDSNQQLKIGLVLSGGQAPGGHNVISGIFDYLQDRAKGSILYGFRGG  121

Query  484  PAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            PAGIMKC YV LT +YI+PYRNQGGFDMICSGRDKIETP+QFKQAEETA KLDL+GLV
Sbjct  122  PAGIMKCNYVQLTADYIHPYRNQGGFDMICSGRDKIETPEQFKQAEETAGKLDLNGLV  179



>ref|XP_002438147.1| hypothetical protein SORBIDRAFT_10g008850 [Sorghum bicolor]
 gb|EER89514.1| hypothetical protein SORBIDRAFT_10g008850 [Sorghum bicolor]
Length=565

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 160/192 (83%), Gaps = 2/192 (1%)
 Frame = +1

Query  82   APAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAG  261
            A A++    +  A+   + GR ASVYSEVQ +RL H LPLPSVLR +F VVDGPASSAAG
Sbjct  3    AAAVTSNGGAVAANGGPAPGRLASVYSEVQTNRLLHALPLPSVLRSNFSVVDGPASSAAG  62

Query  262  HPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQ  441
            +P+EIAKLFP LFGQPSA+LVP  + + A    LK+GVVLSGGQAPGGHNVI GIFDYLQ
Sbjct  63   NPDEIAKLFPNLFGQPSASLVP--AAEPAATRPLKVGVVLSGGQAPGGHNVICGIFDYLQ  120

Query  442  EHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAE  621
            E  KGST+YGF+GGPAG+MKCKYV LT +++YPYRNQGGFDMICSGRDKIETP+QFKQAE
Sbjct  121  ERAKGSTMYGFKGGPAGVMKCKYVELTADFVYPYRNQGGFDMICSGRDKIETPEQFKQAE  180

Query  622  ETAKKLDLDGLV  657
            +TA KLDLDGLV
Sbjct  181  DTANKLDLDGLV  192



>ref|XP_010686769.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Beta vulgaris subsp. vulgaris]
Length=566

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 161/192 (84%), Gaps = 2/192 (1%)
 Frame = +1

Query  88   AISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAG  261
            A + +AN DI +AK+S   GR+++VYSE+Q SR+DH LPLP VL  +F VVDGP SSAAG
Sbjct  2    AAAAVANGDIFAAKSSPTVGRFSTVYSELQRSRIDHSLPLPRVLNGNFTVVDGPKSSAAG  61

Query  262  HPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQ  441
            +P+EIAKLFP L+GQPS+ +VP DS  ++ +  LKIGVVLSGGQAPGGHNVI GIFDYLQ
Sbjct  62   NPDEIAKLFPSLYGQPSSVMVPSDSEGLSSSQKLKIGVVLSGGQAPGGHNVICGIFDYLQ  121

Query  442  EHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAE  621
               KGS +YGFRGGPAGIMK KYV LT ++++PYRNQGGFDMICSGRDKIETP+QFKQAE
Sbjct  122  ARAKGSVVYGFRGGPAGIMKGKYVELTWDFVHPYRNQGGFDMICSGRDKIETPEQFKQAE  181

Query  622  ETAKKLDLDGLV  657
            ETA KLDLDGLV
Sbjct  182  ETAMKLDLDGLV  193



>gb|KJB67274.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=558

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 160/195 (82%), Gaps = 12/195 (6%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAP  S + N D+A+ KT+   GR ASVYSEVQ SR+DH LP+PSVLR  FK+VDGPASS
Sbjct  1    MAP--SFVTNGDVAAVKTTPFAGRLASVYSEVQTSRIDHALPVPSVLRSPFKIVDGPASS  58

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFP LFGQPS+ LVP+   ++  +  LKIGVVLSGGQAPGGHNVISGIF 
Sbjct  59   AAGNPDEIAKLFPNLFGQPSSMLVPNGVDNIGSDQKLKIGVVLSGGQAPGGHNVISGIF-  117

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
                   GSTLYGF+GGPAGIMK KYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFK
Sbjct  118  -------GSTLYGFKGGPAGIMKGKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFK  170

Query  613  QAEETAKKLDLDGLV  657
            QAEETA KLDLDGLV
Sbjct  171  QAEETAAKLDLDGLV  185



>ref|NP_172664.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase subunit 
beta 1 [Arabidopsis thaliana]
 sp|Q8W4M5.1|PFPB1_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1; Short=PFP 1; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 1; AltName: Full=PPi-PFK 
1; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
1 [Arabidopsis thaliana]
 gb|AAL32551.1| Similar to pyrophosphate-dependent phosphofuctokinase beta subunit 
[Arabidopsis thaliana]
 gb|AAM13259.1| similar to pyrophosphate-dependent phosphofuctokinase beta subunit 
[Arabidopsis thaliana]
 gb|AEE28825.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
Length=566

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 165/195 (85%), Gaps = 3/195 (2%)
 Frame = +1

Query  79   MAPAISLLAN-SDIASAKTSTGR-YASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAPA+++  + + + S + +  +  ASVYSEVQ+SR+++ LPLPSVL+ +FK+V+GPASS
Sbjct  1    MAPALAVTRDLTAVGSPENAPAKGRASVYSEVQSSRINNTLPLPSVLKGAFKIVEGPASS  60

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P+EIAKLFPGL+GQPS A+VPD     +    LKIGVVLSGGQAPGGHNVISG+FD
Sbjct  61   AAGNPDEIAKLFPGLYGQPSVAVVPDQDAPSSA-PKLKIGVVLSGGQAPGGHNVISGLFD  119

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETPDQFK
Sbjct  120  YLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIQPYRNQGGFDMICSGRDKIETPDQFK  179

Query  613  QAEETAKKLDLDGLV  657
            QAEETAKKLDLDGLV
Sbjct  180  QAEETAKKLDLDGLV  194



>ref|XP_004157729.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Cucumis sativus]
Length=569

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +1

Query  136  TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSA  315
            T R +S++S+VQ  R+  PLP PSVL+  F+++DGP SSA  +P+EIAKLFP L+GQPSA
Sbjct  22   TARVSSLFSQVQAHRIHQPLPFPSVLKNRFQILDGPPSSAVANPDEIAKLFPSLYGQPSA  81

Query  316  ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI  495
             LVP DS  V +N  LKIGVVLSGGQAPGGHNVISG+FDYLQ+H +GSTLYGF+GGPAGI
Sbjct  82   MLVPSDSSSVQVNKKLKIGVVLSGGQAPGGHNVISGLFDYLQDHARGSTLYGFKGGPAGI  141

Query  496  MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            MKCKYV LT E+IYPYRNQGGFDMICSGRDKIETP+QFKQAEETA++LDLDGLV
Sbjct  142  MKCKYVELTAEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAQRLDLDGLV  195



>ref|XP_010433059.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2 [Camelina sativa]
Length=569

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 155/196 (79%), Gaps = 3/196 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKT---STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPAS  249
            MA  + L+    IA       +  R  SVYSEVQ SR+DH LPLPSV +  FK++DGP S
Sbjct  1    MASQLDLIGKDYIAGISNNPRAASRVTSVYSEVQASRIDHALPLPSVFKNPFKIIDGPLS  60

Query  250  SAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF  429
            S+AGHPEEI KLFP L+GQPSA LVP+ S  V  +  LKIGVVLSGGQAPGGHNVI GIF
Sbjct  61   SSAGHPEEIEKLFPNLYGQPSALLVPNQSDAVKSDQKLKIGVVLSGGQAPGGHNVICGIF  120

Query  430  DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQF  609
            DYLQE+ KGS+L+GFRGGPAGIMK KY+ LT E++YPYRNQGGFDMICSGRDKIETP+QF
Sbjct  121  DYLQEYVKGSSLFGFRGGPAGIMKGKYIELTSEFVYPYRNQGGFDMICSGRDKIETPEQF  180

Query  610  KQAEETAKKLDLDGLV  657
            +QAEET  K+DLDGLV
Sbjct  181  RQAEETVTKMDLDGLV  196



>gb|KDO54283.1| hypothetical protein CISIN_1g042388mg [Citrus sinensis]
Length=567

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 157/188 (84%), Gaps = 2/188 (1%)
 Frame = +1

Query  100  LANSDIASAKTS-TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEI  276
            ++N++  + K    GR ASVYSE+Q SRL+  LPLPSVL+K+F VVDG  SSA+G+PEEI
Sbjct  1    MSNTNAPTVKKDGPGRLASVYSELQTSRLNVSLPLPSVLKKTFNVVDGAPSSASGNPEEI  60

Query  277  AKLFPGLFGQPSAALVPDDSGDVAM-NHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCK  453
             KLFP LFGQPSA LV  D    +M N +LKIGVVLSGGQAPGGHNVISGIFDYLQE   
Sbjct  61   KKLFPKLFGQPSARLVECDPKACSMENKSLKIGVVLSGGQAPGGHNVISGIFDYLQERTN  120

Query  454  GSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAK  633
            GS LYGF+GGPAGIMKCKYV L+ EYIYPYRNQGGFDMICSGRDKIETP+QFKQAEETAK
Sbjct  121  GSKLYGFKGGPAGIMKCKYVELSTEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAK  180

Query  634  KLDLDGLV  657
            KLDLDGLV
Sbjct  181  KLDLDGLV  188



>ref|XP_010496159.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like [Camelina sativa]
Length=569

 Score =   279 bits (713),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 155/196 (79%), Gaps = 3/196 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKT---STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPAS  249
            MA  + L+    IA       +  R  SVYSEVQ +R+DH LPLPSV +  FK++DGP S
Sbjct  1    MASQLDLIGKDYIAGISNNPRAASRVTSVYSEVQANRIDHALPLPSVFKSPFKIIDGPPS  60

Query  250  SAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF  429
            S+AGHPEEI KLFP L+GQPSA LVP+ S  V  +  LKIGVVLSGGQAPGGHNVI GIF
Sbjct  61   SSAGHPEEIEKLFPNLYGQPSALLVPNQSDAVKSDQKLKIGVVLSGGQAPGGHNVICGIF  120

Query  430  DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQF  609
            DYLQE+ KGS+L+GFRGGPAGIMK KY+ LT E++YPYRNQGGFDMICSGRDKIETP+QF
Sbjct  121  DYLQEYVKGSSLFGFRGGPAGIMKGKYIELTSEFVYPYRNQGGFDMICSGRDKIETPEQF  180

Query  610  KQAEETAKKLDLDGLV  657
            +QAEET  K+DLDGLV
Sbjct  181  QQAEETVTKMDLDGLV  196



>ref|XP_006447627.1| hypothetical protein CICLE_v10017788mg [Citrus clementina]
 gb|ESR60867.1| hypothetical protein CICLE_v10017788mg [Citrus clementina]
Length=600

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 158/190 (83%), Gaps = 2/190 (1%)
 Frame = +1

Query  94   SLLANSDIASAKTS-TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPE  270
            S+++N++  + K    GR ASVYSE+Q SRL+  LPL SVL+K+F VVDG  SSA+G+PE
Sbjct  26   SIMSNTNAPTVKKDGPGRLASVYSELQTSRLNVSLPLLSVLKKTFNVVDGAPSSASGNPE  85

Query  271  EIAKLFPGLFGQPSAALVPDDSGDVAM-NHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            EI KLFP LFGQPSA LV  D    +M N +LKIGVVLSGGQAPGGHNVISGIFDYLQE 
Sbjct  86   EIKKLFPKLFGQPSARLVECDPKACSMENKSLKIGVVLSGGQAPGGHNVISGIFDYLQER  145

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
              GS LYGF+GGPAGIMKCKYV L+ EYIYPYRNQGGFDMICSGRDKIETP+QFKQAEET
Sbjct  146  TNGSKLYGFKGGPAGIMKCKYVELSTEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEET  205

Query  628  AKKLDLDGLV  657
            AKKLDLDGLV
Sbjct  206  AKKLDLDGLV  215



>gb|AIE88316.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase 2 [Eriobotrya 
japonica]
Length=556

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  121  SAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLF  300
            + K   GR+ S YSEVQ SRLD PLPLPSVL+ SF VVDGP SSAAG+PEEIAKLFP LF
Sbjct  5    NGKAVPGRFVSSYSEVQASRLDVPLPLPSVLKSSFSVVDGPKSSAAGNPEEIAKLFPNLF  64

Query  301  GQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRG  480
            GQPSA L P  +  ++ + +LKIGVVLSGGQAPGGHNVI GIFDYLQ+H  GS +YGF+G
Sbjct  65   GQPSAMLRPGGTSVLSKDTSLKIGVVLSGGQAPGGHNVICGIFDYLQKHTSGSIMYGFKG  124

Query  481  GPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            GPAGIMKCKYV L+ E+IYPYRNQGGFDMI SGRDKIETP+QFK AEETAKK DLDGLV
Sbjct  125  GPAGIMKCKYVQLSAEFIYPYRNQGGFDMIASGRDKIETPEQFKLAEETAKKFDLDGLV  183



>ref|XP_008379662.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Malus domestica]
Length=556

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  121  SAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLF  300
            + K   GR+ S YSEVQ SRLD PLPLPSVL+ SF VVDGP SSAAG+PEEIAKLFP LF
Sbjct  5    NGKAVPGRFVSSYSEVQASRLDVPLPLPSVLKSSFSVVDGPKSSAAGNPEEIAKLFPNLF  64

Query  301  GQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRG  480
            GQPSA L P  S  +  + +LKIGVVLSGGQAPGGHNVI GIFDYLQ+H  GS +YGF+G
Sbjct  65   GQPSAMLRPGGSSVLPKDKSLKIGVVLSGGQAPGGHNVICGIFDYLQKHTSGSIMYGFKG  124

Query  481  GPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            GPAGIMKCKYV L+ E+IYPYRNQGGFDMI SGRDKIETP+QFK AEETAKK DLDGLV
Sbjct  125  GPAGIMKCKYVQLSAEFIYPYRNQGGFDMIASGRDKIETPEQFKLAEETAKKFDLDGLV  183



>ref|XP_004965128.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Setaria italica]
Length=564

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  142  RYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAAL  321
            R ASVYSEVQ SRL H LPLPSVLR ++ VVDGPASSAAG+P+EIAKLFP LFGQPSA+L
Sbjct  22   RLASVYSEVQTSRLVHALPLPSVLRSNYSVVDGPASSAAGNPDEIAKLFPNLFGQPSASL  81

Query  322  VPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMK  501
            VP  + + A    LK+GVVLSGGQAPGGHNVI GIFDYLQE  KGST+YGF+GGPAGIMK
Sbjct  82   VP--AAEPAATRPLKVGVVLSGGQAPGGHNVICGIFDYLQERAKGSTMYGFKGGPAGIMK  139

Query  502  CKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            CKYV L   ++YPYRNQGGFDMICSGRDKIETP+QFKQAE+TA KL+LDGLV
Sbjct  140  CKYVELNSAFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTANKLELDGLV  191



>ref|XP_010422248.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like isoform X2 [Camelina sativa]
Length=569

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +1

Query  115  IASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPG  294
            I++   +  R +SVYSEVQ SR+DH LPLPSV +  FK++DGP SS+AGHPEEI KLFP 
Sbjct  16   ISNNPRAASRVSSVYSEVQASRIDHALPLPSVFKNPFKIIDGPPSSSAGHPEEIEKLFPN  75

Query  295  LFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGF  474
            LFGQPSA LV + S  V  +  LKIGVVLSGGQAPGGHNVI GIFDYLQE+ KGS+L+GF
Sbjct  76   LFGQPSALLVLNQSDAVKSDQKLKIGVVLSGGQAPGGHNVICGIFDYLQEYVKGSSLFGF  135

Query  475  RGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGL  654
            RGGPAGIMK KY+ LT E++YPYRNQGGFDMICSGRDKIETP+QF+QAEET  K+DLDGL
Sbjct  136  RGGPAGIMKGKYIELTSEFVYPYRNQGGFDMICSGRDKIETPEQFQQAEETVTKMDLDGL  195

Query  655  V  657
            V
Sbjct  196  V  196



>ref|XP_006469757.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Citrus sinensis]
Length=567

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = +1

Query  100  LANSDIASAKTST-GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEI  276
            ++N++  + K    GR ASVYSE+Q SRL+  LPL SVL+K+F VVDG  SSA+G+PEEI
Sbjct  1    MSNTNAPTVKKDGPGRLASVYSELQTSRLNVSLPLLSVLKKTFNVVDGAPSSASGNPEEI  60

Query  277  AKLFPGLFGQPSAALVPDDSGDVAM-NHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCK  453
             KLFP LFGQPSA LV  D    +M N +LKIGVVLSGGQAPGGHNVISGIFDYLQE   
Sbjct  61   KKLFPKLFGQPSARLVECDPKACSMENKSLKIGVVLSGGQAPGGHNVISGIFDYLQERTN  120

Query  454  GSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAK  633
            GS LYGF+GGPAGIMKCKYV L+ EYIYPYRNQGGFDMICSGRDKIETP+QFKQAEETAK
Sbjct  121  GSKLYGFKGGPAGIMKCKYVELSTEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAK  180

Query  634  KLDLDGLV  657
            KLDLDGLV
Sbjct  181  KLDLDGLV  188



>ref|XP_009365098.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Pyrus x bretschneideri]
Length=556

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  121  SAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLF  300
            + K   GR+ S YSEVQ SRLD PLPLPSVL+ SF VVDGP SSAAG+PEEIAKLFP LF
Sbjct  5    NGKAVPGRFVSSYSEVQASRLDVPLPLPSVLKSSFSVVDGPKSSAAGNPEEIAKLFPNLF  64

Query  301  GQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRG  480
            GQPSA L P  S  ++ + +LKIGVVLSGGQAPGGHNVI GIFDYLQ+H  GS +YGF+G
Sbjct  65   GQPSAMLRPGGSSVLSKDTSLKIGVVLSGGQAPGGHNVICGIFDYLQKHTSGSIMYGFKG  124

Query  481  GPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            GPAGIMKCKYV L+ E+IYPYRNQGGFDMI SGRDKIETP+QFK AEET KK DLDGLV
Sbjct  125  GPAGIMKCKYVQLSAEFIYPYRNQGGFDMIASGRDKIETPEQFKLAEETVKKFDLDGLV  183



>ref|XP_010422247.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like isoform X1 [Camelina sativa]
Length=594

 Score =   278 bits (710),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +1

Query  115  IASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPG  294
            I++   +  R +SVYSEVQ SR+DH LPLPSV +  FK++DGP SS+AGHPEEI KLFP 
Sbjct  16   ISNNPRAASRVSSVYSEVQASRIDHALPLPSVFKNPFKIIDGPPSSSAGHPEEIEKLFPN  75

Query  295  LFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGF  474
            LFGQPSA LV + S  V  +  LKIGVVLSGGQAPGGHNVI GIFDYLQE+ KGS+L+GF
Sbjct  76   LFGQPSALLVLNQSDAVKSDQKLKIGVVLSGGQAPGGHNVICGIFDYLQEYVKGSSLFGF  135

