BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF025B11

Length=652
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                285   1e-92   Nicotiana sylvestris
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                281   8e-91   Nicotiana tomentosiformis
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                281   8e-91   Solanum lycopersicum
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           279   4e-90   Nicotiana tomentosiformis
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           278   9e-90   Nicotiana sylvestris
ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           276   3e-89   Solanum tuberosum [potatoes]
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           276   7e-89   Nicotiana tomentosiformis
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           275   1e-88   Nicotiana sylvestris
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           275   2e-88   Solanum tuberosum [potatoes]
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                274   4e-88   Pyrus x bretschneideri [bai li]
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            272   6e-88   
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                273   8e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         271   3e-87   Pyrus x bretschneideri [bai li]
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           271   3e-87   
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         271   3e-87   Malus domestica [apple tree]
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                271   4e-87   Solanum lycopersicum
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                271   4e-87   Prunus mume [ume]
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         271   5e-87   Pyrus x bretschneideri [bai li]
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                271   8e-87   Malus domestica [apple tree]
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     270   1e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           271   1e-86   Glycine max [soybeans]
ref|NP_001274803.1|  uncharacterized protein LOC102577675               270   1e-86   Solanum tuberosum [potatoes]
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           270   1e-86   
ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           270   1e-86   
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           270   2e-86   
ref|XP_006447906.1|  hypothetical protein CICLE_v10016107mg             266   2e-86   
ref|XP_006447904.1|  hypothetical protein CICLE_v10016107mg             268   2e-86   
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                269   3e-86   
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             269   3e-86   Phaseolus vulgaris [French bean]
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    269   3e-86   Glycine max [soybeans]
emb|CBI24704.3|  unnamed protein product                                270   4e-86   Vitis vinifera
gb|AHA84189.1|  60S ribosomal protein L5                                269   4e-86   Phaseolus vulgaris [French bean]
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             269   4e-86   Phaseolus vulgaris [French bean]
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    269   5e-86   Elaeis guineensis
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   268   5e-86   Phaseolus vulgaris [French bean]
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                268   7e-86   Fragaria vesca subsp. vesca
gb|KDO51034.1|  hypothetical protein CISIN_1g022424mg                   265   7e-86   Citrus sinensis [apfelsine]
gb|KHN15970.1|  60S ribosomal protein L5                                268   7e-86   Glycine soja [wild soybean]
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           268   8e-86   Sesamum indicum [beniseed]
gb|KHN36792.1|  60S ribosomal protein L5                                268   1e-85   Glycine soja [wild soybean]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           268   1e-85   Glycine max [soybeans]
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           268   1e-85   Glycine max [soybeans]
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     268   1e-85   
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             267   1e-85   Citrus clementina [clementine]
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         267   1e-85   Prunus mume [ume]
gb|ADR71225.1|  60S ribosomal protein L5A                               267   2e-85   Hevea brasiliensis [jebe]
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           267   2e-85   Nelumbo nucifera [Indian lotus]
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             267   2e-85   Prunus persica
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           267   2e-85   Glycine max [soybeans]
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           267   2e-85   Phoenix dactylifera
gb|KJB71615.1|  hypothetical protein B456_011G133700                    265   4e-85   Gossypium raimondii
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           266   4e-85   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK34395.1|  unknown                                                 266   4e-85   Lotus japonicus
ref|XP_002524859.1|  ribosomal protein L5, putative                     266   4e-85   Ricinus communis
gb|AFK36106.1|  unknown                                                 266   5e-85   Lotus japonicus
gb|AFK46994.1|  unknown                                                 266   5e-85   Lotus japonicus
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    266   5e-85   
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           266   5e-85   Cicer arietinum [garbanzo]
gb|KJB71614.1|  hypothetical protein B456_011G133700                    266   6e-85   Gossypium raimondii
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           266   6e-85   Fragaria vesca subsp. vesca
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           266   6e-85   Citrus sinensis [apfelsine]
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             266   7e-85   Phaseolus vulgaris [French bean]
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   265   7e-85   Citrus sinensis [apfelsine]
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   265   7e-85   Citrus sinensis [apfelsine]
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                265   8e-85   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  264   9e-85   Citrus sinensis [apfelsine]
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    266   9e-85   
gb|ADR71226.1|  60S ribosomal protein L5B                               265   1e-84   Hevea brasiliensis [jebe]
gb|ACU23594.1|  unknown                                                 265   2e-84   Glycine max [soybeans]
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  265   2e-84   Citrus sinensis [apfelsine]
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           264   2e-84   Citrus sinensis [apfelsine]
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                265   2e-84   Sesamum indicum [beniseed]
emb|CDP17898.1|  unnamed protein product                                266   2e-84   Coffea canephora [robusta coffee]
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                264   2e-84   Eucalyptus grandis [rose gum]
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              264   3e-84   Tarenaya hassleriana [spider flower]
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           264   3e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           264   3e-84   Populus euphratica
gb|ABK95722.1|  unknown                                                 264   4e-84   Populus trichocarpa [western balsam poplar]
gb|ABK93902.1|  unknown                                                 263   4e-84   Populus trichocarpa [western balsam poplar]
ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           264   4e-84   Sesamum indicum [beniseed]
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                263   5e-84   Cucumis melo [Oriental melon]
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                263   5e-84   Vitis vinifera
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             263   5e-84   Populus trichocarpa [western balsam poplar]
gb|KDP35145.1|  hypothetical protein JCGZ_10679                         263   7e-84   Jatropha curcas
gb|KJB84072.1|  hypothetical protein B456_N001600                       263   8e-84   Gossypium raimondii
gb|ACJ85054.1|  unknown                                                 263   8e-84   Medicago truncatula
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             266   8e-84   
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           263   9e-84   Cucumis melo [Oriental melon]
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           263   1e-83   Tarenaya hassleriana [spider flower]
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                262   1e-83   Populus euphratica
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   262   2e-83   
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           262   2e-83   Phoenix dactylifera
gb|KJB22671.1|  hypothetical protein B456_004G060400                    259   2e-83   Gossypium raimondii