Query  475  RGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGL  654
            RGGPAGIMK KY+ LT E++YPYRNQGGFDMICSGRDKIETP+QF+QAEET  K+DLDGL
Sbjct  136  RGGPAGIMKGKYIELTSEFVYPYRNQGGFDMICSGRDKIETPEQFQQAEETVTKMDLDGL  195

Query  655  V  657
            V
Sbjct  196  V  196



>ref|XP_006656840.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Oryza brachyantha]
Length=565

 Score =   276 bits (707),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 154/192 (80%), Gaps = 2/192 (1%)
 Frame = +1

Query  82   APAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAG  261
            A A++    +  AS   + GR ASVYSEVQ SRL H LPLPSVLR  F + DGPASSAAG
Sbjct  3    AAAVTTNGGAAQASNAPAPGRLASVYSEVQTSRLKHALPLPSVLRSPFALADGPASSAAG  62

Query  262  HPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQ  441
            +P EIAKLFP LFGQPS +LVP  S + A    LK+GVVLSGGQAPGGHNVI GIFDYLQ
Sbjct  63   NPGEIAKLFPNLFGQPSVSLVP--SPEPASTRPLKVGVVLSGGQAPGGHNVICGIFDYLQ  120

Query  442  EHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAE  621
            E  KGS +YGF+GGPAG+MKCKYV LT +Y+YPYRNQGGFDMICSGRDKIETP+QFKQAE
Sbjct  121  ERAKGSIMYGFKGGPAGVMKCKYVELTADYVYPYRNQGGFDMICSGRDKIETPEQFKQAE  180

Query  622  ETAKKLDLDGLV  657
            +T  KLDLDGLV
Sbjct  181  DTVNKLDLDGLV  192



>ref|XP_009788354.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like isoform X2 [Nicotiana sylvestris]
Length=516

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +1

Query  139  GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAA  318
            GR  S YSEVQ++RL   LPLPSVL+  F VVDGP SSAAG+P EIAKLFP LFGQPS +
Sbjct  12   GRSTSAYSEVQSNRLTVSLPLPSVLKNPFSVVDGPPSSAAGNPGEIAKLFPNLFGQPSVS  71

Query  319  LVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIM  498
            L+P  +    +NHNLKIGVVLSGGQAPGGHNVISGIFDYLQE  KGSTLYGFRGGPAGIM
Sbjct  72   LLPGHTSGATLNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEKTKGSTLYGFRGGPAGIM  131

Query  499  KCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
             CKYV LT +++YPYRNQGGFDMI SGRDKIET +QFKQA ETAKKLDLDG+V
Sbjct  132  NCKYVELTADFVYPYRNQGGFDMIASGRDKIETDEQFKQAAETAKKLDLDGIV  184



>ref|XP_006396720.1| hypothetical protein EUTSA_v10028543mg [Eutrema salsugineum]
 gb|ESQ38173.1| hypothetical protein EUTSA_v10028543mg [Eutrema salsugineum]
Length=480

 Score =   274 bits (700),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 155/193 (80%), Gaps = 5/193 (3%)
 Frame = +1

Query  94   SLLANSDIASAKT---STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGH  264
            S L   DIA       +TGR ASVYSEVQ SR+DH LPLPSV +  FK+VDGP SSAAG+
Sbjct  5    SDLTGDDIARISINPPATGRVASVYSEVQASRIDHSLPLPSVFKIPFKIVDGPPSSAAGN  64

Query  265  PEEIAKLFPGLFGQPSAALVPD--DSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
             EEIAKLFP LFGQPSA LVPD  +S   +    LKIGVVLSGGQAPGGHNVI GIFDYL
Sbjct  65   SEEIAKLFPNLFGQPSALLVPDQTNSAISSDKKKLKIGVVLSGGQAPGGHNVICGIFDYL  124

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            +EH KGS+L+GFRGGPAGIMK K V LT +++YPYRNQGGFDMICSGRDKIETP+QF+QA
Sbjct  125  EEHAKGSSLFGFRGGPAGIMKGKLVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFQQA  184

Query  619  EETAKKLDLDGLV  657
            EET  K+DLDGLV
Sbjct  185  EETVTKMDLDGLV  197



>ref|XP_010252536.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Nelumbo nucifera]
Length=570

 Score =   276 bits (706),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 160/197 (81%), Gaps = 4/197 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTST----GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPA  246
            M+ +  ++ NSD  + K +     GR+ SVYSE+Q +RL+  LPLPSVL+  FK+V+GP 
Sbjct  1    MSSSAPVMLNSDGTTGKAAQAANPGRFISVYSELQTNRLNQCLPLPSVLKNPFKIVEGPP  60

Query  247  SSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGI  426
            SS++G+P+EIAKLFP LFGQPS+ LVP +   +A +  LKIGVVLSGGQAPGGHNVI GI
Sbjct  61   SSSSGNPDEIAKLFPNLFGQPSSTLVPSEKETLASDQKLKIGVVLSGGQAPGGHNVICGI  120

Query  427  FDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ  606
            FDYLQ+  KGSTLYGF+GGPAGIM+CKYV LT +YI+PYRNQGGFDMI SGRDKIETP+Q
Sbjct  121  FDYLQDRAKGSTLYGFKGGPAGIMRCKYVELTADYIFPYRNQGGFDMIRSGRDKIETPEQ  180

Query  607  FKQAEETAKKLDLDGLV  657
            FKQ EETA KLDLDGLV
Sbjct  181  FKQTEETAMKLDLDGLV  197



>ref|XP_010089437.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Morus notabilis]
 gb|EXB37810.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Morus notabilis]
Length=556

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = +1

Query  139  GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAA  318
            GR  S YSEVQ+SRLD  LPLP VLR  F +VDGP SSAAG+PEEIAKLFP LFGQPSA 
Sbjct  11   GRSLSEYSEVQSSRLDVHLPLPCVLRNPFNLVDGPPSSAAGNPEEIAKLFPNLFGQPSAM  70

Query  319  LVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIM  498
            L    +   A + +L IGVVLSGGQAPGGHNVISGIFDYLQ+  KGSTLYGF+GGPAGIM
Sbjct  71   LKSATTSGAAADQSLIIGVVLSGGQAPGGHNVISGIFDYLQQRTKGSTLYGFKGGPAGIM  130

Query  499  KCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            KCKY+ L+ E++YPYRNQGGFDMICSGRDKIETP+QFKQAEETAKKLDLDGLV
Sbjct  131  KCKYIELSEEFVYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLV  183



>ref|XP_009620787.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like [Nicotiana 
tomentosiformis]
Length=557

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = +1

Query  139  GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAA  318
            GR  S YSEVQ++RL   LPLPSVL+  F VVDGP SSAAG+P EIAKLFP LFGQPS +
Sbjct  12   GRSTSAYSEVQSNRLIVSLPLPSVLKNPFSVVDGPPSSAAGNPGEIAKLFPNLFGQPSVS  71

Query  319  LVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIM  498
            L+P  +   A+NHNLKIGVVLSGGQAPGGHNVISGIFDYLQE  KGSTLYGFRGGPAGIM
Sbjct  72   LLPGHTSGAALNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEKTKGSTLYGFRGGPAGIM  131

Query  499  KCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
             CKYV LT +++YPYRNQGGFDMI SGRDKIET +QFKQA ETAKKLDLDG+V
Sbjct  132  NCKYVELTADFVYPYRNQGGFDMIASGRDKIETDEQFKQAAETAKKLDLDGIV  184



>ref|XP_003594152.1| Pyrophosphate-fructose 6-phosphate 1-phosphotransferase subunit 
beta [Medicago truncatula]
 gb|ABD32662.1| Pyrophosphate-dependent phosphofructokinase PfpB [Medicago truncatula]
 gb|AES64403.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Medicago 
truncatula]
Length=565

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 157/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAA  258
            MAPA +++ N       T T R+ASVYSEVQNSR+DH L LPSVL+  F +VDGP SSAA
Sbjct  1    MAPA-AIVTNGTTTVTPTVTTRFASVYSEVQNSRVDHKLRLPSVLQAPFAIVDGPKSSAA  59

Query  259  GHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
            G+P+EIAKLFP LFGQPSAALVP        +  LKIGVVLSGGQAPGGHNVISGI+DYL
Sbjct  60   GNPDEIAKLFPYLFGQPSAALVPAGENTALPHRKLKIGVVLSGGQAPGGHNVISGIYDYL  119

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            Q+   GSTLYGF+GGPAGIMK KYV L  +YIYPYRNQGGFDMICSGRDKIETP+QFKQA
Sbjct  120  QQSASGSTLYGFKGGPAGIMKGKYVELNSDYIYPYRNQGGFDMICSGRDKIETPEQFKQA  179

Query  619  EETAKKLDLDGLV  657
            EETA KLDLDGLV
Sbjct  180  EETATKLDLDGLV  192



>ref|XP_009788347.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like isoform X1 [Nicotiana sylvestris]
Length=557

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +1

Query  139  GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAA  318
            GR  S YSEVQ++RL   LPLPSVL+  F VVDGP SSAAG+P EIAKLFP LFGQPS +
Sbjct  12   GRSTSAYSEVQSNRLTVSLPLPSVLKNPFSVVDGPPSSAAGNPGEIAKLFPNLFGQPSVS  71

Query  319  LVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIM  498
            L+P  +    +NHNLKIGVVLSGGQAPGGHNVISGIFDYLQE  KGSTLYGFRGGPAGIM
Sbjct  72   LLPGHTSGATLNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEKTKGSTLYGFRGGPAGIM  131

Query  499  KCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
             CKYV LT +++YPYRNQGGFDMI SGRDKIET +QFKQA ETAKKLDLDG+V
Sbjct  132  NCKYVELTADFVYPYRNQGGFDMIASGRDKIETDEQFKQAAETAKKLDLDGIV  184



>ref|XP_006396719.1| hypothetical protein EUTSA_v10028543mg [Eutrema salsugineum]
 gb|ESQ38172.1| hypothetical protein EUTSA_v10028543mg [Eutrema salsugineum]
Length=570

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 155/193 (80%), Gaps = 5/193 (3%)
 Frame = +1

Query  94   SLLANSDIASAKT---STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGH  264
            S L   DIA       +TGR ASVYSEVQ SR+DH LPLPSV +  FK+VDGP SSAAG+
Sbjct  5    SDLTGDDIARISINPPATGRVASVYSEVQASRIDHSLPLPSVFKIPFKIVDGPPSSAAGN  64

Query  265  PEEIAKLFPGLFGQPSAALVPD--DSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYL  438
             EEIAKLFP LFGQPSA LVPD  +S   +    LKIGVVLSGGQAPGGHNVI GIFDYL
Sbjct  65   SEEIAKLFPNLFGQPSALLVPDQTNSAISSDKKKLKIGVVLSGGQAPGGHNVICGIFDYL  124

Query  439  QEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQA  618
            +EH KGS+L+GFRGGPAGIMK K V LT +++YPYRNQGGFDMICSGRDKIETP+QF+QA
Sbjct  125  EEHAKGSSLFGFRGGPAGIMKGKLVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFQQA  184

Query  619  EETAKKLDLDGLV  657
            EET  K+DLDGLV
Sbjct  185  EETVTKMDLDGLV  197



>ref|XP_008230005.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Prunus mume]
Length=600

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 158/196 (81%), Gaps = 2/196 (1%)
 Frame = +1

Query  76   SMAPAISLLA--NSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPAS  249
            S+  ++SL A  +S   + K   GR  S YSEVQ SRLD  LPLPSVL+ SF VVDGP S
Sbjct  32   SLRVSLSLKAIMSSSSVNLKAVPGRLTSSYSEVQASRLDVSLPLPSVLKSSFSVVDGPKS  91

Query  250  SAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF  429
            SAAG+PEEIAKLFP LFGQPSA L P  S  ++ + +LKIGVVLSGGQAPGGHNVISGIF
Sbjct  92   SAAGNPEEIAKLFPNLFGQPSAVLNPGGSSVLSKDISLKIGVVLSGGQAPGGHNVISGIF  151

Query  430  DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQF  609
            DYLQ H  GST+YGF+GGPAGIMK KYV L+ E++YPYRNQGGFDMI SGRDKIETP+QF
Sbjct  152  DYLQHHTSGSTVYGFKGGPAGIMKGKYVELSAEFVYPYRNQGGFDMIASGRDKIETPEQF  211

Query  610  KQAEETAKKLDLDGLV  657
            KQAEETAK LDLDGLV
Sbjct  212  KQAEETAKTLDLDGLV  227



>gb|AAC28214.1| contains similarity to phosphofructokinases (Pfam; PFK.hmm, score; 
36.60) [Arabidopsis thaliana]
 emb|CAB77872.1| putative phosphofructokinase beta subunit [Arabidopsis thaliana]
Length=583

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 157/212 (74%), Gaps = 19/212 (9%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKT---STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPAS  249
            MA  + L+    IA       +  R  SVYSEVQ SR+DH LPLPSV +  FK++DGP S
Sbjct  1    MASQLDLIGGDYIAGISINPPTNSRVTSVYSEVQASRIDHTLPLPSVFKTPFKIIDGPPS  60

Query  250  SAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF  429
            S+AGHPEEI KLFP LFGQPSA LVP+ S +V+ +  LKIGVVLSGGQAPGGHNVI GIF
Sbjct  61   SSAGHPEEIEKLFPNLFGQPSALLVPNQSNEVSSDQKLKIGVVLSGGQAPGGHNVICGIF  120

Query  430  ----------------DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGF  561
                            DYLQE+ +GS+L+GFRGGPAGIMK KY+ LT E++YPYRNQGGF
Sbjct  121  GFKNLICDCIFVVGLIDYLQEYARGSSLFGFRGGPAGIMKGKYIELTSEFVYPYRNQGGF  180

Query  562  DMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            DMICSGRDKIETP+QFKQAEET  K+DLDGLV
Sbjct  181  DMICSGRDKIETPEQFKQAEETVTKMDLDGLV  212



>gb|KFK30957.1| hypothetical protein AALP_AA6G049400 [Arabis alpina]
Length=557

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = +1

Query  136  TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSA  315
            + R  SVYSEVQ SR+DH LPLPSVL+  FK++DGP SS+AG+ EEIAKLFP L+GQPSA
Sbjct  11   SNRVTSVYSEVQASRIDHSLPLPSVLKNPFKIIDGPPSSSAGNSEEIAKLFPNLYGQPSA  70

Query  316  ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI  495
             LVPD S  V +   LKIGVVLSGGQAPGGHNVI GIFDYLQE  KGS+L+GFRGGPAGI
Sbjct  71   LLVPDQSNVVPLQQKLKIGVVLSGGQAPGGHNVICGIFDYLQEFAKGSSLFGFRGGPAGI  130

Query  496  MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            MK KYV LT ++++PYRNQGGFDMICSGRDKIETP+QF+QAEET   +DLDGLV
Sbjct  131  MKGKYVELTSDFVHPYRNQGGFDMICSGRDKIETPEQFQQAEETVTTMDLDGLV  184



>ref|NP_001057284.1| Os06g0247500 [Oryza sativa Japonica Group]
 dbj|BAD45669.1| putative pyrophosphate-dependent phosphofructokinase beta subunit 
[Oryza sativa Japonica Group]
 dbj|BAF19198.1| Os06g0247500 [Oryza sativa Japonica Group]
 gb|EAZ00352.1| hypothetical protein OsI_22368 [Oryza sativa Indica Group]
 gb|EAZ36477.1| hypothetical protein OsJ_20808 [Oryza sativa Japonica Group]
Length=567

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 146/172 (85%), Gaps = 2/172 (1%)
 Frame = +1

Query  142  RYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAAL  321
            R ASVYSEVQ SRL H LPLPSVLR  F + DGPASSAAG+P EIAKLFP LFGQPS +L
Sbjct  25   RLASVYSEVQTSRLKHALPLPSVLRSPFALADGPASSAAGNPGEIAKLFPNLFGQPSVSL  84

Query  322  VPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMK  501
            VP  S + A    LK+GVVLSGGQAPGGHNVI GIFDYLQE+ KGS +YGF+GGPAG+MK
Sbjct  85   VP--SPEPASTRPLKVGVVLSGGQAPGGHNVICGIFDYLQEYAKGSVMYGFKGGPAGVMK  142

Query  502  CKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            CKYV LT +Y+YPYRNQGGFDMICSGRDKIETP+QFKQAE+T  KLDLDGLV
Sbjct  143  CKYVELTADYVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTVNKLDLDGLV  194



>gb|ABK26333.1| unknown [Picea sitchensis]
Length=317

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 152/188 (81%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   LLANSDIASAKTST-GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEE  273
             ++N D+++ K +   R  SVYSEVQ+SRLDH LPLPSVL   FK+V GP ++AAG PE+
Sbjct  4    FVSNGDVSAHKQAALTRDISVYSEVQSSRLDHQLPLPSVLEAPFKLVSGPPTTAAGSPED  63

Query  274  IAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCK  453
            IAKLFP L+GQPS  LVP D+  +  +  L IGVVLSGGQAPGGHNVI+G+FDY+Q + K
Sbjct  64   IAKLFPQLYGQPSVHLVPSDTAALKSDRKLNIGVVLSGGQAPGGHNVIAGLFDYVQNNTK  123

Query  454  GSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAK  633
             S L+GF GGPAGIMKCKYV +T E++YPYRNQGGFD+ICSGRDKIETP+QF+QAEET  
Sbjct  124  DSRLFGFNGGPAGIMKCKYVEMTKEFVYPYRNQGGFDIICSGRDKIETPEQFRQAEETVL  183

Query  634  KLDLDGLV  657
            KLDLDGLV
Sbjct  184  KLDLDGLV  191



>ref|XP_007215516.1| hypothetical protein PRUPE_ppa003662mg [Prunus persica]
 gb|EMJ16715.1| hypothetical protein PRUPE_ppa003662mg [Prunus persica]
Length=558

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  106  NSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKL  285
            +S   + K   GR  S YSEVQ SRLD  LPLPSVL+ SF VVDGP SSAAG+PEEIAKL
Sbjct  2    SSSSVNLKAVPGRLTSSYSEVQASRLDVSLPLPSVLKSSFSVVDGPKSSAAGNPEEIAKL  61

Query  286  FPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTL  465
            FP LFGQPSA L P  S  ++ + +LKIGVVLSGGQAPGGHNVISGIFDYLQ    GST+
Sbjct  62   FPNLFGQPSAVLNPGGSSVLSKDTSLKIGVVLSGGQAPGGHNVISGIFDYLQHRTSGSTV  121

Query  466  YGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDL  645
            YGF+GGPAGIMK KYV L+ E++YPYRNQGGFDMI SGRDKIETP+QFKQAEETAK LDL
Sbjct  122  YGFKGGPAGIMKGKYVELSAEFVYPYRNQGGFDMIASGRDKIETPEQFKQAEETAKTLDL  181