gb|KJB22672.1|  hypothetical protein B456_004G060400                    259   2e-83   Gossypium raimondii
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           262   2e-83   Cucumis sativus [cucumbers]
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   263   3e-83   
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          261   3e-83   
gb|AFK41086.1|  unknown                                                 261   4e-83   Medicago truncatula
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   261   4e-83   Phaseolus vulgaris [French bean]
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         261   5e-83   Tarenaya hassleriana [spider flower]
gb|KJB22668.1|  hypothetical protein B456_004G060400                    260   7e-83   Gossypium raimondii
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          260   8e-83   Sorghum bicolor [broomcorn]
emb|CDP18434.1|  unnamed protein product                                261   8e-83   Coffea canephora [robusta coffee]
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         260   9e-83   Tarenaya hassleriana [spider flower]
gb|AFW84310.1|  hypothetical protein ZEAMMB73_937605                    258   9e-83   
gb|ABK93596.1|  unknown                                                 260   9e-83   Populus trichocarpa [western balsam poplar]
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             260   9e-83   Populus trichocarpa [western balsam poplar]
ref|NP_001267659.1|  60S ribosomal protein L5                           260   1e-82   Cucumis sativus [cucumbers]
ref|XP_002524558.1|  ribosomal protein L5, putative                     259   1e-82   Ricinus communis
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    259   2e-82   Phoenix dactylifera
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   259   2e-82   
gb|KJB27798.1|  hypothetical protein B456_005G010200                    259   2e-82   Gossypium raimondii
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         259   2e-82   Tarenaya hassleriana [spider flower]
gb|KJB27799.1|  hypothetical protein B456_005G010200                    259   2e-82   Gossypium raimondii
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           259   2e-82   Populus euphratica
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           259   3e-82   Cicer arietinum [garbanzo]
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     259   3e-82   Eucalyptus grandis [rose gum]
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    258   4e-82   
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         257   4e-82   Camelina sativa [gold-of-pleasure]
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     258   4e-82   Eucalyptus grandis [rose gum]
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     260   5e-82   Eucalyptus grandis [rose gum]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         258   7e-82   Setaria italica
gb|KJB10809.1|  hypothetical protein B456_001G226000                    255   7e-82   Gossypium raimondii
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         258   7e-82   Zea mays [maize]
gb|ACR38045.1|  unknown                                                 258   8e-82   Zea mays [maize]
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   258   8e-82   
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           260   9e-82   
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         258   9e-82   Brachypodium distachyon [annual false brome]
gb|EPS64989.1|  hypothetical protein M569_09790                         254   1e-81   Genlisea aurea
gb|KHN27258.1|  60S ribosomal protein L5                                258   1e-81   Glycine soja [wild soybean]
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                257   1e-81   Erythranthe guttata [common monkey flower]
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         257   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    257   2e-81   
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              256   3e-81   Zea mays [maize]
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         256   4e-81   Brassica rapa
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         256   4e-81   Brachypodium distachyon [annual false brome]
gb|AFK39593.1|  unknown                                                 256   4e-81   Lotus japonicus
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              256   4e-81   
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              256   4e-81   Brachypodium distachyon [annual false brome]
ref|NP_001151284.1|  60S ribosomal protein L5-1                         256   4e-81   Zea mays [maize]
ref|NP_198790.1|  60S ribosomal protein L5-2                            256   4e-81   Arabidopsis thaliana [mouse-ear cress]
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               256   5e-81   Erythranthe guttata [common monkey flower]
gb|KJB10810.1|  hypothetical protein B456_001G226000                    256   5e-81   Gossypium raimondii
emb|CDY52294.1|  BnaA03g57870D                                          257   5e-81   Brassica napus [oilseed rape]
dbj|BAJ89012.1|  predicted protein                                      256   5e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    256   5e-81   Camelina sativa [gold-of-pleasure]
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             256   5e-81   Eutrema salsugineum [saltwater cress]
gb|AEV92989.1|  60S ribosomal protein L5                                256   6e-81   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             256   6e-81   
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             255   7e-81   Arabidopsis lyrata subsp. lyrata
gb|AAM64753.1|  ribosomal protein, putative                             255   8e-81   Arabidopsis thaliana [mouse-ear cress]
gb|ACG36552.1|  60S ribosomal protein L5-1                              255   8e-81   Zea mays [maize]
gb|KDP45189.1|  hypothetical protein JCGZ_15054                         255   8e-81   Jatropha curcas
ref|NP_566767.1|  60S ribosomal protein L5-1                            255   9e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    255   1e-80   Arabis alpina [alpine rockcress]
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           255   1e-80   Nelumbo nucifera [Indian lotus]
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    255   1e-80   Arabis alpina [alpine rockcress]
emb|CDY15088.1|  BnaC03g44490D                                          254   3e-80   Brassica napus [oilseed rape]
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             253   4e-80   Capsella rubella
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             253   4e-80   Capsella rubella
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         253   4e-80   
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         253   5e-80   Brassica rapa
emb|CDY50258.1|  BnaC07g47930D                                          253   6e-80   Brassica napus [oilseed rape]
emb|CDY27889.1|  BnaA07g04790D                                          253   6e-80   Brassica napus [oilseed rape]
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         253   7e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         253   7e-80   Camelina sativa [gold-of-pleasure]
emb|CDY15089.1|  BnaC03g44500D                                          253   8e-80   Brassica napus [oilseed rape]
gb|AFK41626.1|  unknown                                                 249   8e-80   Lotus japonicus
emb|CDY52293.1|  BnaA03g57860D                                          253   8e-80   Brassica napus [oilseed rape]
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    253   9e-80   Brassica rapa
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             251   2e-79   Capsella rubella
gb|KJB84073.1|  hypothetical protein B456_N001600                       251   2e-79   Gossypium raimondii
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         251   3e-79   Camelina sativa [gold-of-pleasure]
emb|CDX86312.1|  BnaA06g30290D                                          251   3e-79   
gb|ABK21084.1|  unknown                                                 250   7e-79   Picea sitchensis
dbj|BAD82173.1|  putative ribosomal protein L5                          250   1e-78   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045083.1|  Os01g0896800                                       249   1e-78   
gb|KJB22669.1|  hypothetical protein B456_004G060400                    249   2e-78   Gossypium raimondii
gb|EPS61271.1|  hypothetical protein M569_13526                         247   2e-78   Genlisea aurea
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        249   2e-78   Oryza sativa Indica Group [Indian rice]
gb|KDO51035.1|  hypothetical protein CISIN_1g022424mg                   247   2e-78   Citrus sinensis [apfelsine]
ref|XP_006858792.1|  hypothetical protein AMTR_s00066p00162800          249   3e-78   
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             248   4e-78   
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         248   4e-78   Oryza brachyantha
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           249   5e-78   Elaeis guineensis
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    248   6e-78   Oryza brachyantha
ref|XP_010101365.1|  60S ribosomal protein L5                           248   7e-78   
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    248   7e-78   