Query  646  DGLV  657
            DGLV
Sbjct  182  DGLV  185



>gb|AAC17614.1| Similar to pyrophosphate-dependent phosphofuctokinase beta subunit 
gb|Z32850 from Ricinus communis. ESTs gb|N65773, gb|N64925 
and gb|F15232 come from this gene [Arabidopsis thaliana]
Length=574

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 165/203 (81%), Gaps = 11/203 (5%)
 Frame = +1

Query  79   MAPAISLLAN-SDIASAKTSTGR-YASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            MAPA+++  + + + S + +  +  ASVYSEVQ+SR+++ LPLPSVL+ +FK+V+GPASS
Sbjct  1    MAPALAVTRDLTAVGSPENAPAKGRASVYSEVQSSRINNTLPLPSVLKGAFKIVEGPASS  60

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF-  429
            AAG+P+EIAKLFPGL+GQPS A+VPD     +    LKIGVVLSGGQAPGGHNVISG+F 
Sbjct  61   AAGNPDEIAKLFPGLYGQPSVAVVPDQDAPSSA-PKLKIGVVLSGGQAPGGHNVISGLFG  119

Query  430  -DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ  606
             DYLQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETPDQ
Sbjct  120  KDYLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIQPYRNQGGFDMICSGRDKIETPDQ  179

Query  607  ------FKQAEETAKKLDLDGLV  657
                  FKQAEETAKKLDLDGLV
Sbjct  180  VEYFFVFKQAEETAKKLDLDGLV  202



>ref|XP_009114586.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2 [Brassica rapa]
Length=568

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = +1

Query  142  RYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAAL  321
            R  SVYSEVQ SR+DH LPLPSV +  FK+VDGP SSAAG+ EEIAKLFP L+GQPSA L
Sbjct  23   RVPSVYSEVQVSRIDHALPLPSVFKSPFKIVDGPPSSAAGNSEEIAKLFPNLYGQPSALL  82

Query  322  VPDDSGDVAM-NHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIM  498
            V D S D  + +  LK+GVVLSGGQAPGGHNVI GIFDYLQE+ KGSTL+GFRGGPAGIM
Sbjct  83   VSDQSNDAVLSDQKLKVGVVLSGGQAPGGHNVICGIFDYLQEYAKGSTLFGFRGGPAGIM  142

Query  499  KCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            K KYV LT +++YPYRNQGGFDMICSGRDKIETP+QFKQAE+T  K++LDGLV
Sbjct  143  KGKYVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTVTKMELDGLV  195



>ref|XP_003564006.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Brachypodium distachyon]
Length=562

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = +1

Query  88   AISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP  267
            A + +A++  A+   + GR ASVYSEVQ SRL H LPLPSVLR  F + DGPASSAAG+P
Sbjct  2    AAAAVASNGGAANAPAPGRLASVYSEVQTSRLTHMLPLPSVLRSHFTLADGPASSAAGNP  61

Query  268  EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            +EIAKLFP L+GQPSA++VP  S +      LKIGVVLSGGQAPGGHNVI GIFDYLQE 
Sbjct  62   DEIAKLFPNLYGQPSASVVP--SAEPVPAKPLKIGVVLSGGQAPGGHNVICGIFDYLQER  119

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
             KGST+YGF+GGPAG+MK KYV LT +++YPYRNQGGFDMICSGRDKIETP+QFKQAE+T
Sbjct  120  VKGSTMYGFKGGPAGVMKGKYVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDT  179

Query  628  AKKLDLDGLV  657
              +LDLDGLV
Sbjct  180  VNRLDLDGLV  189



>ref|XP_004243522.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Solanum lycopersicum]
Length=554

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +1

Query  115  IASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPG  294
            +A+A    GR  S YSEVQ++RL   LPLPSVL+K F V+DGP SSAAG+P EIAKLFP 
Sbjct  1    MAAAAVGPGRSTSSYSEVQHNRLIVSLPLPSVLKKPFSVIDGPPSSAAGNPGEIAKLFPN  60

Query  295  LFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGF  474
            LFGQPS +L+P  +   A++H LK+GVVLSGGQAPGGHNVISGIFDYLQE  K STLYGF
Sbjct  61   LFGQPSVSLLPGHTSGAALDHTLKVGVVLSGGQAPGGHNVISGIFDYLQEKTKNSTLYGF  120

Query  475  RGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGL  654
            +GGPAGIM CKYV LT +++YPYRNQGGFDMICSGRDKIE+ +QF QA ETAKKL+LDG+
Sbjct  121  KGGPAGIMNCKYVELTADFVYPYRNQGGFDMICSGRDKIESDEQFNQAAETAKKLNLDGI  180

Query  655  V  657
            V
Sbjct  181  V  181



>gb|KDO54287.1| hypothetical protein CISIN_1g008310mg [Citrus sinensis]
Length=570

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 150/185 (81%), Gaps = 2/185 (1%)
 Frame = +1

Query  109  SDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLF  288
            S I     + GR AS+Y+E+Q SR++  LPLPSVL+ +F VVD  ASSAAG PEEI KLF
Sbjct  5    SSIVKRDEAAGRVASIYTELQISRMNVSLPLPSVLKNTFNVVDDAASSAAGDPEEIKKLF  64

Query  289  PGLFGQPSAALVPDD--SGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGST  462
            P  +GQPSA LV  D  +  +  N +LKIGVVLSGGQAPGGHNVI+GIFDYLQE  KGS 
Sbjct  65   PKFYGQPSARLVECDPMACTLMENKSLKIGVVLSGGQAPGGHNVIAGIFDYLQERTKGSK  124

Query  463  LYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLD  642
            LYGFRGGPAGIMKCK+V L+ E+IYPYRNQGGFDM+CSGRDKIETP+QFKQAEET KKLD
Sbjct  125  LYGFRGGPAGIMKCKFVELSSEFIYPYRNQGGFDMLCSGRDKIETPEQFKQAEETVKKLD  184

Query  643  LDGLV  657
            LDGLV
Sbjct  185  LDGLV  189



>ref|XP_007049157.1| Phosphofructokinase family protein [Theobroma cacao]
 gb|EOX93314.1| Phosphofructokinase family protein [Theobroma cacao]
Length=566

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 159/195 (82%), Gaps = 6/195 (3%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTG--RYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            M+PA+   A +  A  +   G  R   VYSE+Q++RL+H  PLPS+L+ SFKVVDGP +S
Sbjct  1    MSPAV---ATNGFADTQKEEGPSRLPPVYSELQSNRLNHSPPLPSILKSSFKVVDGPPTS  57

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P EIA LFP L+G+PS +LVP DS ++  + +LKIGVVLSGGQAPGGHNVI+GIFD
Sbjct  58   AAGNPNEIANLFPNLYGKPSVSLVPGDS-EMKGHQSLKIGVVLSGGQAPGGHNVITGIFD  116

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQE  KGSTLYGF+GGPAGI++CKYV L+ E IYPYRNQGGFDMICSGRDKIETP+Q K
Sbjct  117  YLQERAKGSTLYGFKGGPAGIVRCKYVKLSTELIYPYRNQGGFDMICSGRDKIETPEQLK  176

Query  613  QAEETAKKLDLDGLV  657
            QAEET KKLDLDGLV
Sbjct  177  QAEETVKKLDLDGLV  191



>gb|KJB69226.1| hypothetical protein B456_011G011600 [Gossypium raimondii]
Length=557

 Score =   268 bits (686),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 154/190 (81%), Gaps = 11/190 (6%)
 Frame = +1

Query  94   SLLANSDIASAKTS--TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP  267
            SL  N + A+ +T   +GR+A+VYSEVQNSR+DH LPLPSVLR  FKVV+GP SSAAG+P
Sbjct  4    SLNTNGNAAAFETGPVSGRFAAVYSEVQNSRIDHALPLPSVLRNPFKVVEGPPSSAAGNP  63

Query  268  EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            +EIAKLFP LFGQPSA LVP+++  +  +  LKIGVVLSGGQAPG         DYLQ+ 
Sbjct  64   DEIAKLFPNLFGQPSAMLVPNEADSLRSDLKLKIGVVLSGGQAPG---------DYLQDR  114

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
             KGS LYGFRGGPAGIMKCKY+ L  +YIYPYRNQGGFDMICSGRDKIETP+QFKQAEET
Sbjct  115  AKGSILYGFRGGPAGIMKCKYIELNADYIYPYRNQGGFDMICSGRDKIETPEQFKQAEET  174

Query  628  AKKLDLDGLV  657
            A KLDLDGLV
Sbjct  175  AVKLDLDGLV  184



>ref|XP_006447633.1| hypothetical protein CICLE_v10014750mg [Citrus clementina]
 ref|XP_006469626.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Citrus sinensis]
 gb|ESR60873.1| hypothetical protein CICLE_v10014750mg [Citrus clementina]
Length=570

 Score =   268 bits (686),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 149/185 (81%), Gaps = 2/185 (1%)
 Frame = +1

Query  109  SDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLF  288
            S I     + GR AS+Y+E+Q SR++  LPLPSVL+ +F VVD  ASSAAG PEEI KLF
Sbjct  5    SSIVKRDEAAGRVASIYTELQISRMNVSLPLPSVLKNTFNVVDDAASSAAGDPEEIKKLF  64

Query  289  PGLFGQPSAALVPDD--SGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGST  462
            P  +GQPSA LV  D  +  +  N +LKIGVVLSGGQAPGGHNVISGIFDYLQE  KGS 
Sbjct  65   PKFYGQPSARLVECDPMACTLMENKSLKIGVVLSGGQAPGGHNVISGIFDYLQERTKGSK  124

Query  463  LYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLD  642
            LYGFRGGPAGIM CK+V L+ E+IYPYRNQGGFDM+CSGRDKIETP+QFKQAEET KKLD
Sbjct  125  LYGFRGGPAGIMNCKFVELSSEFIYPYRNQGGFDMLCSGRDKIETPEQFKQAEETVKKLD  184

Query  643  LDGLV  657
            LDGLV
Sbjct  185  LDGLV  189



>ref|XP_006357957.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Solanum tuberosum]
Length=554

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = +1

Query  115  IASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPG  294
            +A+     GR  S YSEVQ++RL   LPLPSVL+K F V+DGP SSAAG+P EIAKLFP 
Sbjct  1    MAATAVGPGRSTSSYSEVQHNRLIVSLPLPSVLKKPFSVIDGPPSSAAGNPGEIAKLFPN  60

Query  295  LFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGF  474
            LFGQPS +L+P  +   A++  LKIGVVLSGGQAPGGHNVISGIFDYLQE  K STLYGF
Sbjct  61   LFGQPSVSLLPGHTSGAALDRTLKIGVVLSGGQAPGGHNVISGIFDYLQEKTKNSTLYGF  120

Query  475  RGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGL  654
            +GGPAGIM CKYV LT +++YPYRNQGGFDMICSGRDKIE+ +QF QA ETAKKLDLDG+
Sbjct  121  KGGPAGIMNCKYVELTTDFVYPYRNQGGFDMICSGRDKIESDEQFNQAAETAKKLDLDGI  180

Query  655  V  657
            V
Sbjct  181  V  181



>emb|CDX94541.1| BnaC09g22950D [Brassica napus]
Length=634

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 150/189 (79%), Gaps = 3/189 (2%)
 Frame = +1

Query  100  LANSDIA--SAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEE  273
            L   DIA  S      R  SVYSEVQ SR+DH LPLPSV +  F +VDG  SSAAG+ EE
Sbjct  7    LTGEDIAGISINPPASRVPSVYSEVQVSRIDHALPLPSVFKSPFTIVDGAPSSAAGNSEE  66

Query  274  IAKLFPGLFGQPSAALVPDDSGDVAM-NHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHC  450
            IAKLFP L+GQPSA LV D S D  + +  LK+GVVLSGGQAPGGHNVI GIFDYLQEH 
Sbjct  67   IAKLFPNLYGQPSALLVSDQSNDAVLSDQKLKVGVVLSGGQAPGGHNVICGIFDYLQEHA  126

Query  451  KGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETA  630
            KGST++GFRGGPAGIMK KYV +T +++YPYRNQGGFDMICSGRDKIETP+QFKQAE+T 
Sbjct  127  KGSTMFGFRGGPAGIMKGKYVEVTSDFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTV  186

Query  631  KKLDLDGLV  657
             K+DLDGLV
Sbjct  187  TKMDLDGLV  195



>ref|XP_002271059.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Vitis vinifera]
 emb|CBI28853.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = +1

Query  94   SLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEE  273
            S  +N    + + S+G  +SV+SEVQ SRL H LPLPSVLRK F V DGP SSAAG+P+E
Sbjct  5    SAASNGCATAGRPSSGCPSSVFSEVQTSRLRHSLPLPSVLRKPFNVSDGPPSSAAGNPDE  64

Query  274  IAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCK  453
            IAKLFP LFGQPSA LVP +   +  +  L+IGVVLSGGQAPGGHNVISGIFDYLQE   
Sbjct  65   IAKLFPNLFGQPSATLVPGEG--LKKDQGLRIGVVLSGGQAPGGHNVISGIFDYLQECTT  122

Query  454  GSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAK  633
            GST+YGF+GGPAGIM CKYV LT E+I P+RNQGGF MICSGRDKIETP+QFKQA+ETA 
Sbjct  123  GSTMYGFKGGPAGIMNCKYVELTSEFILPFRNQGGFHMICSGRDKIETPEQFKQADETAS  182

Query  634  KLDLDGLV  657
            KL+LDGLV
Sbjct  183  KLELDGLV  190



>ref|XP_004305986.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Fragaria vesca subsp. vesca]
Length=557

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = +1

Query  106  NSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKL  285
            +S  A+AK   GR ASVYSEVQ SRLD  LPLPSVL+  F VVDGP SSA G+P+EIAKL
Sbjct  2    SSSTATAKAVPGRCASVYSEVQTSRLDVLLPLPSVLKGPFSVVDGPKSSATGNPDEIAKL  61

Query  286  FPGLFGQPSAAL-VPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGST  462
            FP LFGQPSA+L   D S  ++ + +LKIGVVLSGGQAPGGHNVISGIFDYLQ+   GS 
Sbjct  62   FPNLFGQPSASLKAGDASSALSKDKSLKIGVVLSGGQAPGGHNVISGIFDYLQQRTTGSI  121

Query  463  LYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLD  642
            +YGFRGGPAG+MK KYV L+ EY+YPYRNQGGFDMI SGRDKIETP+QF+QA +TA KLD
Sbjct  122  MYGFRGGPAGVMKGKYVELSTEYVYPYRNQGGFDMIASGRDKIETPEQFQQAADTASKLD  181

Query  643  LDGLV  657
            LDGLV
Sbjct  182  LDGLV  186



>dbj|BAJ85690.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85834.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 147/173 (85%), Gaps = 2/173 (1%)
 Frame = +1

Query  139  GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAA  318
            GR ASVYSEVQ SR+ H LPLPSVLR  F + DGPAS+AAG P+EIAKLFP L+GQPSA+
Sbjct  17   GRLASVYSEVQTSRIAHMLPLPSVLRSHFTLADGPASTAAGSPDEIAKLFPCLYGQPSAS  76

Query  319  LVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIM  498
            +VP  + +   +  LKIGVVLSGGQAPGGHNVI GIFDYLQE  KGST+YGF+GGPAG+M
Sbjct  77   VVP--TAEPVASKPLKIGVVLSGGQAPGGHNVICGIFDYLQERAKGSTMYGFKGGPAGVM  134

Query  499  KCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            K KYV LT +++YPYRNQGGFDMICSGRDKIETP+QFKQAE+T  +LDLDGLV
Sbjct  135  KGKYVELTADFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTVNRLDLDGLV  187



>dbj|BAK07581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 147/173 (85%), Gaps = 2/173 (1%)
 Frame = +1

Query  139  GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAA  318
            GR ASVYSEVQ SR+ H LPLPSVLR  F + DGPAS+AAG P+EIAKLFP L+GQPSA+
Sbjct  17   GRLASVYSEVQTSRIAHMLPLPSVLRSHFTLADGPASTAAGCPDEIAKLFPCLYGQPSAS  76

Query  319  LVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIM  498
            +VP  + +   +  LKIGVVLSGGQAPGGHNVI GIFDYLQE  KGST+YGF+GGPAG+M
Sbjct  77   VVP--TAEPVASKPLKIGVVLSGGQAPGGHNVICGIFDYLQERAKGSTMYGFKGGPAGVM  134

Query  499  KCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            K KYV LT +++YPYRNQGGFDMICSGRDKIETP+QFKQAE+T  +LDLDGLV
Sbjct  135  KGKYVELTADFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTVNRLDLDGLV  187



>ref|XP_004955203.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Setaria italica]
Length=553

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 145/175 (83%), Gaps = 2/175 (1%)
 Frame = +1

Query  133  STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPS  312
            S GR ASVYSEVQ SRL H L LPSVL   F +VDGP SSA G+P+EIAKLFP LFGQPS
Sbjct  8    SPGRLASVYSEVQTSRLHHALQLPSVLCSQFTLVDGPPSSATGNPDEIAKLFPNLFGQPS  67

Query  313  AALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAG  492
            AALVP  + +      LK+GVVLSGGQAPGGHNVI GIFD+LQ+  KGST+YGF+GGPAG
Sbjct  68   AALVP--AKEAVEGKPLKVGVVLSGGQAPGGHNVICGIFDFLQQRAKGSTMYGFKGGPAG  125

Query  493  IMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            +M CKYV L  +++YPYRNQGGFDMICSGRDKIETP+QFKQAE+TA KL+LDGLV
Sbjct  126  VMNCKYVELNTDFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTANKLELDGLV  180



>gb|KHN03504.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Glycine soja]
Length=439

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 151/198 (76%), Gaps = 25/198 (13%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTS----TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPA  246
            MAP+ ++  N+   SA+ +    TGR+A+VYSEVQNSR+DH LPLPSVL+  F +VDGP 
Sbjct  1    MAPSFAI--NAAFPSARVTPPSVTGRFAAVYSEVQNSRIDHALPLPSVLKNPFIIVDGPQ  58

Query  247  SSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGI  426
            SSAAG+PEEIAKLFP LFGQPSAALVP DS  + +N  LKIGVVLSGGQAPGGHNVISGI
Sbjct  59   SSAAGNPEEIAKLFPNLFGQPSAALVPSDSHALPVNQKLKIGVVLSGGQAPGGHNVISGI  118

Query  427  FD-YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPD  603
            FD YLQ+  +GSTLYGFRGGPAGIMKCKYV LT +YIYPYRN                  
Sbjct  119  FDNYLQDLAEGSTLYGFRGGPAGIMKCKYVELTSDYIYPYRN------------------  160

Query  604  QFKQAEETAKKLDLDGLV  657
            QFKQAEET +KLDLDGLV
Sbjct  161  QFKQAEETVQKLDLDGLV  178



>ref|XP_001773466.1| predicted protein [Physcomitrella patens]
 gb|EDQ61666.1| predicted protein [Physcomitrella patens]
Length=567

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 147/191 (77%), Gaps = 1/191 (1%)
 Frame = +1

Query  88   AISLLAN-SDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGH  264
            A+S  AN  ++++AK    R  SVYS VQ SR+DH   LPSVL+ +FK+  GP S++AG 
Sbjct  2    AVSANANGQEVSAAKKDAVRDKSVYSPVQTSRIDHTPTLPSVLQGNFKLNHGPPSTSAGQ  61

Query  265  PEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQE  444
            PEEI KLFP LFGQPS  +V  DS    ++  LK+GVVLSGGQAPGGHNVI+G FDYLQ 
Sbjct  62   PEEIQKLFPCLFGQPSVQIVKSDSPSYNVDQKLKVGVVLSGGQAPGGHNVIAGFFDYLQA  121

Query  445  HCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEE  624
            H  GS LYGF+GGPAGIM+ K V +T E++YPYRNQGGFD+ICSGRDKIETP+QF+QA +
Sbjct  122  HAPGSVLYGFKGGPAGIMRNKVVEITAEFLYPYRNQGGFDIICSGRDKIETPEQFQQAVD  181

Query  625  TAKKLDLDGLV  657
            T  KLDLDGLV
Sbjct  182  TVTKLDLDGLV  192



>gb|KJB42857.1| hypothetical protein B456_007G170900 [Gossypium raimondii]
Length=568

 Score =   245 bits (625),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 146/195 (75%), Gaps = 4/195 (2%)
 Frame = +1

Query  79   MAPAISLLANSDIASAKTSTGRYA--SVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS  252
            M+PAI+      ++  +    R+   S Y + Q +RL+H  PLPS+L+  F+VVDG  ++
Sbjct  1    MSPAIAASNGLPVSRNEEGPSRFLLPSDYGDFQTNRLNHTPPLPSILKNPFQVVDGHPTT  60

Query  253  AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD  432
            AAG+P EIA LFP L+GQPS +LVP  S       +LK+GVV SGGQAPGGHNVI+GIFD
Sbjct  61   AAGNPNEIANLFPNLYGQPSVSLVPGQSE--VKGQSLKVGVVFSGGQAPGGHNVITGIFD  118

Query  433  YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK  612
            YLQE  +GSTLYGF+GGPAGIM CKYV LT + IYPYRNQGGF MICS RDKIETP+Q K
Sbjct  119  YLQERARGSTLYGFKGGPAGIMSCKYVKLTADLIYPYRNQGGFHMICSSRDKIETPEQLK  178

Query  613  QAEETAKKLDLDGLV  657
            QAEET KKLDLDGLV
Sbjct  179  QAEETVKKLDLDGLV  193



>ref|XP_002984967.1| hypothetical protein SELMODRAFT_234662 [Selaginella moellendorffii]
 gb|EFJ13842.1| hypothetical protein SELMODRAFT_234662 [Selaginella moellendorffii]
Length=560

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  124  AKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFG  303
            AK S  R  SVYS VQ+SRLD+  P+PSVL   FKV  G ++SAAG    IA+LFP LFG
Sbjct  10   AKRSCSREVSVYSPVQSSRLDYKPPMPSVLEGHFKVEHGSSTSAAGDAGAIAQLFPKLFG  69

Query  304  QPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGG  483
            QPS  +VP  +        L+IGVVLSGGQAPGGHNVI+G+FDYLQ+H  GS L GFRGG
Sbjct  70   QPSVHIVPCAAAAFKEEVKLRIGVVLSGGQAPGGHNVIAGLFDYLQKHAPGSLLLGFRGG  129

Query  484  PAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            PAGIM+CKYV +T E++YPYRNQGGFD+ICSGRDKIETP+QFKQAE+TA KLDLDG+V
Sbjct  130  PAGIMRCKYVEITSEFLYPYRNQGGFDIICSGRDKIETPEQFKQAEDTAVKLDLDGIV  187



>ref|XP_002986153.1| hypothetical protein SELMODRAFT_234963 [Selaginella moellendorffii]
 gb|EFJ12684.1| hypothetical protein SELMODRAFT_234963 [Selaginella moellendorffii]
Length=560

 Score =   243 bits (620),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = +1

Query  124  AKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFG  303
            AK S  R  SVYS VQ+SRLD+  P+PSVL   FKV  G ++SA G    IA+LFP LFG
Sbjct  10   AKRSCSREVSVYSPVQSSRLDYKPPMPSVLEGHFKVEHGSSTSAVGDAGAIAQLFPKLFG  69

Query  304  QPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGG  483
            QPS  +VP  +        L+IGVVLSGGQAPGGHNVI+G+FDYLQ+H  GS L GFRGG
Sbjct  70   QPSVHIVPCAAAAFKEEVKLRIGVVLSGGQAPGGHNVIAGLFDYLQKHAPGSLLLGFRGG  129

Query  484  PAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            PAGIM+CKYV +T E++YPYRNQGGFD+ICSGRDKIETP+QFKQAE+TA KLDLDG+V
Sbjct  130  PAGIMRCKYVEITSEFLYPYRNQGGFDIICSGRDKIETPEQFKQAEDTAVKLDLDGIV  187



>ref|XP_001770321.1| predicted protein [Physcomitrella patens]
 gb|EDQ64811.1| predicted protein [Physcomitrella patens]
Length=565

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = +1

Query  118  ASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGL  297
            A  KT T R  SVYS VQ SRLDH  PLP V    FK+  GP S+AAGHPEEIAKLFP L
Sbjct  15   APGKTGT-RDLSVYSPVQASRLDHTPPLPKVFHGHFKLKHGPPSTAAGHPEEIAKLFPNL  73

Query  298  FGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFR  477
            FGQPS  ++P +      N  LK+GVVLSGGQAPGGHNVI+G+FDYLQ H  GS LYGF+
Sbjct  74   FGQPSVEMIPCEGSAYDENRVLKVGVVLSGGQAPGGHNVIAGMFDYLQTHAPGSILYGFK  133

Query  478  GGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            GGPAGIM+ K++ +T   +YPYRNQGGFD+ICSGRDKIE P+QFKQAE T   LDLDGLV
Sbjct  134  GGPAGIMRNKWLEITTPLLYPYRNQGGFDIICSGRDKIELPEQFKQAETTVTALDLDGLV  193



>ref|XP_001774878.1| predicted protein [Physcomitrella patens]
 gb|EDQ60290.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 146/191 (76%), Gaps = 1/191 (1%)
 Frame = +1

Query  88   AISLLANS-DIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGH  264
            A++  AN+ ++A+ K    R  SVYS VQ SR+DH   LP+VL+ +FK+  GP ++AAG 
Sbjct  2    AVTSQANAQEVAAVKKDAVRDKSVYSPVQLSRIDHTPTLPAVLQGNFKLNHGPPTTAAGQ  61

Query  265  PEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQE  444
            PEEI KLFP L+GQPS  LV  D+    ++  LK+GVVLSGGQAPGGHNVI+G FDYLQ 
Sbjct  62   PEEIQKLFPCLYGQPSVQLVESDAPTYNVDQKLKVGVVLSGGQAPGGHNVIAGFFDYLQT  121

Query  445  HCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEE  624
            H  GS LYGF+GGPAGIM+   V +T +++YPYRNQGGFD+ICSGRDKIE+P+QF+QA +
Sbjct  122  HAPGSVLYGFKGGPAGIMRNNVVEITADFLYPYRNQGGFDIICSGRDKIESPEQFQQAVD  181

Query  625  TAKKLDLDGLV  657
            T  KLDLDGLV
Sbjct  182  TVTKLDLDGLV  192



>gb|EPS65871.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta, partial [Genlisea aurea]
Length=504

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  268  EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            +EIAKLFP LFGQPSA+LVP DS D ++   LKIG VLSGGQAPGGHNVISGIFDYLQ +
Sbjct  1    DEIAKLFPRLFGQPSASLVPADSKDNSLGRPLKIGAVLSGGQAPGGHNVISGIFDYLQNY  60

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
            CKGSTLYGFRGGPAGIMKCKYV+L  EYIYPYRNQGGFDMICSGRDKIETP+QFKQAEET
Sbjct  61   CKGSTLYGFRGGPAGIMKCKYVVLNSEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEET  120

Query  628  AKKLDLDGLV  657
            A KLDLDG+V
Sbjct  121  AVKLDLDGIV  130



>ref|XP_009610530.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Nicotiana tomentosiformis]
Length=513

 Score =   231 bits (588),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  316  ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI  495
            +LVP+DSGDVAMN +LKIGVVLSGGQAPGGHNVISGIFD+LQ HCKGSTLYGFRGGPAGI
Sbjct  27   SLVPEDSGDVAMNQSLKIGVVLSGGQAPGGHNVISGIFDFLQTHCKGSTLYGFRGGPAGI  86

Query  496  MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            MKCKYV+LTPEYIYPYRNQGGFDMICSGRDKIETP+QFKQAEETAKKLDLDGLV
Sbjct  87   MKCKYVVLTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLV  140



>gb|AGR67383.1| pyrophosphate-dependent phosphofructokinase beta subunit, partial 
[Citrus reshni]
Length=134

 Score =   216 bits (549),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  151  SVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPD  330
            SVYSE+Q SR+DH LPLPSVL+  FK+VDGPASSAAG+P+EIAKLFP LFGQPSA LVP+
Sbjct  1    SVYSELQTSRIDHALPLPSVLKNPFKIVDGPASSAAGNPDEIAKLFPNLFGQPSALLVPN  60

Query  331  DSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKY  510
             +  V  +  LKIGVVLSGGQAPGGHNVISGI+DYLQ+  KGS LYGFRGGPAGIMKCKY
Sbjct  61   GADAVRSDEKLKIGVVLSGGQAPGGHNVISGIYDYLQDRAKGSVLYGFRGGPAGIMKCKY  120

Query  511  VILTPEYIYPYRNQ  552
            V LT +YIYPYRNQ
Sbjct  121  VXLTSDYIYPYRNQ  134



>ref|XP_011086211.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like, partial [Sesamum indicum]
Length=154

 Score =   214 bits (544),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = +1

Query  88   AISLLANSDIASAKT-STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGH  264
            A +L+AN ++ + K+ +TGRYA+VYSEVQNSRLDHPLPLPSVLR  FKVVDGP SSAAG+
Sbjct  2    AAALVANGEVTAVKSPNTGRYAAVYSEVQNSRLDHPLPLPSVLRNPFKVVDGPPSSAAGN  61

Query  265  PEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQE  444
            P+EIAKLFP LFGQPSA LVP DS D      LKIGVVLSGGQAPGGHNVISGIFDYLQ+
Sbjct  62   PDEIAKLFPCLFGQPSATLVPADSSDNLSGQGLKIGVVLSGGQAPGGHNVISGIFDYLQD  121

Query  445  HCKGSTLYGFRGGPAGIMKCKYVIL  519
             CKGSTLYGF+GGPAG  + ++  L
Sbjct  122  RCKGSTLYGFKGGPAGRERWRWRWL  146



>ref|NP_001275324.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Solanum tuberosum]
 gb|AAA63452.1| pyrophosphate-fructose 6-phosphate 1-phosphotransferase beta-subunit 
[Solanum tuberosum]
Length=513

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  313  AALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAG  492
             +LVPDDSGDVAMN  LKIGVVLSGGQAPGGHNVISGIFDYLQ HCKGST+YGFRGGPAG
Sbjct  26   VSLVPDDSGDVAMNQILKIGVVLSGGQAPGGHNVISGIFDYLQTHCKGSTMYGFRGGPAG  85

Query  493  IMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            +MK KYV+LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQAEETAKKLDLDGLV
Sbjct  86   VMKGKYVVLTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLV  140



>ref|XP_010316565.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit beta-like [Solanum lycopersicum]
Length=513

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  313  AALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAG  492
             +LVPDDSGDVAMN  LKIGVVLSGGQAPGGHNVISGIFDYLQ HCKGST+YGFRGGPAG
Sbjct  26   VSLVPDDSGDVAMNQILKIGVVLSGGQAPGGHNVISGIFDYLQTHCKGSTMYGFRGGPAG  85

Query  493  IMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            +MK KYV LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQAEETAKKLDLDGLV
Sbjct  86   VMKGKYVGLTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLV  140



>gb|AGY61468.1| pyrophosphate-fructose-6-phosphate-phosphotransferase beta1, 
partial [Rorippa sylvestris]
Length=296

 Score =   214 bits (545),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  283  LFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGST  462
            LFPGL+GQPS A+VPD++   +    LKIGVVLSGGQAPGGHNVISG+FDYLQE  KGST
Sbjct  1    LFPGLYGQPSVAVVPDENA-ASSGQKLKIGVVLSGGQAPGGHNVISGLFDYLQERAKGST  59

Query  463  LYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLD  642
             YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETP+QFKQAEETAKKLD
Sbjct  60   FYGFKGGPAGIMKCKYVELNAEYILPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLD  119

Query  643  LDGLV  657
            LDGLV
Sbjct  120  LDGLV  124



>gb|AGY61467.1| pyrophosphate-fructose-6-phosphate-phosphotransferase beta1, 
partial [Rorippa amphibia]
Length=296

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  283  LFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGST  462
            LFPGL+GQPS A+VPD++   +    LKIGVVLSGGQAPGGHNVISG+FDYLQE  KGST
Sbjct  1    LFPGLYGQPSVAVVPDENA-ASSGQKLKIGVVLSGGQAPGGHNVISGLFDYLQERAKGST  59

Query  463  LYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLD  642
             YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETP+QFKQAEETAKKLD
Sbjct  60   FYGFKGGPAGIMKCKYVELNAEYILPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLD  119

Query  643  LDGLV  657
            LDGLV
Sbjct  120  LDGLV  124



>gb|KHN27784.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Glycine soja]
Length=224

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 111/131 (85%), Gaps = 4/131 (3%)
 Frame = +1

Query  265  PEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQE  444
            P EIAKLFP LFGQPSAALV  DS    +N  LKIGVVLSGGQAPGGHNVISGIFD    
Sbjct  77   PGEIAKLFPNLFGQPSAALVLSDSHAPPVNQKLKIGVVLSGGQAPGGHNVISGIFDL---  133

Query  445  HCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEE  624
              +GSTLYGFRGGPAGIMKCKYV LT +YIYPYRNQGGFDMI SGRDKIETP+QFKQAEE
Sbjct  134  -AEGSTLYGFRGGPAGIMKCKYVELTSDYIYPYRNQGGFDMIRSGRDKIETPEQFKQAEE  192

Query  625  TAKKLDLDGLV  657
            T +KLDL+GLV
Sbjct  193  TVQKLDLEGLV  203



>emb|CDY34604.1| BnaC08g41630D [Brassica napus]
Length=507

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 111/132 (84%), Gaps = 3/132 (2%)
 Frame = +1

Query  268  EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            +EIAKLFPGL+GQPS ++VPD S   +    LKIGVVLSGGQAPGGHNVISG+FDYLQE 
Sbjct  4    DEIAKLFPGLYGQPSVSVVPDPSA-ASSGQKLKIGVVLSGGQAPGGHNVISGLFDYLQER  62

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQ--GGFDMICSGRDKIETPDQFKQAE  621
             KGST YGF+ GPAGIMK KYV L  EYI+PYRNQ  GGFDMICSGRDKIETP+QFKQAE
Sbjct  63   AKGSTFYGFKVGPAGIMKFKYVELNAEYIHPYRNQILGGFDMICSGRDKIETPEQFKQAE  122

Query  622  ETAKKLDLDGLV  657
            ET  KLDLDGLV
Sbjct  123  ETTNKLDLDGLV  134



>gb|EMT25675.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Aegilops tauschii]
Length=550

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = +1

Query  244  ASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISG  423
            AS+     +EIAKLFP L+GQPSAA+VP  S +      LKIGVVLSGGQAPGGHNVI G
Sbjct  42   ASNIGVERDEIAKLFPCLYGQPSAAVVP--SAEPVETKPLKIGVVLSGGQAPGGHNVICG  99

Query  424  IFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPD  603
            IFDYLQE  KGST+YGF+GGPAG+MK KYV LT +++YPYRNQGGFDMICSGRDKIETP+
Sbjct  100  IFDYLQERAKGSTMYGFKGGPAGVMKGKYVELTTDFVYPYRNQGGFDMICSGRDKIETPE  159

Query  604  QFKQAEETAKKLDLDGLV  657
            QF+QAE+T  +LDLDGLV
Sbjct  160  QFQQAEDTVNRLDLDGLV  177



>gb|KJB67271.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=487

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  319  LVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIM  498
            LVP+   ++  +  LKIGVVLSGGQAPGGHNVISGIFDYLQE   GSTLYGF+GGPAGIM
Sbjct  2    LVPNGVDNIGSDQKLKIGVVLSGGQAPGGHNVISGIFDYLQERAPGSTLYGFKGGPAGIM  61

Query  499  KCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            K KYV LT +YIYPYRNQGGFDMICSGRDKIETP+QFKQAEETA KLDLDGLV
Sbjct  62   KGKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAAKLDLDGLV  114



>ref|XP_005707151.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Galdieria 
sulphuraria]
 gb|EME30631.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Galdieria 
sulphuraria]
Length=569

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 113/166 (68%), Gaps = 0/166 (0%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +  +RL++   LP +L+ +F   +G  +  A   EEI + FP L+GQPS  +VP+  G
Sbjct  31   SPLHRARLEYFPRLPPILKGAFGWREGEPTDFADDAEEIKRYFPNLYGQPSVFIVPNRGG  90

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
             V     L++GVVLSGG APGGHNVISG+FDYL    + S L+GF  GP+GI+K  YV L
Sbjct  91   PVTTGKTLRVGVVLSGGPAPGGHNVISGLFDYLYNRNRDSVLFGFLNGPSGIIKNNYVQL  150

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
              E IYPYRNQGGF +I S R KIETP+QF++ +ET + LDLDGLV
Sbjct  151  DEERIYPYRNQGGFHIIGSDRTKIETPEQFQKVDETVRSLDLDGLV  196



>ref|XP_008788881.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Phoenix dactylifera]
Length=148

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 94/130 (72%), Gaps = 5/130 (4%)
 Frame = +1

Query  97   LLANSDIASAKT--STGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPE  270
            + ANS +A+     S GR  +VYSEVQ SRL+H LPLPSV+R  FK+VDGP SSAAG+P+
Sbjct  1    MAANSILANGGKGPSPGRLTAVYSEVQTSRLNHSLPLPSVVRGPFKIVDGPLSSAAGNPD  60

Query  271  EIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQE--  444
            EI KLFP LFGQPSA LVP  S    M  +LK+GVVLSGGQAPGGHNVISGIF  L +  
Sbjct  61   EIKKLFPNLFGQPSATLVPTGSAPSEMAGSLKVGVVLSGGQAPGGHNVISGIFGQLLDVF  120