ref|XP_002876523.1|  predicted protein                                  247   1e-77   Arabidopsis lyrata subsp. lyrata
emb|CDX85331.1|  BnaC07g26420D                                          250   1e-77   
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    247   1e-77   
gb|KJB22673.1|  hypothetical protein B456_004G060400                    243   1e-77   Gossypium raimondii
gb|KJB22670.1|  hypothetical protein B456_004G060400                    242   2e-77   Gossypium raimondii
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             246   4e-77   Eutrema salsugineum [saltwater cress]
gb|AES74307.2|  60S ribosomal protein L5-2                              244   1e-76   Medicago truncatula
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                244   1e-76   Elaeis guineensis
gb|EMT04099.1|  60S ribosomal protein L5-2                              244   1e-76   
ref|XP_003604056.1|  60S ribosomal protein L5                           244   3e-76   
gb|EMT23062.1|  60S ribosomal protein L5-2                              242   1e-75   
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                241   2e-75   Nelumbo nucifera [Indian lotus]
gb|EMT20601.1|  60S ribosomal protein L5-2                              241   3e-75   
ref|XP_001783620.1|  predicted protein                                  240   6e-75   
gb|EMS59984.1|  60S ribosomal protein L5-2                              240   6e-75   Triticum urartu
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        238   3e-74   
ref|XP_001767871.1|  predicted protein                                  238   4e-74   
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      238   4e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001759628.1|  predicted protein                                  237   7e-74   
ref|XP_001783411.1|  predicted protein                                  236   3e-73   
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             234   1e-72   
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             226   2e-69   Selaginella moellendorffii
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             226   2e-69   Selaginella moellendorffii
ref|XP_004310188.1|  PREDICTED: 60S ribosomal protein L5-2-like         219   2e-68   Fragaria vesca subsp. vesca
sp|Q4KTI3.1|RL5_SUBDO  RecName: Full=60S ribosomal protein L5           201   1e-59   Suberites domuncula
dbj|BAB33422.1|  putative senescence-associated protein                 198   7e-59   Pisum sativum [garden pea]
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              196   4e-58   Chlorella variabilis
sp|Q627R7.2|RL5_CAEBR  RecName: Full=60S ribosomal protein L5           196   5e-58   Caenorhabditis briggsae
ref|NP_495811.1|  Protein RPL-5                                         196   6e-58   Caenorhabditis elegans [roundworm]
gb|EGT59634.1|  hypothetical protein CAEBREN_19650                      196   6e-58   Caenorhabditis brenneri
ref|XP_002630158.1|  C. briggsae CBR-RPL-5 protein                      196   7e-58   Caenorhabditis briggsae
gb|ERG79917.1|  60s ribosomal protein l5                                195   7e-58   
ref|XP_003117386.1|  CRE-RPL-5 protein                                  194   2e-57   Caenorhabditis remanei
ref|XP_005717676.1|  unnamed protein product                            194   3e-57   Chondrus crispus [carageen]
ref|XP_005536050.1|  60S ribosomal protein L5                           194   4e-57   Cyanidioschyzon merolae strain 10D
gb|ACZ13335.1|  60S ribosomal protein L5                                194   5e-57   Bursaphelenchus xylophilus [pine wilt nematode]
ref|XP_005706768.1|  60S ribosomal protein L5e                          194   5e-57   Galdieria sulphuraria
gb|KDD76608.1|  ribosomal L18p/L5e                                      194   6e-57   Helicosporidium sp. ATCC 50920
gb|ABO26701.1|  ribosomal protein l5                                    192   9e-57   Haliotis discus discus
gb|EPZ34992.1|  60S ribosomal protein L5                                193   1e-56   Rozella allomycis CSF55
gb|KIY93440.1|  60S ribosomal protein L5                                190   1e-56   Monoraphidium neglectum
ref|XP_008049787.1|  PREDICTED: 60S ribosomal protein L5                189   2e-56   Carlito syrichta
ref|XP_005107604.1|  PREDICTED: 60S ribosomal protein L5-like           192   3e-56   Aplysia californica
ref|XP_003767272.1|  PREDICTED: 60S ribosomal protein L5                193   3e-56   
ref|XP_001689859.1|  ribosomal protein L5, component of cytosolic...    191   4e-56   Chlamydomonas reinhardtii
gb|KHJ46023.1|  ribosomal L18p/L5e family protein                       192   5e-56   Trichuris suis