Query  445  -HCKGSTLYG  471
             + + S  +G
Sbjct  121  PNLRASNAFG  130



>ref|WP_007133749.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
salivae]
 gb|EFV05378.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
salivae DSM 15606]
 gb|ERJ98291.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
salivae F0493]
Length=546

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 106/166 (64%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+V+G  + +  + EEI KLFP  +G P    VP   G
Sbjct  4    SALQKERAAYQPKLPKALQGAVKIVEGAPTKSVDNQEEIKKLFPNTYGMPLIEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            + A N  L +GV+LSGGQAPGGHNVISG+FD L++    + LYGF  GP G++  +Y+ +
Sbjct  61   EKANNKKLNLGVILSGGQAPGGHNVISGLFDTLKKLNPENRLYGFLMGPGGLVDHEYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  121  TSDFIDQYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRKLDISAIV  166



>gb|EFB33295.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oris F0302]
Length=573

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 110/183 (60%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  SDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLF  288
            S+I+ +K          S +Q  R  +   LP  L+ + K+V+G  + +  + EEI KLF
Sbjct  14   SEISYSKIYKANKIMEISALQKERAAYQPKLPKALQGAVKIVEGAPTKSVDNQEEIKKLF  73

Query  289  PGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLY  468
            P  +G P    VP +  +      + IGV+LSGGQAPGGHNVISG+FD +++    + LY
Sbjct  74   PNTYGMPLIEFVPGEENNT---KRINIGVILSGGQAPGGHNVISGLFDAVKKLNSENRLY  130

Query  469  GFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLD  648
            GF  GP G++  KY+ +T ++I  YRN GGFDMI SGR K+E  DQF++  E  +KLD+ 
Sbjct  131  GFLMGPGGLVDHKYIEITADFIDQYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRKLDIS  190

Query  649  GLV  657
             +V
Sbjct  191  AIV  193



>emb|CBJ31829.1| RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=Pyrophosphate-dependent 
6-ph [Ectocarpus siliculosus]
Length=1147

 Score =   151 bits (381),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 110/168 (65%), Gaps = 2/168 (1%)
 Frame = +1

Query  157  YSEVQNSRLDHPLPLPSV-LRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDD  333
            +S++Q+ RL      P V L KS  V++  A  A  H + I  LFP  +G+P   LVP  
Sbjct  15   FSKLQDERLASRCIKPRVVLAKSVHVMEREALGARDHHDRIKALFPSTYGRPRIELVPGG  74

Query  334  SGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYV  513
              DV  +  L +GVVLSGGQAPGGHNVI+G+FD+ ++    S ++GF  GPAG+MK    
Sbjct  75   EADV-FDKPLNMGVVLSGGQAPGGHNVIAGVFDFAKKCSPDSKVFGFLNGPAGVMKGICT  133

Query  514  ILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
             +TPE +  YRN GGFDM+ SGRDKIET +Q + +++ A++L+LDGL+
Sbjct  134  EITPELMDAYRNTGGFDMLGSGRDKIETKEQMEASKKVAEELNLDGLI  181


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +1

Query  511  VILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            V +T E +  YRNQGGFD++   RD I T  +  +A+E    LDLDGLV
Sbjct  668  VEVTDELLDAYRNQGGFDLLGRSRDSIRTEAELAKAKEACAALDLDGLV  716



>ref|WP_004376175.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oris]
 gb|EFI49449.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oris C735]
Length=546

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+V+G  + +  + EEI KLFP  +G P    VP   G
Sbjct  4    SALQKERAAYQPKLPKALQGAVKIVEGAPTKSVDNQEEIKKLFPNTYGMPLIEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + IGV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++  KY+ +
Sbjct  61   EENNTKRINIGVILSGGQAPGGHNVISGLFDAVKKLNSENRLYGFLMGPGGLVDHKYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  121  TADFIDKYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRKLDISAIV  166



>ref|WP_036890490.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oris]
Length=546

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+V+G  + +  + EEI KLFP  +G P    VP +  
Sbjct  4    SALQKERAAYQPKLPKALQGAVKIVEGAPTKSVDNQEEIKKLFPNTYGMPLIEFVPGEEN  63

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + IGV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++  KY+ +
Sbjct  64   NT---KRINIGVILSGGQAPGGHNVISGLFDAVKKLNSENRLYGFLMGPGGLVDHKYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  121  TADFIDQYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRKLDISAIV  166



>ref|WP_026285932.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oris]
Length=546

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+V+G  + +  + EEI KLFP  +G P    VP   G
Sbjct  4    SALQKERAAYQPKLPKALQGAVKIVEGAPTKSVDNQEEIKKLFPNTYGMPLIEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + IGV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++  KY+ +
Sbjct  61   EENNTKRINIGVILSGGQAPGGHNVISGLFDAVKKLNSENRLYGFLMGPGGLVDHKYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  121  TADFIDQYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRKLDISAIV  166



>ref|WP_021896515.1| pyrophosphate-dependent phosphofructokinase [Prevotella sp. CAG:924]
 emb|CCY03614.1| pyrophosphate-dependent phosphofructokinase [Prevotella sp. CAG:924]
Length=548

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + KV +G  + + G  +EI KLFP  +G P    VP   G
Sbjct  4    SLLQKARAQYEPKLPKGLQNAVKVKEGAPTQSVGDQDEIKKLFPNTYGMPLIEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D AM  +  +G++LSGGQAPGGHNVI GIFD +++    + +YGF  GP G++  KY+ L
Sbjct  61   DTAMTMDGNVGIILSGGQAPGGHNVICGIFDAVKKLNPNNKVYGFLMGPGGLVDHKYIEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            TPE++  YRN GGFDMI SGR K+E  DQF+   E  ++L +  +V
Sbjct  121  TPEFVDEYRNTGGFDMIGSGRTKLEKVDQFESGLEIIRELGIKAIV  166



>ref|WP_024989602.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
albensis]
Length=547

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+ +G  + + G  EEI KLFP  +G P    VP   G
Sbjct  4    SALQKERAAYQPKLPKALQGAVKISEGKPTQSVGDQEEIKKLFPNTYGMPLIEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + IGV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  61   TEANNAKINIGVILSGGQAPGGHNVISGLFDTVKKLNPENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E++  YRN GGFDMI SGR K+E  DQF++  +  +KLD+  +V
Sbjct  121  TEEFLANYRNTGGFDMIGSGRTKLEKEDQFEKGLQIIRKLDIKAIV  166



>ref|WP_025790489.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
histicola]
Length=547

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R ++   LP  L+ + KV +G  + +  + E+I KLFP  +G P     P DS 
Sbjct  4    SALQKERANYQPKLPKALQGAVKVKEGAPTQSVDNQEDIKKLFPNTYGMPLVEFEPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N N+ +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNANMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENKLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  DQF++  E  KKL++  +V
Sbjct  121  TEENLQAYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIKKLNIKAIV  166



>ref|WP_022311541.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:474]
 emb|CDC98102.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:474]
Length=548

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + + G  EEI KLFP  +G P    VP   G
Sbjct  4    SLLQRERAAYQPKLPKGLQGAVKVQEGEPTQSVGDQEEIKKLFPNTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D AM+  + +GV+LSGGQAPGGHNVISGIFD +++    + LYGF  GP G+++  Y  L
Sbjct  61   DEAMSQKINVGVILSGGQAPGGHNVISGIFDAVKKLNPENKLYGFLMGPGGLVEHNYKEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E I  YRN GGFDMI SGR K+E  DQF++  E  ++L ++ +V
Sbjct  121  TAEIIDDYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRELGINAIV  166



>ref|WP_025839858.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
scopos]
Length=547

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + EEI KLFP  +G P    VP D+ 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVKEGAPTQSVDNQEEIKKLFPNTYGMPLVEFVPSDA-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++  KY+ +
Sbjct  63   --ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPENRLYGFLMGPGGLVDHKYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  +QF++  E  ++LD+  +V
Sbjct  121  TAENLQAYRNTGGFDMIGSGRTKLEKEEQFEKGLEIIRQLDIKAIV  166



>ref|WP_009010591.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. C561]
 gb|EGW48516.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. C561]
Length=547

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P    VP DS 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVQEGAPTQSVDNQEDIKKLFPNTYGMPLVEFVPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  121  TAESLQAYRNTGGFDMIGSGRTKLEKEDQFEKGLEILRKLDIKAVV  166



>ref|WP_007366298.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
multiformis]
 gb|EGC19896.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
multiformis DSM 16608]
Length=547

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + EEI KLFP  +G P   LV  +  
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVKEGTPTQSVDNQEEIKKLFPNTYGMP---LVEFEPA  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            + A N  + +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  61   ETANNAKMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENRLYGFLMGPGGLVDHNYMEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E++  YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  121  TAEFLQAYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRKLDIKAIV  166



>ref|XP_011402204.1| ATP-dependent zinc metalloprotease FTSH 5, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM29151.1| ATP-dependent zinc metalloprotease FTSH 5, mitochondrial [Auxenochlorella 
protothecoides]
Length=1068

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 109/190 (57%), Gaps = 18/190 (9%)
 Frame = +1

Query  97   LLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEI  276
            L     + S + + G      S +Q  RL++   +P                AA + E I
Sbjct  506  LRTKDHVLSIEDALGNVGRHLSRLQRERLEYEPLVPE---------------AAANHEAI  550

Query  277  AKLFPGLFGQPS--AALVPDDSGDVAMNHN-LKIGVVLSGGQAPGGHNVISGIFDYLQEH  447
            AKLFP L   P     LVP +    A  H  L+IGVVLSGGQAPGGHNVI+GIFDYL + 
Sbjct  551  AKLFPQLCRSPLHLLRLVPGEHAPHAEGHRPLRIGVVLSGGQAPGGHNVITGIFDYLAKQ  610

Query  448  CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET  627
              GS L GF+ GP GI+   + +LT   +  YRNQGGF +ICSGRDKIE P+Q K A++T
Sbjct  611  HPGSVLIGFKDGPRGIINNDHKLLTARELEFYRNQGGFHLICSGRDKIEKPEQLKAAKQT  670

Query  628  AKKLDLDGLV  657
             K+L LDGLV
Sbjct  671  CKELGLDGLV  680



>ref|WP_036927708.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
timonensis]
 gb|KGI21925.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
timonensis S9-PR14]
Length=546

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +    EEI KLFP  +G P    VP   G
Sbjct  4    SALQVERAVYQPKLPKALQGAVKVQEGAPTQSVDDQEEIQKLFPHTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +   +  L +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G+++  YV +
Sbjct  61   EHTESKRLNVGVILSGGQAPGGHNVISGLFDAVKKLNPENQLYGFLMGPGGLVEHHYVEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E++ PYRN GGFDMI SGR K+E  +QF++  E  KKLD+  LV
Sbjct  121  TKEFLDPYRNTGGFDMIGSGRTKLEKEEQFEKGLEILKKLDIKALV  166



>ref|WP_009434216.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 306]
 gb|EID34440.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 306 str. F0472]
Length=547

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P     P DS 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVKEGAPTQSVDNQEDIKKLFPNTYGMPLVEFEPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNAKMNVGVILSGGQAPGGHNVISGLFDEVKKLNPDNRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  DQF++  E  KKLD+  +V
Sbjct  121  TAENLQAYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIKKLDIKAIV  166



>gb|EGV34403.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
oulorum F0390]
Length=547

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + K+V+G  + +  + EEI  LFP  +G P    VP   G
Sbjct  5    SALQKARSAYQPKLPKALQGAVKIVEGAPTQSVDNQEEIKNLFPNTYGMPLVEFVP---G  61

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  62   NETNQKKMNVGIILSGGQAPGGHNVISGLFDAVKKLNPENRLYGFLMGPGGLVDHNYIEI  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E+I PYRN GGFDMI SGR K+E  +QF++  +  +KLD+  +V
Sbjct  122  TSEFIDPYRNTGGFDMIGSGRTKLEKEEQFEKGLQIIRKLDISAIV  167



>ref|WP_040561026.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oulorum]
Length=546

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + K+V+G  + +  + EEI  LFP  +G P    VP   G
Sbjct  4    SALQKARSAYQPKLPKALQGAVKIVEGAPTQSVDNQEEIKNLFPNTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  61   NETNQKKMNVGIILSGGQAPGGHNVISGLFDAVKKLNPENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E+I PYRN GGFDMI SGR K+E  +QF++  +  +KLD+  +V
Sbjct  121  TSEFIDPYRNTGGFDMIGSGRTKLEKEEQFEKGLQIIRKLDISAIV  166



>ref|WP_036869025.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
histicola]
 gb|KGF29108.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
histicola JCM 15637 = DNF00424]
Length=547

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R ++   LP  L+ + KV +G  + +  + E+I KLFP  +G P     P DS 
Sbjct  4    SALQKERANYQPKLPKALQGAVKVKEGAPTQSVDNQEDIKKLFPNTYGMPLVEFEPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNAKMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENKLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  DQF++  E  KKL++  +V
Sbjct  121  TEENLQAYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIKKLNIKAIV  166



>ref|WP_008822440.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
histicola]
 gb|EHG17195.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
histicola F0411]
Length=547

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R ++   LP  L+ + KV +G  + +  + E+I KLFP  +G P     P DS 
Sbjct  4    SALQKERANYQPKLPKALQGAVKVKEGAPTQSVDNQEDIKKLFPNTYGMPLVEFEPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNAKMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENKLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  DQF++  E  KKL++  +V
Sbjct  121  TEENLQAYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIKKLNIKAIV  166



>ref|WP_004383638.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
veroralis]
 gb|EEX18162.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
veroralis F0319]
Length=547

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P     P DS 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVKEGAPTQSVDNQEDIKKLFPNTYGMPLVEFEPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNAKMNVGVILSGGQAPGGHNVISGLFDEVKKLNPDNRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  DQF++  E  KKLD+  +V
Sbjct  121  TAENLQAYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIKKLDIKAVV  166



>ref|WP_018909818.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
veroralis]
Length=547

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P     P DS 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVKEGAPTQSVDNQEDIKKLFPNTYGMPLVEFEPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNAKMNVGVILSGGQAPGGHNVISGLFDEVKKLNPDNRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  DQF++  E  KKLD+  +V
Sbjct  121  TAENLQAYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIKKLDIKAVV  166



>gb|ERK00034.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
pleuritidis F0068]
Length=600

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 119/220 (54%), Gaps = 11/220 (5%)
 Frame = +1

Query  4    KIYFSSELFFSYLPHSLFPLGENQSMAPAIS--LLANSDIASAKTSTGRYASVYSEVQNS  177
            KI+         LPH    + +      A+S   L N+ I       G+     S +Q  
Sbjct  10   KIFLIVGFLMETLPH----IADLSYFCRALSRCWLDNNKIILYNKQKGKMKK--SLLQKE  63

Query  178  RLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNH  357
            R  +   LP  L+ + KV +G  + +    EEI KLFP  +G P    VP   G+ A + 
Sbjct  64   RSSYQPKLPKGLQGAVKVKEGAPTQSVSDREEIQKLFPNTYGMPLVEFVP---GNEANHE  120

Query  358  NLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIY  537
             + +GV+LSGGQAPGGHNVI GIFD +++    + LYGF  GP G+++  Y+ LT E I 
Sbjct  121  AMNVGVILSGGQAPGGHNVICGIFDEVKKLNPNNRLYGFLMGPGGLVEHNYIELTAEIID  180

Query  538  PYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
             YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  181  DYRNTGGFDMIGSGRTKLEEEDQFEKGLEIIRKLDIQAIV  220



>ref|WP_025877362.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
corporis]
Length=553

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 105/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+ +G  + +    EEI KLFP  +G P    VP DS 
Sbjct  4    SALQKERAKYQPKLPKALQGAVKIKEGKPTQSVDDYEEIKKLFPNTYGMPLVEFVPADSQ  63

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D   + ++ +GV+LSGGQAPGGHNVISG+FD L++    + LYGF  GP G++   Y+ +
Sbjct  64   D---SLSINVGVILSGGQAPGGHNVISGLFDELKKINPNNRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I+ YRN GGFD+I SGR K+E+ DQF++  E  ++LD+  +V
Sbjct  121  TSDLIHNYRNTGGFDLIGSGRTKLESIDQFERGLEIIRQLDIKAIV  166



>ref|WP_018464632.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
paludivivens]
Length=546

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 105/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G ++ +  + EEI KLFP  +G P    VP ++ 
Sbjct  4    SALQKERAAYQPKLPKALQGAVKVKEGASTKSVDNQEEIKKLFPNTYGMPLIEFVPGENA  63

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D      + IGV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  64   D---KKKINIGVILSGGQAPGGHNVISGLFDAVKKLNSENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E++  YRN GGFDMI SGR K+E  +QF++  +  ++LD++ +V
Sbjct  121  TAEFLNQYRNTGGFDMIGSGRTKLEEENQFEKGLKIIRELDINAIV  166



>ref|WP_008121761.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
timonensis]
 gb|EFA98541.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
timonensis CRIS 5C-B1]
Length=546

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +    EEI KLFP  +G P    VP   G
Sbjct  4    SALQVERAAYQPKLPKALQGAVKVQEGAPTQSVDDQEEIQKLFPHTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +   +  L +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G+++  YV +
Sbjct  61   EHTESKRLNVGVILSGGQAPGGHNVISGLFDAVKKLNPENQLYGFLMGPGGLVEHHYVEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +++ PYRN GGFDMI SGR K+E  +QF++  E  KKLD+  LV
Sbjct  121  TKDFLDPYRNTGGFDMIGSGRTKLEKEEQFEKGLEILKKLDIKALV  166



>ref|WP_022252312.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:386]
 emb|CDC24261.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:386]
Length=548

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            SE+Q +R  +   LP  L+ + KV +G  + +  + EEI KLFP  +G P    VP   G
Sbjct  4    SELQLARAAYLPKLPKGLQGNVKVKEGAPTQSVDNQEEIKKLFPNTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D A +  + +GV+LSGGQAPGGHNVI G+FD L++    + LYGF  GP G++   Y+ +
Sbjct  61   DEAHDTKMNVGVILSGGQAPGGHNVICGLFDALKKLNPANRLYGFLMGPGGLVDHNYMEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+E  DQF +  E  ++LD+  +V
Sbjct  121  TADFINDYRNTGGFDMIGSGRTKLEKTDQFDKGLEIIRELDIQAVV  166



>ref|WP_028909804.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. AGR2160]
Length=549

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + EEI KLFP  +G P    VP D  
Sbjct  5    SALQKERAAYQPKLPKALQGAVKVQEGAPTQSVDNQEEIKKLFPNTYGMPLIEFVPGDEE  64

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            + A    + IGV+LSGGQAPGGHNVI+G+FD L++    + LYGF  GP G++   Y+ +
Sbjct  65   NRA---KMNIGVILSGGQAPGGHNVITGLFDTLKKLNPENRLYGFLMGPGGLVDHNYIEI  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +++  YRN GGFDMI SGR K+E  DQF++  +  +KLD+  +V
Sbjct  122  TEDFLKDYRNTGGFDMIGSGRTKLEKEDQFEKGLQIIRKLDIKAIV  167



>ref|WP_028896044.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. HUN102]
Length=547

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + K+ +G  + +  + EEI  LFP  +G P    VP D  
Sbjct  4    SALQKARAAYQPKLPKALQGAVKIQEGEPTQSVDNHEEIKNLFPNTYGMPLVEFVPADKE  63

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVISG+FD L++    + LYGF+ GP G++  KY+ +
Sbjct  64   NAL---RINVGVILSGGQAPGGHNVISGLFDQLKKLNPENRLYGFQMGPGGLVDHKYLEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            TPE +  YRN GGFDMI SGR K+E  +QF++  E  ++LD+  LV
Sbjct  121  TPELMDKYRNTGGFDMIGSGRTKLEEVEQFEKGLEIIRELDIKALV  166



>gb|KJB67272.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=460

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  421  GIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETP  600
            G+ DYLQE   GSTLYGF+GGPAGIMK KYV LT +YIYPYRNQGGFDMICSGRDKIETP
Sbjct  9    GMKDYLQERAPGSTLYGFKGGPAGIMKGKYVELTADYIYPYRNQGGFDMICSGRDKIETP  68

Query  601  DQFKQAEETAKKLDLDGLV  657
            +QFKQAEETA KLDLDGLV
Sbjct  69   EQFKQAEETAAKLDLDGLV  87



>ref|WP_021940332.1| hypothetical protein [Bacteroides eggerthii CAG:109]
 emb|CCY55520.1| putative uncharacterized protein [Bacteroides eggerthii CAG:109]
Length=485

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 106/167 (63%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  LR + K V G A+ +    E+I KLFP  +G P   L+  ++ 
Sbjct  4    SALQIARAAYQPKLPKALRGTVKAVAGAATQSVADQEDIKKLFPNTYGMP---LIKFEAT  60

Query  340  DVAMNH-NLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI  516
            D A+N   + +GV+LSGGQAPGGHNVISGIFD +++  K S LYGF  GP G++   Y+ 
Sbjct  61   DEAVNFPAMNVGVILSGGQAPGGHNVISGIFDGIKKLNKDSKLYGFILGPGGLVDHNYME  120

Query  517  LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            LT + I  YRN GGFD+I SGR K+E  DQF++  E  K+L++  LV
Sbjct  121  LTADIIDEYRNTGGFDIIGSGRTKLEKEDQFEKGLEILKELNIKALV  167



>ref|WP_013265533.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica]
 gb|ADK97073.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica ATCC 25845]
Length=547

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P    VP DS 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVQEGAPTQSVDNQEDIKKLFPNTYGMPLVEFVPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  +QF++  E  +KLD+  +V
Sbjct  121  TAENLQAYRNTGGFDMIGSGRTKLEKEEQFEKGLEILRKLDIKAVV  166



>ref|WP_036925131.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. ICM33]
 gb|ETS96328.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. ICM33]
Length=547

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P    VP DS 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVQEGAPTQSVDNQEDIKKLFPNTYGMPLVEFVPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  +QF++  E  +KLD+  +V
Sbjct  121  TAENLQAYRNTGGFDMIGSGRTKLEKEEQFEKGLEILRKLDIKAVV  166



>ref|WP_036865072.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica]
 gb|KGF47636.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica DNF00666]
Length=547

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P    VP DS 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVQEGAPTQSVDNQEDIKKLFPNTYGMPLVEFVPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  +QF++  E  +KLD+  +V
Sbjct  121  TAENLQTYRNTGGFDMIGSGRTKLEKEEQFEKGLEILRKLDIKAVV  166



>ref|WP_024467519.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pedis]
Length=563

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 103/170 (61%), Gaps = 5/170 (3%)
 Frame = +1

Query  157  YSEVQNSRLDHPLPLPSVLRKSFKVVD---GPASSAAGHPEEIAKLFPGLFGQPSAALVP  327
            YS +Q  R ++   +P V  K F  +    G +++A  + EE+ +LFP  +G P    V 
Sbjct  3    YSTMQRLRYNYKPKMPDVFYKDFASIKPEIGKSTAALTNQEELKELFPNTYGMPVVKFVE  62

Query  328  DDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCK  507
              SG    +  LK GV+LSGGQAPGGHNVISG++D L++  K S LYGF  GP G++K  
Sbjct  63   GKSG--CTSKPLKFGVILSGGQAPGGHNVISGLYDALKKSNKNSKLYGFLYGPEGLVKGN  120

Query  508  YVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            Y+ +  E I  YRN GGFD+I SGR KIET +Q   + +  KKL LD LV
Sbjct  121  YIEIKKELIDKYRNTGGFDIIGSGRAKIETEEQVADSIKNVKKLGLDALV  170



>ref|WP_036872035.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccalis]
 gb|KGF35998.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccalis DNF00853]
Length=546

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+ +G  + +  + EEI KLFP  +G P    VP   G
Sbjct  4    SALQKERASYQPKLPKALQGAVKIKEGAPTESVDNQEEIRKLFPHTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D   +  + +GV+LSGGQAPGGHNVISG+FD +++  + + LYGF  GP G++   Y+ +
Sbjct  61   DKCEHKLMNVGVILSGGQAPGGHNVISGLFDAVKKLNEENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T  ++  YRN GGFDMI SGR K+E  DQF++  E  ++LD+  LV
Sbjct  121  TANFLEKYRNTGGFDMIGSGRTKLEKEDQFEKGLEVIRELDIKALV  166



>ref|WP_039876710.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
pleuritidis]
Length=546

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +    EEI KLFP  +G P    VP   G
Sbjct  4    SLLQKERSSYQPKLPKGLQGAVKVKEGAPTQSVSDREEIQKLFPNTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            + A +  + +GV+LSGGQAPGGHNVI GIFD +++    + LYGF  GP G+++  Y+ L
Sbjct  61   NEANHEAMNVGVILSGGQAPGGHNVICGIFDEVKKLNPNNRLYGFLMGPGGLVEHNYIEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E I  YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  121  TAEIIDDYRNTGGFDMIGSGRTKLEEEDQFEKGLEIIRKLDIQAIV  166



>ref|WP_025065627.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
enoeca]
Length=546

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +    EEI KLFP  +G P    VP   G
Sbjct  4    SLLQKERSSYQPKLPKGLQGAVKVKEGAPTQSVSDREEIQKLFPNTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            + A +  + +GV+LSGGQAPGGHNVI GIFD +++    + LYGF  GP G+++  Y+ L
Sbjct  61   NEANHEAMNVGVILSGGQAPGGHNVICGIFDEVKKLNPNNRLYGFLMGPGGLVEHNYIEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E I  YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  121  TSEIIDDYRNTGGFDMIGSGRTKLEEEDQFEKGLEIIRKLDIQAIV  166



>ref|WP_024991268.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
pleuritidis]
Length=546

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +    EEI KLFP  +G P    VP   G
Sbjct  4    SLLQKERSSYQPKLPKGLQGAVKVKEGAPTQSVSDREEIQKLFPNTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            + A +  + +GV+LSGGQAPGGHNVI GIFD +++    + LYGF  GP G+++  Y+ L
Sbjct  61   NEANHEAMNVGVILSGGQAPGGHNVICGIFDEVKKLNPNNRLYGFLMGPGGLVEHNYIEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E I  YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  121  TAEIIDDYRNTGGFDMIGSGRTKLEEEDQFEKGLEIIRKLDIQAIV  166



>ref|WP_028912949.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. MA2016]
Length=545

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + KV +G A+ + G  EEI KLFP  +G P     P    
Sbjct  4    SALQQARAAYQPKLPKALQGAVKVKEGAATQSVGDQEEIKKLFPNTYGMPIVEFEPATE-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +G++LSGGQAPGGHNVI+G+FD +++    + L+GF  GP G++   Y+ L
Sbjct  63   --ANNTKMNVGIILSGGQAPGGHNVITGLFDQIKKLNPENRLFGFILGPGGLVDHNYMEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E I  YRN GGFDMI SGR K+E  DQF++  E  +KLD+  +V
Sbjct  121  TSEIIDEYRNTGGFDMIGSGRTKLEKVDQFEKGLEIIRKLDIKAIV  166



>ref|WP_021854968.1| phosphofructokinase [Prevotella sp. CAG:255]
 emb|CCX70505.1| phosphofructokinase [Prevotella sp. CAG:255]
Length=546

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R+D+   LP+ L+ S KV +G  + +    E+I KLFP  +G P     P +  
Sbjct  4    SALQKARIDYAPKLPTSLQGSVKVKEGAPTQSVDDQEDIKKLFPNTYGMPVVEFEPSNET  63

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
                   + +GV+LSGGQAPGGHNVI+G+FD ++     + LYGF  GP G++  KY+ +
Sbjct  64   QTC---EMNVGVILSGGQAPGGHNVITGLFDTIKRLNPNNKLYGFILGPGGLVDHKYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +YI  YRN GGFDMI SGR K+E  +QF++  E  ++L++  LV
Sbjct  121  TEDYINDYRNTGGFDMIGSGRTKLEKIEQFEKGLEIVRELNIKALV  166



>ref|WP_020966487.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pedis]
 gb|AGT45192.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pedis str. T A4]
Length=563

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 103/170 (61%), Gaps = 5/170 (3%)
 Frame = +1

Query  157  YSEVQNSRLDHPLPLPSVLRKSFKVVD---GPASSAAGHPEEIAKLFPGLFGQPSAALVP  327
            YS +Q  R ++   +P V  K F  +    G +++A  + EE+ +LFP  +G P    V 
Sbjct  3    YSTMQRLRYNYKPKMPDVFYKDFASIKPEIGKSTAALTNQEELKELFPNTYGMPVIKFVE  62

Query  328  DDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCK  507
              SG    +  LK GV+LSGGQAPGGHNVISG++D L++  K S LYGF  GP G++K  
Sbjct  63   GKSG--CTSKPLKFGVILSGGQAPGGHNVISGLYDALKKSNKNSKLYGFLYGPEGLVKGN  120

Query  508  YVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            Y+ +  E I  YRN GGFD+I SGR KIET +Q   + +  KKL LD LV
Sbjct  121  YIEIKKELIDKYRNTGGFDIIGSGRAKIETEEQVADSIKNVKKLGLDALV  170



>ref|WP_025071710.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
timonensis]
Length=546

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +    EEI KLFP  +G P    VP   G
Sbjct  4    SALQVERAAYQPKLPKALQGAVKVQEGAPTQSVDDQEEIQKLFPHTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +   +  L +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G+++  YV +
Sbjct  61   EHTESKRLNVGVILSGGQAPGGHNVISGLFDAVKKLNPENQLYGFLMGPGGLVEHHYVEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +++ PYRN GGFDMI SGR K+E  +QF++  E  K+LD+  LV
Sbjct  121  TKDFLDPYRNTGGFDMIGSGRTKLEKEEQFEKGLEILKELDIKALV  166



>ref|WP_007172919.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
bergensis]
 gb|EFA44740.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
bergensis DSM 17361]
Length=549

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L  + KV +G  + + G  +EI KLFP  +G P    VP   G
Sbjct  4    SLLQKARAHYQPKLPKALVGAVKVREGETTQSVGDQDEIKKLFPHTYGLPVIHFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +  +   + +GV+LSGGQAPGGHNVI GIFD ++     + +YGF  GP+G+++  Y  L
Sbjct  61   EERIGMKMNVGVILSGGQAPGGHNVICGIFDAVKAQNPENKVYGFLMGPSGLIEHDYKEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T EY+  YRN GGFDMI SGR K+E  DQF++  E  +KL++  L+
Sbjct  121  TEEYVESYRNTGGFDMIGSGRTKLEKEDQFEKGREILEKLNIKALI  166



>ref|WP_004290431.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
eggerthii]
 gb|EEC53640.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
eggerthii DSM 20697]
Length=548

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 106/167 (63%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  LR + K V G A+ +    E+I KLFP  +G P   L+  ++ 
Sbjct  4    SALQIARAAYQPKLPKALRGTVKAVAGAATQSVADQEDIKKLFPNTYGMP---LIKFEAT  60

Query  340  DVAMNH-NLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI  516
            D A+N   + +GV+LSGGQAPGGHNVISGIFD +++  K S LYGF  GP G++   Y+ 
Sbjct  61   DEAVNFPAMNVGVILSGGQAPGGHNVISGIFDGIKKLNKDSKLYGFILGPGGLVDHNYME  120

Query  517  LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            LT + I  YRN GGFD+I SGR K+E  DQF++  E  K+L++  LV
Sbjct  121  LTADIIDEYRNTGGFDIIGSGRTKLEKEDQFEKGLEILKELNIKALV  167



>ref|WP_013672124.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola]
 gb|AEA21353.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola F0289]
Length=547

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P     P +S 
Sbjct  4    SALQKERSGYQPKLPKALQGAVKVKEGAPTQSVNNQEDIKKLFPNTYGMPLVEFEPAES-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   YV +
Sbjct  63   --ANNAKMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENRLYGFLMGPGGLVDHNYVEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +Y+  YRN GGFDMI SGR K+E  DQF++  E  +KL++  +V
Sbjct  121  TADYLQSYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRKLNIKAVV  166



>ref|WP_004292707.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
eggerthii]
 gb|EFV31548.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
eggerthii 1_2_48FAA]
Length=548

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 106/167 (63%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  LR + K V G A+ +    E+I KLFP  +G P   L+  ++ 
Sbjct  4    SALQIARAAYQPKLPKALRGTVKAVAGAATQSVADQEDIKKLFPNTYGMP---LIKFEAT  60

Query  340  DVAMNH-NLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI  516
            D A+N   + +GV+LSGGQAPGGHNVISGIFD +++  K S LYGF  GP G++   Y+ 
Sbjct  61   DEAVNFPAMNVGVILSGGQAPGGHNVISGIFDGIKKLNKDSKLYGFILGPGGLVDHNYME  120

Query  517  LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            LT + I  YRN GGFD+I SGR K+E  DQF++  E  K+L++  LV
Sbjct  121  LTADIIDEYRNTGGFDIIGSGRTKLEKEDQFEKGLEILKELNIKALV  167



>ref|WP_008564004.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
maculosa]
 gb|EHO73775.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
maculosa OT 289]
Length=546

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + K+ +G  + +  + EEI KLFP  +G P    +P   G
Sbjct  4    SALQKARAAYQPKLPKALQGAVKIAEGAPTKSVDNQEEIKKLFPNTYGMPLIEFIP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +   N  + IGV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  61   EEVNNKKINIGVILSGGQAPGGHNVISGLFDAVKKLNSENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+E  DQF++  +  ++L++  +V
Sbjct  121  TADFIDQYRNTGGFDMIGSGRTKLEKEDQFEKGLQIIRELNISAVV  166



>ref|WP_021671600.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. F0091]
 gb|ERJ79916.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. F0091]
Length=547

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P    VP DS 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVQEGAPTQSVDNQEDIKKLFPNTYGMPLVEFVPADS-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  63   --ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  +QF++  E  ++LD+  +V
Sbjct  121  TAENLQAYRNTGGFDMIGSGRTKLEKEEQFEKGLEIIRQLDIKAVV  166



>ref|WP_010663795.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Marinilabilia 
salmonicolor]
Length=548

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 102/170 (60%), Gaps = 6/170 (4%)
 Frame = +1

Query  154  VYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAAL-VPD  330
            + S +Q +R  +   +P+ L+ S KVVDG  + +     EI K+FP  +G P       D
Sbjct  3    IKSPLQIAREKYAPKVPAALKGSVKVVDGDKTQSVADQGEIEKMFPNTYGMPVLTFEASD  62

Query  331  DSGDV-AMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCK  507
            +  D  AMN    +GV+LSGGQAPGGHNVISG+FD L+     S LYGF GGP+G+   +
Sbjct  63   EKKDFPAMN----VGVILSGGQAPGGHNVISGLFDGLKTLNSDSKLYGFLGGPSGLTDNQ  118

Query  508  YVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            Y  LT + I  YRN GGFD+I SGR K+E   QF Q  E  KKLD+  LV
Sbjct  119  YKELTSDVIDEYRNTGGFDIIGSGRTKLEEESQFDQTLENCKKLDIKALV  168



>ref|WP_004359492.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica]
 gb|EFC73632.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica D18]
Length=547

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P    VP DS 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKVQEGAPTQSVDNQEDIKKLFPNTYGMPLVEFVPADSV  63

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +   N  + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  64   N---NAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E +  YRN GGFDMI SGR K+E  +QF++  E  +KLD+  +V
Sbjct  121  TAENLQAYRNTGGFDMIGSGRTKLEKEEQFEKGLEVLRKLDIKAVV  166



>ref|WP_018028382.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
somerae]
Length=548

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 108/167 (65%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP+ L+ + KVV+G  + +    EEI +LFP  +G P+ A    + G
Sbjct  5    SPLQKARSKYEPKLPNALKGNVKVVEGNPTHSVDDQEEIKQLFPNTYGLPTIAF---EKG  61

Query  340  DVAMNHN-LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI  516
            D  ++   + +GV+LSGGQAPGGHNVI+GIFD +++  K S LYGF  GPAG++  KY+ 
Sbjct  62   DAPLHTKPINVGVILSGGQAPGGHNVIAGIFDGIKKINKDSRLYGFLMGPAGLIDHKYME  121

Query  517  LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            +T E +  YRN GGFD+I SGR K+ET +QF +     +KLD+  LV
Sbjct  122  ITSEIMDEYRNTGGFDIIGSGRTKLETEEQFDKGLIILRKLDIQALV  168



>ref|WP_025067563.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola]
Length=547

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P     P +S 
Sbjct  4    SALQKERSGYQPKLPKALQGAVKVKEGAPTQSVDNQEDIKKLFPNTYGMPLVEFEPAES-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   YV +
Sbjct  63   --ANNAKMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENRLYGFLMGPGGLVDHNYVEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +Y+  YRN GGFDMI SGR K+E  DQF++  E  +KL++  +V
Sbjct  121  TADYLQSYRNTGGFDMIGSGRTKLEKKDQFEKGLEIIRKLNIKAVV  166



>ref|WP_036854388.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola]
 gb|KGF42223.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola DNF00960]
Length=547

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P     P +S 
Sbjct  4    SALQKERSGYQPKLPKALQGAVKVKEGAPTQSVDNQEDIKKLFPNTYGMPLVEFEPAES-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   YV +
Sbjct  63   --ANNAKMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENRLYGFLMGPGGLVDHNYVEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +Y+  YRN GGFDMI SGR K+E  DQF++  E  +KL++  +V
Sbjct  121  TADYLQSYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRKLNIKAVV  166



>ref|WP_004353492.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola]
 gb|EGC86256.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola CRIS 18C-A]
Length=547