tpg|DAA34076.1|  TPA: 60S ribosomal protein L5                          188   6e-56   Amblyomma variegatum
ref|XP_004171975.1|  PREDICTED: 60S ribosomal protein L5-like           189   6e-56   
gb|KDO24705.1|  hypothetical protein SPRG_10239                         191   6e-56   Saprolegnia parasitica CBS 223.65
ref|NP_001104213.1|  uncharacterized protein LOC100126642               191   6e-56   Xenopus laevis [clawed frog]
emb|CDI98331.1|  ribosomal protein l5                                   191   7e-56   Echinococcus multilocularis
gb|ACN25149.1|  ribosomal-like protein                                  190   7e-56   Pectinaria gouldii
emb|CDS19989.1|  ribosomal protein l5                                   191   7e-56   Echinococcus granulosus
ref|XP_010948703.1|  PREDICTED: 60S ribosomal protein L5                191   1e-55   Camelus bactrianus [camel]
gb|KFD48731.1|  hypothetical protein M513_10361                         192   1e-55   Trichuris suis
gb|KHG14330.1|  60S ribosomal L5                                        189   1e-55   Gossypium arboreum [tree cotton]
ref|XP_002588187.1|  hypothetical protein BRAFLDRAFT_113823             191   1e-55   Branchiostoma floridae
gb|EJW84695.1|  60S ribosomal protein L5                                190   2e-55   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|KGG50093.1|  60S ribosomal protein L5-2                              191   2e-55   Mitosporidium daphniae
ref|XP_001897856.1|  60S ribosomal protein L5                           190   2e-55   Brugia malayi [agent of lymphatic filariasis]
ref|XP_006197385.1|  PREDICTED: 60S ribosomal protein L5                190   2e-55   Vicugna pacos
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 190   2e-55   Ixodes scapularis [blacklegged tick]
gb|AGH70151.1|  60S ribosomal protein L5                                187   2e-55   Placozoa sp. H4
ref|XP_006985882.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   3e-55   Peromyscus maniculatus bairdii
gb|ABX44805.1|  putative 60S ribosomal protein RP5L                     186   3e-55   Flustra foliacea
ref|XP_007611466.1|  PREDICTED: 60S ribosomal protein L5                189   3e-55   
ref|XP_003505203.1|  PREDICTED: 60S ribosomal protein L5                189   3e-55   Cricetulus griseus [Chinese hamsters]
ref|XP_006985881.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   3e-55   Peromyscus maniculatus bairdii
gb|AAI09371.1|  Ribosomal protein L5                                    189   3e-55   Homo sapiens [man]
ref|XP_011399144.1|  60S ribosomal protein L5-1                         189   3e-55   Auxenochlorella protothecoides
ref|XP_005385096.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   3e-55   Chinchilla lanigera
ref|XP_003479207.1|  PREDICTED: 60S ribosomal protein L5                189   3e-55   Cavia porcellus [guinea pig]
ref|XP_005542773.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   3e-55   
ref|XP_005385097.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   3e-55   Chinchilla lanigera
ref|NP_001107756.1|  60S ribosomal protein L5                           189   3e-55   Sus scrofa [pigs]
ref|XP_004884144.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   3e-55   
ref|XP_007533339.1|  PREDICTED: 60S ribosomal protein L5                189   3e-55   Erinaceus europaeus [common hedgehog]
ref|NP_000960.2|  60S ribosomal protein L5                              189   3e-55   Homo sapiens [man]
ref|XP_004018480.1|  PREDICTED: 60S ribosomal protein L5-like           189   3e-55   Ovis aries [domestic sheep]
dbj|BAD96324.1|  ribosomal protein L5 variant                           189   3e-55   Homo sapiens [man]
ref|XP_006728911.1|  PREDICTED: 60S ribosomal protein L5                189   3e-55   Leptonychotes weddellii
ref|XP_005610314.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   3e-55   Equus caballus [domestic horse]
ref|XP_004625113.1|  PREDICTED: 60S ribosomal protein L5-like           189   3e-55   Octodon degus
ref|XP_001515074.2|  PREDICTED: 60S ribosomal protein L5                189   3e-55   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_010643206.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   4e-55   Fukomys damarensis [Damara mole rat]
ref|XP_004884145.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   4e-55   
ref|XP_008070593.1|  PREDICTED: 60S ribosomal protein L5                189   4e-55   Carlito syrichta
gb|EHH14955.1|  hypothetical protein EGK_00972                          189   4e-55   Macaca mulatta [rhesus macaque]
ref|XP_005983309.1|  PREDICTED: 60S ribosomal protein L5                189   4e-55   Pantholops hodgsonii [Tibetan antelope]
ref|XP_006093256.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   4e-55   Myotis lucifugus