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + KV +G  + +  + E+I KLFP  +G P     P +S 
Sbjct  4    SALQKERSGYQPKLPKALQGAVKVKEGAPTQSVDNQEDIKKLFPNTYGMPLVEFEPAES-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +GV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   YV +
Sbjct  63   --ANNAKMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENRLYGFLMGPGGLVDHNYVEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +Y+  YRN GGFDMI SGR K+E  DQF++  E  +KL++  +V
Sbjct  121  TADYLQSYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRKLNIKAVV  166



>ref|WP_019967261.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
maculosa]
Length=546

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + KV +G  + +  + EEI  LFP  +G P    +P   G
Sbjct  4    SALQKARAAYQPKLPKALQGAVKVAEGAPTKSVDNQEEIKMLFPNTYGMPLIEFIP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            + A N  + IGV+LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  61   EEANNKKINIGVILSGGQAPGGHNVISGLFDAVKKLNSENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+E  DQF++  +  ++L++  +V
Sbjct  121  TADFIDQYRNTGGFDMIGSGRTKLEKEDQFEKGLQIIRELNISAVV  166



>ref|WP_038563379.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Draconibacterium 
orientale]
 gb|AHW61396.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Draconibacterium 
orientale]
Length=550

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 104/167 (62%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+V+G  + +    +EIA+LFP  +G P   L+  ++ 
Sbjct  4    SALQKERAKYQPKLPKSLKGNVKLVEGAKTESVADQKEIAELFPNTYGMP---LITFEAA  60

Query  340  DVAMNHN-LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI  516
            D A +   + +GV+LSGGQAPGGHNVISGIFD ++     S LYGF GGP G++  KY+ 
Sbjct  61   DAATDRQPVNVGVILSGGQAPGGHNVISGIFDGIKNIHPDSKLYGFLGGPGGLVDHKYME  120

Query  517  LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            LT + I  YRN GGFD+I SGR K+E   QF +  E AK L L+ LV
Sbjct  121  LTADIIDEYRNTGGFDIIGSGRTKLEEEAQFDKGLEIAKDLGLNALV  167



>ref|WP_023058711.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Prevotella]
 gb|ERT56306.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. BV3P1]
 gb|KGF42411.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccalis DNF00985]
Length=546

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+ +G  + +    EEI KLFP  +G P    VP   G
Sbjct  4    SALQKERASYQPKLPKALQGAVKIKEGAPTESVDDQEEIKKLFPHTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D   +  + +GV+LSGGQAPGGHNVISG+FD +++  + + LYGF  GP G++   Y+ +
Sbjct  61   DKCEHKLMNVGVILSGGQAPGGHNVISGLFDAVKKLNEENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T  ++  YRN GGFDMI SGR K+E  DQF++  E  ++LD+  LV
Sbjct  121  TAGFLEKYRNTGGFDMIGSGRTKLEKEDQFEKGLEVIRELDIKALV  166



>ref|WP_007574011.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
multisaccharivorax]
 gb|EGN56744.1| pyrophosphate-dependent phosphofructokinase [Prevotella multisaccharivorax 
DSM 17128]
Length=549

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + KV +G  + + G  E+I KLFP  +G P    VP   G
Sbjct  4    SLLQKARAQYQPKLPKGLQSAVKVKEGEPTQSVGDQEKIKKLFPNTYGMPLIEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D    + + +G++LSGGQAPGGHNVI GIFD +++    + +YGF  GP G++   Y+ L
Sbjct  61   DKKAKNEMNVGIILSGGQAPGGHNVICGIFDAVRKMNSNNKVYGFLMGPGGLVDHNYMEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +++  YRN GGFDMI SGR K+E  DQF++  E  ++L++  +V
Sbjct  121  TEDFVDQYRNTGGFDMIGSGRTKLEKEDQFEKGLEIIRQLNIKAIV  166



>ref|WP_036897542.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. S7 MS 2]
 gb|KGI60529.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. S7 MS 2]
Length=546

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 104/167 (62%), Gaps = 5/167 (3%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVP-DDS  336
            S +Q  R  +   LP  L+ + K+ +G  + +  + EEI KLFP  +G P    +P D+ 
Sbjct  4    SALQKERAGYQPKLPKALQGAVKIKEGEPTQSVDNQEEIKKLFPNTYGMPLVEFIPGDEK  63

Query  337  GDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI  516
              + MN    +G++LSGGQAPGGHNVISG+FD ++     + LYGF  GP G++   Y+ 
Sbjct  64   NSLEMN----VGIILSGGQAPGGHNVISGLFDAVKNLNPNNRLYGFLMGPGGLVDHNYIE  119

Query  517  LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            +TPE++  YRN GGFDMI SGR K+E  +QF++  E  ++L++  +V
Sbjct  120  ITPEFLDEYRNTGGFDMIGSGRTKLEKEEQFEKGLEIIRELNIKAIV  166



>ref|WP_009229809.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 317]
 gb|EFC69384.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 317 str. F0108]
Length=546

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + KV +G  + +  + +EI KLFP  +G P    V    G
Sbjct  4    SALQKARASYQPKLPKALQGAVKVSEGAPTKSVDNQDEIKKLFPNTYGMPLVEFV---QG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D   +  + +G++LSGGQAPGGHNVISG+FD ++     + LYGF  GP G++   Y+ +
Sbjct  61   DKMPSKEINVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+ET +QF++  E  +KLD+  +V
Sbjct  121  TADFIDEYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDIKAIV  166



>ref|WP_007412056.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. MSX73]
 gb|EJP28706.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. MSX73]
Length=546

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R ++   LP  L+ + KV +G  + + G  EEI KLFP  +G P    VP   G
Sbjct  4    SRLQRERAEYRPKLPKGLQGAVKVKEGEPTQSVGDQEEIKKLFPNTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D A +  + +GV+LSGGQAPGGHNVI G+FD ++     + LYGF  GP G++   Y  L
Sbjct  61   DKANSGKMNVGVILSGGQAPGGHNVICGLFDAIKRLNPDNRLYGFLMGPGGLVDHDYKEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+E  +QF++  E  ++LD+  +V
Sbjct  121  TADIIDEYRNTGGFDMIGSGRTKLEKEEQFEKGLEVIRQLDIKAIV  166



>ref|WP_004345857.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccae]
 gb|EFU30489.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccae ATCC 33574]
Length=546

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R ++   LP  L+ + KV +G  + + G  EEI KLFP  +G P    VP   G
Sbjct  4    SRLQRERAEYRPKLPKGLQGAVKVKEGEPTQSVGDQEEIKKLFPNTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D A +  + +GV+LSGGQAPGGHNVI G+FD ++     + LYGF  GP G++   Y  L
Sbjct  61   DKANSGKMNVGVILSGGQAPGGHNVICGLFDAIKRLNPDNRLYGFLMGPGGLVDHDYKEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+E  +QF++  E  ++LD+  +V
Sbjct  121  TADIIDEYRNTGGFDMIGSGRTKLEKEEQFEKGLEVIRQLDIKAIV  166



>ref|WP_025070337.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oulorum]
Length=546

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + K+V+G  + +  + EEI  LFP  +G P    V    G
Sbjct  4    SALQKARSAYQPKLPKALQGAVKIVEGAPTQSVDNQEEIKNLFPNTYGMPLVEFV---LG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++   Y+ +
Sbjct  61   NETNQKKMNVGIILSGGQAPGGHNVISGLFDAVKKLNPENRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E+I PYRN GGFDMI SGR K+E  +QF++  +  +KLD+  +V
Sbjct  121  TSEFIDPYRNTGGFDMIGSGRTKLEKEEQFEKGLQIIRKLDISAIV  166



>ref|WP_004340656.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccae]
 gb|EFC76530.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccae D17]
Length=546

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R ++   LP  L+ + KV +G  + + G  EEI KLFP  +G P    VP   G
Sbjct  4    SRLQRERAEYRPKLPKGLQGAVKVKEGEPTQSVGDQEEIKKLFPNTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D A +  + +GV+LSGGQAPGGHNVI G+FD ++     + LYGF  GP G++   Y  L
Sbjct  61   DKANSGKMNVGVILSGGQAPGGHNVICGLFDAIKRLNPDNRLYGFLMGPGGLVDHDYKEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+E  +QF++  E  ++LD+  +V
Sbjct  121  TADIIDEYRNTGGFDMIGSGRTKLEKEEQFEKGLEVIRQLDIKAIV  166



>ref|WP_019893247.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Allobaculum 
stercoricanis]
Length=554

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 106/169 (63%), Gaps = 4/169 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLR---KSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPD  330
            S +Q +R ++   LP +LR   +   V +G A+ +    E+I  LFP  +G+P    V  
Sbjct  4    SPLQKARYEYAPKLPGMLRHGIQEISVKEGLATQSVADQEKIQALFPNTYGKPEITFVKG  63

Query  331  DSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKY  510
            D+ DV  +    +GV+LSGGQAPGGHNVISG++D L+     +TL GF+GGP+G+++  Y
Sbjct  64   DAKDVTPSKK-TVGVILSGGQAPGGHNVISGLYDALKALNPENTLLGFKGGPSGLIEDSY  122

Query  511  VILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            V  T E+I  YRN GGFD+I SGR K+ET +QF    E AKK  ++ +V
Sbjct  123  VEFTDEFIDEYRNTGGFDIIGSGRTKLETQEQFAIVAEVAKKHGMNAIV  171



>ref|WP_013758252.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
brennaborense]
 gb|AEE16544.1| diphosphate/fructose-6-phosphate 1-phosphotransferase [Treponema 
brennaborense DSM 12168]
Length=553

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLR----KSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVP  327
            S +Q +R  +   LP+VLR    ++  +  G  ++A     E+A LF   +G+P A    
Sbjct  5    SALQTARYAYQPKLPAVLRDNEPENVALEFGKPTTALADQAELASLFKHTYGKPEALF--  62

Query  328  DDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCK  507
                + A    +++GV+LSGGQAPGGHNVI+G++D +++  K S ++GF GGP+G++  +
Sbjct  63   KKGANPAAGKKIRVGVILSGGQAPGGHNVIAGLYDGIKKGNKDSVVFGFTGGPSGLIDGE  122

Query  508  YVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            YV +T  ++  YRN GGFDMI SGR KIETP+Q+  +  TAKKLDLD +V
Sbjct  123  YVEITDSFMDEYRNTGGFDMIGSGRTKIETPEQYAASVATAKKLDLDAIV  172



>ref|WP_021964522.1| phosphofructokinase [Prevotella sp. CAG:1185]
 emb|CCY80832.1| phosphofructokinase [Prevotella sp. CAG:1185]
Length=546

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R++    LP+ L+ S KV +G  + +    E+I KLFP  +G P     P +  
Sbjct  4    SVLQKARIEFAPKLPTSLQGSVKVKEGAPTQSVDDQEDIKKLFPNTYGMPVVEFEPSNE-  62

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
              A N  + +GV+LSGGQAPGGHNVI+G+FD ++     + LYGF  GP G++  KY  +
Sbjct  63   --AQNCEMNVGVILSGGQAPGGHNVITGLFDTIKRLNPNNKLYGFILGPGGLVDHKYKEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+E  DQF++  E  ++L++  LV
Sbjct  121  TEDFINEYRNTGGFDMIGSGRTKLEKVDQFEKGLEIIRELNIKALV  166



>gb|KJF43929.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Draconibacterium 
sp. JN14CK-3]
Length=550

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 103/167 (62%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+V+G  + +    +EIA+LFP  +G P   L+  ++ 
Sbjct  4    SALQKERAKYQPKLPKSLKGNVKLVEGAKTESVADQKEIAELFPNTYGMP---LITFEAA  60

Query  340  DVAMNHN-LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI  516
            D A     + +GV+LSGGQAPGGHNVISGIFD ++     S LYGF GGP G++  KY+ 
Sbjct  61   DAAAEKQPVNVGVILSGGQAPGGHNVISGIFDGIKNIHPDSKLYGFLGGPGGLVDHKYME  120

Query  517  LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            LT + I  YRN GGFD+I SGR K+E   QF +  E AK L L+ LV
Sbjct  121  LTADIIDEYRNTGGFDIIGSGRTKLEEEAQFDKGLEIAKDLSLNALV  167



>ref|WP_009036817.1| diphosphate-fructose-6-phosphate 1-phosphotransferase, partial 
[Bacteroides sp. D20]
 gb|EFA21231.1| putative diphosphate--fructose-6-phosphate 1-phosphotransferase, 
partial [Bacteroides sp. D20]
Length=311

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 104/167 (62%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + K  +G A+ +    EEI KLFP  +G P   L+  ++ 
Sbjct  4    SALQIARAAYQPKLPKALKGTVKAAEGAATQSVADQEEIKKLFPNTYGMP---LIKFETT  60

Query  340  DVAMNH-NLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI  516
            D  +N   + +GV+LSGGQAPGGHNVISGIFD +++  K S LYGF  GP G++   Y+ 
Sbjct  61   DEVVNFPAMNVGVILSGGQAPGGHNVISGIFDGIKKLNKDSKLYGFILGPGGLVDHNYME  120

Query  517  LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            LT + I  YRN GGFD+I SGR K+E  +QF++  E  K+L +  LV
Sbjct  121  LTADIIDEYRNTGGFDIIGSGRTKLEKEEQFEKGYEILKELGIKALV  167



>ref|WP_036650726.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis]
 gb|KDS37338.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis str. 3776 D15 i]
 gb|KDS73592.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis str. 3776 D15 iv]
Length=547

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   +P+ L+ + K VDG  + +    EEI KLFP  +G P      + S 
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTQSVADQEEIKKLFPNTYGMPIVTF--EKSN  61

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVI+G+FD ++ H   S LYGF  GP G++  KY+ L
Sbjct  62   EEKAMPVMNVGVILSGGQAPGGHNVIAGLFDGIKAHNADSRLYGFILGPGGLIDHKYMEL  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+ET +QF +  +  K+LD+  LV
Sbjct  122  TADIIDEYRNTGGFDMIGSGRTKLETTEQFDKGLQILKELDIKALV  167



>ref|WP_009123978.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fluxus]
 gb|EGF58971.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fluxus YIT 12057]
Length=548

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 106/167 (63%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + K  +G A+ +  + EEI KLFP  +G P   L+  ++ 
Sbjct  4    SALQIARAAYQPKLPKALKGTVKAAEGAATQSVANQEEIKKLFPNTYGMP---LIKFETT  60

Query  340  DVAMNH-NLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI  516
            D A N   + +GV+LSGGQAPGGHNVISGIFD +++  K S LYGF  GP G++   Y+ 
Sbjct  61   DEAANFPAMNVGVILSGGQAPGGHNVISGIFDGIKKLNKDSKLYGFILGPGGLVDHNYME  120

Query  517  LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            LT + I  YRN GGFD+I SGR K+E  +QF++  E  K+L++  LV
Sbjct  121  LTADIIDEYRNTGGFDIIGSGRTKLEKEEQFEKGYEILKELNIKALV  167



>ref|WP_005798671.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis]
 gb|EIK36756.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis CL07T00C01]
 gb|EIY90906.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis CL07T12C05]
 gb|EXY45774.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3783N1-2]
 gb|EXY50547.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3783N2-1]
 gb|EXY55362.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3976T7]
 gb|EXZ77796.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3-F-2 #6]
 gb|EYA60988.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. A7 (UDC12-2)]
 gb|EYB08883.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3783N1-6]
 gb|EYB18106.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. I1345]
Length=547

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ S K V+G A+ +    E I KLFP  +G P   L+  + G
Sbjct  4    SALQIARAAYQPKLPKALKGSVKAVEGAATQSVADQEAIQKLFPNTYGMP---LIKFEEG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP G++   Y+ L
Sbjct  61   EAIQLPTMNVGVILSGGQAPGGHNVISGLFDGIKTLNKDNKLYGFILGPGGLVDHNYMEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFD+I SGR K+ETP+QF++  E   KL +  LV
Sbjct  121  TADIIDEYRNTGGFDIIGSGRTKLETPEQFEKGLEIINKLGIKALV  166



>ref|WP_036613717.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis]
 gb|KDS49395.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis str. 3776 Po2 i]
Length=547

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   +P+ L+ + K VDG  + +    EEI KLFP  +G P      + S 
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTQSVADQEEIKKLFPNTYGMPIVTF--EKSN  61

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVI+G+FD ++ H   S LYGF  GP G++  KY+ L
Sbjct  62   EEKAMPVMNVGVILSGGQAPGGHNVIAGLFDGIKAHNADSRLYGFILGPGGLIDHKYMEL  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+ET +QF +  +  K+LD+  LV
Sbjct  122  TADIIDEYRNTGGFDMIGSGRTKLETTEQFDKGLQILKELDIKALV  167



>ref|WP_008771783.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 2_1_33B]
 gb|EEY84374.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 2_1_33B]
Length=547

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   +P+ L+ + K VDG  + +    EEI KLFP  +G P      + S 
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTQSVADQEEIKKLFPNTYGMPIVTF--EKSN  61

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVI+G+FD ++ H   S LYGF  GP G++  KY+ L
Sbjct  62   EEKAMPVMNVGVILSGGQAPGGHNVIAGLFDGIKAHNADSRLYGFILGPGGLIDHKYMEL  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+ET +QF +  +  K+LD+  LV
Sbjct  122  TADIIDEYRNTGGFDMIGSGRTKLETTEQFDKGLQILKELDIKALV  167



>ref|WP_005855923.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroidales]
 gb|ABR43274.1| phosphofructokinase [Parabacteroides distasonis ATCC 8503]
 gb|EEU51263.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
sp. D13]
 gb|EFI07957.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 3_1_19]
 gb|EFK61940.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
sp. 20_3]
 gb|EKN20539.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis CL09T03C24]
 gb|EKN23414.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis CL03T12C09]
 gb|EKN27165.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
sp. D25]
 emb|CDB50523.1| phosphofructokinase [Parabacteroides sp. CAG:2]
 gb|KDS57710.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis str. 3999B T(B) 4]
 gb|KDS76245.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis str. 3999B T(B) 6]
 gb|KEJ86135.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
sp. 31_2]
Length=547

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   +P+ L+ + K VDG  + +    EEI KLFP  +G P      + S 
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTQSVADQEEIKKLFPNTYGMPIVTF--EKSN  61

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVI+G+FD ++ H   S LYGF  GP G++  KY+ L
Sbjct  62   EEKAMPVMNVGVILSGGQAPGGHNVIAGLFDGIKAHNADSRLYGFILGPGGLIDHKYMEL  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+ET +QF +  +  K+LD+  LV
Sbjct  122  TADIIDEYRNTGGFDMIGSGRTKLETKEQFDKGLQILKELDIKALV  167



>ref|WP_014223699.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
forsythia]
 gb|AEW22109.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
forsythia ATCC 43037]
Length=548

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   +P+ LR + K VDG  + +  + EEI KLFP  +G P      + S 
Sbjct  4    SALQIERAHYVPKMPTALRGAVKAVDGEYTESVANQEEIKKLFPNTYGMPVVTF--EKSN  61