ref|XP_004378798.1|  PREDICTED: 60S ribosomal protein L5                189   4e-55   Trichechus manatus latirostris
ref|XP_008262168.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   4e-55   
gb|ELW72620.1|  60S ribosomal protein L5                                189   4e-55   
ref|XP_004402579.1|  PREDICTED: 60S ribosomal protein L5                189   4e-55   
ref|XP_005542775.1|  PREDICTED: 60S ribosomal protein L5 isoform X3     189   4e-55   
ref|XP_010596404.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   4e-55   
ref|XP_006758248.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   4e-55   
ref|XP_005610315.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   4e-55   
ref|XP_005879039.1|  PREDICTED: 60S ribosomal protein L5                189   4e-55   
ref|XP_004319592.1|  PREDICTED: 60S ribosomal protein L5-like           189   4e-55   
pdb|4W20|D  Chain D, Structure Of The Mammalian 60s Ribosomal Sub...    189   4e-55   
ref|XP_007169652.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   4e-55   
ref|XP_003418527.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   4e-55   
ref|XP_004620003.1|  PREDICTED: 60S ribosomal protein L5                188   4e-55   
ref|XP_002751148.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   4e-55   
ref|XP_007110786.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   4e-55   
ref|XP_006140244.1|  PREDICTED: 60S ribosomal protein L5                189   4e-55   
ref|XP_007934240.1|  PREDICTED: 60S ribosomal protein L5                189   4e-55   
ref|NP_001182608.1|  60S ribosomal protein L5                           189   4e-55   
ref|XP_007169651.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   4e-55   
ref|XP_004699318.1|  PREDICTED: 60S ribosomal protein L5                189   4e-55   
ref|XP_008152973.1|  PREDICTED: 60S ribosomal protein L5                191   4e-55   
ref|XP_010643208.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   4e-55   
ref|NP_001079437.1|  60S ribosomal protein L5-B                         189   4e-55   
dbj|BAD92217.1|  ribosomal protein L5 variant                           189   5e-55   
ref|XP_007480367.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     189   5e-55   
ref|XP_007480368.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     189   5e-55   
ref|XP_008578547.1|  PREDICTED: 60S ribosomal protein L5                189   5e-55   
gb|AAX46329.1|  ribosomal protein L5                                    188   5e-55   
gb|AGM32490.1|  60S ribosomal protein L5-like protein                   188   5e-55   
sp|P15125.2|RL5A_XENLA  RecName: Full=60S ribosomal protein L5-A        189   5e-55   
gb|KFM66007.1|  60S ribosomal protein L5-A                              188   5e-55   
gb|AER57859.1|  60S ribosomal protein L5                                189   5e-55   
ref|XP_009680869.1|  PREDICTED: 60S ribosomal protein L5                189   6e-55   
sp|P15126.2|RL5B_XENLA  RecName: Full=60S ribosomal protein L5-B        188   6e-55   
ref|XP_003220130.1|  PREDICTED: 60S ribosomal protein L5                188   6e-55   
gb|KDO45956.1|  hypothetical protein CISIN_1g0225141mg                  187   6e-55   
ref|XP_005077452.1|  PREDICTED: 60S ribosomal protein L5                188   6e-55   
emb|CAD91421.1|  ribosomal protein L5                                   187   7e-55   
ref|NP_989912.1|  60S ribosomal protein L5                              188   7e-55   
ref|XP_010973953.1|  PREDICTED: 60S ribosomal protein L5                191   7e-55   
ref|XP_005153981.1|  PREDICTED: 60S ribosomal protein L5                188   7e-55   
emb|CBX33183.1|  ribosomal protein L5                                   188   7e-55   
ref|XP_009908172.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     188   7e-55   
ref|XP_001634531.1|  predicted protein                                  188   7e-55   
ref|NP_001187210.1|  ribosomal protein L5b                              188   8e-55   
ref|XP_006265613.1|  PREDICTED: 60S ribosomal protein L5                188   8e-55   
ref|XP_666127.1|  ribosomal protein L5A                                 189   8e-55   
ref|XP_011283311.1|  PREDICTED: 60S ribosomal protein L5                190   9e-55   
ref|XP_008605837.1|  50S ribosomal protein L5e                          188   9e-55   
ref|XP_001421418.1|  Ribosomal protein L5A, component of cytosoli...    188   1e-54   
ref|XP_003973919.1|  PREDICTED: 60S ribosomal protein L5-like           189   1e-54   
ref|NP_001187035.1|  ribosomal protein L5a                              188   1e-54   
gb|ADO28300.1|  60S ribosomal protein l5                                188   1e-54   
ref|XP_011442101.1|  PREDICTED: 60S ribosomal protein L5-like           188   1e-54   