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVI+G+FD L+   K S LYGF  GP G+++ KY+ L
Sbjct  62   EKKAMPPINVGVILSGGQAPGGHNVIAGLFDGLKSGNKDSRLYGFILGPGGLIEHKYMEL  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T   I  YRN GGFDMI SGR K+E  +QF +  E  KKL++  LV
Sbjct  122  TAGIIDEYRNTGGFDMIGSGRTKLEQKEQFDKGLEILKKLNIKALV  167



>ref|WP_025798196.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica]
Length=546

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 105/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + K+ +G  + +  + E+I KLFP  +G P    V    G
Sbjct  4    SALQKARASYQPKLPKALQGAVKIAEGAPTQSVDNQEDIKKLFPNTYGMPLIEFV---QG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++  KY+ +
Sbjct  61   NEIPAKAINVGIILSGGQAPGGHNVISGLFDEVKKLNPNNRLYGFLMGPGGLVDHKYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +++  YRN GGFDMI SGR K+ET +QF++  E  +KLD++ +V
Sbjct  121  TADFLNDYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDINAIV  166



>ref|WP_022150455.1| phosphofructokinase [Prevotella sp. CAG:1320]
 emb|CDA95884.1| phosphofructokinase [Prevotella sp. CAG:1320]
Length=546

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + KV +G  + +  + EEI KLFP  +G P    VP   G
Sbjct  4    SALQIARAAYQPKLPKALQGAVKVKEGEPTQSVDNQEEIKKLFPNTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +VA    + +GV+LSGGQAPGGHNVI G+FD +++    + LYGF  GP G++   Y+ +
Sbjct  61   EVANEKKMNVGVILSGGQAPGGHNVICGLFDTIKKLNPENRLYGFILGPGGLVDHNYMEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+E  +QF++  E  ++L++  LV
Sbjct  121  TADFIEDYRNTGGFDMIGSGRTKLEKVEQFEKGIEILRQLEISALV  166



>ref|WP_026625143.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
capnocytophagoides]
Length=548

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   +P  L  S +V +G A+ +    +E+ KLFP  +G P    V  +S 
Sbjct  4    SALQVARAAYKPKMPKALYGSVRVEEGAATQSVADQDEVKKLFPNTYGMPILKFV--ESA  61

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            + A    + +GV+LSGGQAPGGHNVI+GIFD ++   K S +YGF  GP G++  KY  L
Sbjct  62   EKANFPAMNVGVILSGGQAPGGHNVIAGIFDGIKSLNKDSKVYGFLMGPGGLVDHKYQEL  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T E I  YRN GGFD+I SGR K+ET +QF +  E  KKLD+  LV
Sbjct  122  TSEIIDEYRNTGGFDIIGSGRTKLETKEQFDKGLEILKKLDIKALV  167



>ref|WP_009161991.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica]
 gb|EKY02337.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica F0055]
Length=546

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 105/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + K+ +G  + +  + E+I KLFP  +G P    V    G
Sbjct  4    SALQKARASYQPKLPKALQGAVKIAEGAPTQSVDNQEDIKKLFPNTYGMPLIEFV---QG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +G++LSGGQAPGGHNVISG+FD +++    + LYGF  GP G++  KY+ +
Sbjct  61   NEIPAKAINVGIILSGGQAPGGHNVISGLFDEVKKLNPNNRLYGFLMGPGGLVDHKYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T +++  YRN GGFDMI SGR K+ET +QF++  E  +KLD++ +V
Sbjct  121  TADFLNDYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDINAIV  166



>ref|WP_005815165.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis]
 gb|EKA85453.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis HMW 615]
 gb|EXZ57334.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3719 A10]
Length=547

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ S K V+G A+ +    E I KLFP  +G P   L+  + G
Sbjct  4    SALQIARAAYQPKLPKALKGSVKAVEGAATQSVADQEAIQKLFPNTYGMP---LIKFEEG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP G++   Y+ L
Sbjct  61   EAIQLPAMNVGVILSGGQAPGGHNVISGLFDGIKTLNKDNKLYGFILGPGGLVDHNYMEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFD+I SGR K+ETP+QF++  E   KL +  LV
Sbjct  121  TADIIDEYRNTGGFDIIGSGRTKLETPEQFEKGLEIINKLGIKALV  166



>ref|WP_032583802.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis]
 gb|EXY64981.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3986 N(B)19]
 gb|EYA47635.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3719 T6]
Length=547

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ S K V+G A+ +    E I KLFP  +G P   L+  + G
Sbjct  4    SALQIARAAYQPKLPKALKGSVKAVEGAATQSVADQEAIQKLFPNTYGMP---LIKFEEG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP G++   Y+ L
Sbjct  61   EAIQLPAMNVGVILSGGQAPGGHNVISGLFDGIKTLNKDNKLYGFILGPGGLVDHNYMEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFD+I SGR K+ETP+QF++  E   KL +  LV
Sbjct  121  TADIIDEYRNTGGFDIIGSGRTKLETPEQFEKGLEIINKLGIKALV  166



>ref|WP_005788903.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 ref|YP_100379.1| phosphofructokinase [Bacteroides fragilis YCH46]
 dbj|BAD49845.1| phosphofructokinase [Bacteroides fragilis YCH46]
 emb|CAH08633.1| putative phosphofructokinase [Bacteroides fragilis NCTC 9343]
 gb|EES86726.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 3_2_5]
 gb|EEZ25295.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 2_1_16]
 emb|CBW23426.1| putative phosphofructokinase [Bacteroides fragilis 638R]
 gb|EGN01986.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 2_1_56FAA]
 gb|EIY45321.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis CL03T00C08]
 gb|EIY48233.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis CL03T12C07]
 gb|EIY92223.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis CL05T00C42]
 gb|EIY97359.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis CL05T12C13]
 emb|CDD43984.1| phosphofructokinase [Bacteroides fragilis CAG:47]
 gb|EXY17178.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 2-F-2 #5]
 gb|EXY21102.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 2-F-2 #7]
 gb|EXY26868.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3397 T10]
 gb|EXY35237.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 34-F-2 #13]
 gb|EXY40197.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3774 T13]
 gb|EXY59848.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3986T(B)10]
 gb|EXY69472.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3986 T(B)9]
 gb|EXY73717.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3988T(B)14]
 gb|EXY79671.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3988 T1]
 gb|EXY83765.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3996 N(B) 6]
 gb|EXY89895.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3998T(B)3]
 gb|EXY94798.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3998 T(B) 4]
 gb|EXY99771.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. DS-166]
 gb|EXZ04772.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. DS-208]
 gb|EXZ09357.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. DS-71]
 gb|EXZ13377.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. Ds-233]
 gb|EXZ18499.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. J-143-4]
 gb|EXZ23676.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S13 L11]
 gb|EXZ27855.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S36L11]
 gb|EXZ33070.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 1007-1-F #4]
 gb|EXZ38712.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 1007-1-F #7]
 gb|EXZ43766.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 2-F-2 #4]
 gb|EXZ48264.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3397 N2]
 gb|EXZ53020.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3397 T14]
 gb|EXZ62826.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3725 D9(v)]
 gb|EXZ72585.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3976T8]
 gb|EXZ82514.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. B1 (UDC16-1)]
 gb|EXZ88253.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. J38-1]
 gb|EXZ93744.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. Korea 419]
 gb|EXZ99634.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S23 R14]
 gb|EYA03937.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S6L3]
 gb|EYA08665.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S6R6]
 gb|EYA14476.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 1007-1-F #10]
 gb|EYA18515.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 1007-1-F #3]
 gb|EYA24096.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 1007-1-F #9]
 gb|EYA29643.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 1009-4-F #10]
 gb|EYA33304.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 1009-4-F #7]
 gb|EYA37967.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 20793-3]
 gb|EYA42923.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3397 N3]
 gb|EYA51917.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3986 N(B)22]
 gb|EYA56420.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3986 T(B)13]
 gb|EYA65525.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S23L24]
 gb|EYA70541.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S24L15]
 gb|EYA75060.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S24L26]
 gb|EYA79689.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S24L34]
 gb|EYA84504.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S36L12]
 gb|EYA90038.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S36L5]
 gb|EYA94992.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S38L5]
 gb|EYA99541.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S6L8]
 gb|EYB04177.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S6R5]
 gb|EYB13952.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S38L3]
 gb|EYE43487.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S23L17]
 gb|EYE46435.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S6L5]
 gb|EYE51708.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. S6R8]
 gb|EYE52644.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 1007-1-F #5]
 gb|EYE62875.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 1007-1-F #6]
 gb|EYE67086.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3986 N3]
 gb|KER49394.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis]
Length=547

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ S K V+G A+ +    E I KLFP  +G P   L+  + G
Sbjct  4    SALQIARAAYQPKLPKALKGSVKAVEGAATQSVADQEAIQKLFPNTYGMP---LIKFEEG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP G++   Y+ L
Sbjct  61   EAIQLPAMNVGVILSGGQAPGGHNVISGLFDGIKTLNKDNKLYGFILGPGGLVDHNYMEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFD+I SGR K+ETP+QF++  E   KL +  LV
Sbjct  121  TADIIDEYRNTGGFDIIGSGRTKLETPEQFEKGLEIINKLGIKALV  166



>ref|WP_007658653.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Parabacteroides]
 gb|EKN07938.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
goldsteinii CL02T12C30]
 gb|EMZ30988.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
sp. ASF519]
 gb|EOS17848.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
goldsteinii dnLKV18]
Length=548

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   +P+ L+ + K VDG  + +    E+I KLFP  +G P      + S 
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTESVADQEDIKKLFPNTYGMPIVTF--EKSN  61

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVI+GIFD ++   K S LYGF  GP G++  KY+ L
Sbjct  62   EKKEMPAINVGVILSGGQAPGGHNVIAGIFDGVKATNKDSRLYGFILGPGGLIDHKYMEL  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+ET +QF +  E  K+LD+  LV
Sbjct  122  TADIIDEYRNTGGFDMIGSGRTKLETKEQFDKGLEILKELDIKALV  167



>ref|WP_032590268.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis]
 gb|EXY12435.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 1007-1-F #8]
Length=547

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ S K V+G A+ +    E I KLFP  +G P   L+  + G
Sbjct  4    SALQIARAAYQPKLPKALKGSVKAVEGAATQSVADQEAIQKLFPNTYGMP---LIKFEEG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP G++   Y+ L
Sbjct  61   EAIQLPAMNVGVILSGGQAPGGHNVISGLFDGIKTLNKDNKLYGFILGPGGLVDHNYMEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFD+I SGR K+ETP+QF++  E   KL +  LV
Sbjct  121  TADIIDEYRNTGGFDIIGSGRTKLETPEQFEKGLEIINKLGIKALV  166



>ref|WP_005780146.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EFR54446.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis 3_1_12]
 gb|EKA80893.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis HMW 616]
 gb|EKA90702.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis HMW 610]
 emb|CCZ38818.1| phosphofructokinase [Bacteroides fragilis CAG:558]
 gb|KER51841.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis]
 gb|KER57847.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis]
 gb|KER77555.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis]
 gb|KER78758.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis]
 gb|KFX72764.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis]
Length=547

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ S K V+G A+ +    E I KLFP  +G P   L+  + G
Sbjct  4    SALQIARAAYQPKLPKALKGSVKAVEGAATQSVADQEAIQKLFPNTYGMP---LIKFEEG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP G++   Y+ L
Sbjct  61   EAIQLPAMNVGVILSGGQAPGGHNVISGLFDGIKTLNKDNKLYGFILGPGGLVDHNYMEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFD+I SGR K+ETP+QF++  E   KL +  LV
Sbjct  121  TADIIDEYRNTGGFDIIGSGRTKLETPEQFEKGLEIINKLGIKALV  166



>gb|EXZ67313.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3783N1-8]
Length=542

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 101/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  166  VQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDV  345
            +Q +R  +   LP  L+ S K V+G A+ +    E I KLFP  +G P   L+  + G+ 
Sbjct  1    MQIARAAYQPKLPKALKGSVKAVEGAATQSVADQEAIQKLFPNTYGMP---LIKFEEGEA  57

Query  346  AMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTP  525
                 + +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP G++   Y+ LT 
Sbjct  58   IQLPTMNVGVILSGGQAPGGHNVISGLFDGIKTLNKDNKLYGFILGPGGLVDHNYMELTA  117

Query  526  EYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            + I  YRN GGFD+I SGR K+ETP+QF++  E   KL +  LV
Sbjct  118  DIIDEYRNTGGFDIIGSGRTKLETPEQFEKGLEIINKLGIKALV  161



>ref|WP_019188428.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus 
Prevotella conceptionensis]
Length=546

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + KV +G  + +  +  EI KLFP  +G P    V    G
Sbjct  4    SALQKARASYQPKLPKALQGAVKVSEGAPTKSVDNQGEIKKLFPNTYGMPLVEFV---QG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D   +  + +G++LSGGQAPGGHNVISG+FD ++     + LYGF  GP G++   Y+ +
Sbjct  61   DEMPSKEINVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T ++I  YRN GGFDMI SGR K+ET +QF++  E  +KLD+  +V
Sbjct  121  TADFIDEYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDIKAIV  166



>ref|WP_028727537.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
gordonii]
Length=548

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   +P+ L+ + K VDG  + +    EEI +LFP  +G P      + S 
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTQSVADQEEIKELFPNTYGMPIVTF--EKSS  61

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +      + +GV+LSGGQAPGGHNVI+GIFD ++   K S LYGF  GP G++  KY+ L
Sbjct  62   EKKDMPAINVGVILSGGQAPGGHNVIAGIFDGVKATNKDSRLYGFILGPGGLIDHKYMEL  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+ET +QF +  E  K+LD+  LV
Sbjct  122  TADIIDEYRNTGGFDMIGSGRTKLETKEQFDKGLEILKELDIKALV  167



>ref|WP_004350381.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccalis]
 gb|EFA91285.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccalis ATCC 35310]
Length=546

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q  R  +   LP  L+ + K+ +G  + +    +EI KLFP  +G P    VP   G
Sbjct  4    SALQKERASYQPKLPKALQGAVKIKEGAPTESVDDQDEIKKLFPHTYGMPLVEFVP---G  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            D   +  + +GV+LSGGQAPGGHNVISG+FD +++  + + LYGF  GP G++   Y+ +
Sbjct  61   DKCEHKLMNVGVILSGGQAPGGHNVISGLFDAVKKLNEENHLYGFLMGPGGLVDHNYIEI  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T  ++  YRN GGFDMI SGR K+E  DQF++  E  ++LD+  LV
Sbjct  121  TAGFLEKYRNTGGFDMIGSGRTKLEKEDQFEKGLEVIRELDIKALV  166



>ref|WP_036787718.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Phocaeicola 
abscessus]
Length=548

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + KV +  A+ A    EEI  LFP  +G P    V    G
Sbjct  4    SALQMARAAYQPKLPKALQGAVKVREEEATQAVADREEIKSLFPNTYGMPLIRFV---EG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +   +    +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP+G+++ +Y  L
Sbjct  61   EKRESPTFNVGVILSGGQAPGGHNVISGLFDGIKRLNKDNRLYGFLMGPSGLIEHRYTEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+ET DQF+   +  +KLD+  +V
Sbjct  121  TADIIDDYRNTGGFDMIGSGRTKLETEDQFESGLKIIRKLDIQAIV  166



>ref|WP_006798230.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
gadei]
 gb|EGK03145.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
gadei ATCC BAA-286]
Length=548

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 103/168 (61%), Gaps = 2/168 (1%)
 Frame = +1

Query  154  VYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDD  333
            V S +Q +R  +   +P  L  S K+ +G A+ +    EE+ KLFP  +G P+   V  +
Sbjct  2    VKSALQVARAAYKPKMPKALYGSVKIEEGAATQSVADQEEVKKLFPNTYGMPTLKFV--E  59

Query  334  SGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYV  513
            + + A    + +GV+LSGGQAPGGHNVI+G+FD ++    GS LYGF  GP G++   Y 
Sbjct  60   ASEKANYPAINVGVILSGGQAPGGHNVIAGLFDGIKNLNSGSRLYGFLMGPGGLVDHDYK  119

Query  514  ILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
             LT E I  YRN GGFD+I SGR K+E+ +QF +  E  KKLD+  LV
Sbjct  120  ELTGEIIDEYRNTGGFDIIGSGRTKLESKEQFDKGLEILKKLDIKALV  167



>ref|WP_035455514.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroidetes 
bacterium oral taxon 272]
Length=548

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + KV +  A+ A    EEI  LFP  +G P    V    G
Sbjct  4    SALQMARAAYQPKLPKALQGAVKVREEEATQAVADREEIKSLFPNTYGMPLIRFV---EG  60

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +   +    +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP+G+++ +Y  L
Sbjct  61   EKRESPTFNVGVILSGGQAPGGHNVISGLFDGIKRLNKDNRLYGFLMGPSGLIEHRYTEL  120

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+ET DQF+   +  +KLD+  +V
Sbjct  121  TADIIDDYRNTGGFDMIGSGRTKLETEDQFESGLKIIRKLDIQAIV  166



>ref|WP_036877364.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oryzae]
Length=546

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 107/167 (64%), Gaps = 5/167 (3%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVP-DDS  336
            S +Q +R  +   LP  L+ + KV +G  + +  + EEI KLFP  +G P    VP +++
Sbjct  4    SALQKARAAYQPKLPKALQGAVKVKEGAPTKSVDNQEEIKKLFPNTYGMPLVEFVPGEET  63

Query  337  GDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI  516
               AMN    +GV+LSGGQAPGGHNVISG+FD +++    + L+GF  GP G++  KYV 
Sbjct  64   AQKAMN----VGVILSGGQAPGGHNVISGLFDEIKKLNSNNRLFGFLMGPGGLVDHKYVE  119

Query  517  LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            +T +++  YRN GGFD+I SGR K+E  +QF++  +  ++LD+  ++
Sbjct  120  ITEDFLADYRNTGGFDIIGSGRTKLEKEEQFEKGLQIIRELDIKAII  166



>gb|EPT34726.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroidetes 
bacterium oral taxon 272 str. F0290]
Length=549

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  160  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG  339
            S +Q +R  +   LP  L+ + KV +  A+ A    EEI  LFP  +G P    V    G
Sbjct  5    SALQMARAAYQPKLPKALQGAVKVREEEATQAVADREEIKSLFPNTYGMPLIRFV---EG  61

Query  340  DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL  519
            +   +    +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP+G+++ +Y  L
Sbjct  62   EKRESPTFNVGVILSGGQAPGGHNVISGLFDGIKRLNKDNRLYGFLMGPSGLIEHRYTEL  121

Query  520  TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV  657
            T + I  YRN GGFDMI SGR K+ET DQF+   +  +KLD+  +V
Sbjct  122  TADIIDDYRNTGGFDMIGSGRTKLETEDQFESGLKIIRKLDIQAIV  167



Lambda      K        H        a         alpha
   0.317    0.137    0.407    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320