gb|ETE73605.1|  60S ribosomal protein L5                                188   1e-54   
ref|XP_625505.1|  60S ribosomal protein L5                              189   1e-54   
ref|XP_004417183.1|  PREDICTED: 60S ribosomal protein L5-like           188   1e-54   
ref|XP_007437567.1|  PREDICTED: 60S ribosomal protein L5                188   1e-54   
gb|ADO29334.1|  60S ribosomal protein l5                                188   1e-54   
ref|XP_005643753.1|  60S ribosomal protein L5                           188   1e-54   
gb|ACO09827.1|  60S ribosomal protein L5                                188   1e-54   
ref|XP_008578545.1|  PREDICTED: 60S ribosomal protein L5                187   1e-54   
ref|XP_008334234.1|  PREDICTED: 60S ribosomal protein L5                188   1e-54   
sp|Q26481.3|RL5_STYCL  RecName: Full=60S ribosomal protein L5           187   1e-54   
ref|XP_007073490.1|  PREDICTED: 60S ribosomal protein L5-like           191   1e-54   
gb|ACD65111.1|  putative 60S ribosomal protein RPL5                     184   1e-54   
ref|NP_001270867.1|  60S ribosomal protein L5                           187   1e-54   
ref|NP_112361.1|  60S ribosomal protein L5                              187   2e-54   
ref|XP_006001656.1|  PREDICTED: 60S ribosomal protein L5                187   2e-54   
ref|NP_001279040.1|  ribosomal protein L5                               187   2e-54   
ref|XP_006250647.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   2e-54   
gb|AFM87418.1|  60S ribosomal protein L5-B                              187   2e-54   
ref|XP_002736904.1|  PREDICTED: 60S ribosomal protein L5-like           187   2e-54   
ref|XP_009939484.1|  PREDICTED: 60S ribosomal protein L5                189   2e-54   
ref|XP_007233671.1|  PREDICTED: 60S ribosomal protein L5-like           187   2e-54   
gb|AFM87698.1|  60S ribosomal protein L5-A                              187   2e-54   
gb|KJB84074.1|  hypothetical protein B456_N001600                       186   2e-54   
ref|XP_005346907.1|  PREDICTED: 60S ribosomal protein L5-like           187   2e-54   
ref|XP_005781727.1|  hypothetical protein EMIHUDRAFT_434648             187   2e-54   
gb|ACO07680.1|  60S ribosomal protein L5                                187   2e-54   
gb|ACH70882.1|  Ribosomal protein L5b                                   187   2e-54   
ref|XP_005298201.1|  PREDICTED: 60S ribosomal protein L5                187   2e-54   
ref|XP_010339421.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    187   2e-54   
pdb|2ZKR|NN  Chain n, Structure Of A Mammalian Ribosomal 60s Subu...    187   2e-54   
ref|NP_001291805.1|  ribosomal protein L5                               187   2e-54   
gb|EPY76441.1|  60S ribosomal protein L5                                187   2e-54   
ref|NP_001079377.1|  60S ribosomal protein L5-A                         187   2e-54   
ref|XP_004752780.1|  PREDICTED: 60S ribosomal protein L5                190   2e-54   
gb|EYB99479.1|  hypothetical protein Y032_0122g1070                     187   3e-54   
ref|XP_005592505.1|  PREDICTED: 60S ribosomal protein L5-like           187   3e-54   
ref|XP_007058944.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     187   3e-54   
gb|ACD65156.1|  putative 60S ribosomal protein RPL5                     185   3e-54   
ref|XP_010646096.1|  PREDICTED: 60S ribosomal protein L5-like           186   3e-54   
ref|XP_009273931.1|  PREDICTED: 60S ribosomal protein L5                187   3e-54   
emb|CAG05644.1|  unnamed protein product                                186   3e-54   
ref|XP_002675028.1|  predicted protein                                  187   3e-54   
ref|XP_004349238.1|  ribosomal protein L5                               187   4e-54   
ref|XP_006093255.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     187   4e-54   
gb|KGO46596.1|  Ribosomal protein L5 eukaryotic/L18 archaeal, C-t...    187   4e-54   
ref|XP_002559574.1|  Pc13g11570                                         187   4e-54   
gb|AFM88682.1|  ribosomal protein L5                                    186   4e-54   
dbj|BAF98650.1|  ribosomal protein L5                                   186   4e-54   
gb|AFW84312.1|  hypothetical protein ZEAMMB73_937605                    149   4e-54   
gb|ELR57120.1|  60S ribosomal protein L5                                186   4e-54   
gb|ETN75275.1|  ribosomal L18p/L5e family protein                       187   4e-54   
ref|XP_008628716.1|  PREDICTED: 60S ribosomal protein L5                187   4e-54   
ref|XP_006882544.1|  PREDICTED: 60S ribosomal protein L5                186   4e-54   
ref|XP_003743796.1|  PREDICTED: 60S ribosomal protein L5-like           186   4e-54   
ref|NP_001232619.1|  putative ribosomal protein L5                      186   5e-54   
ref|XP_007641146.1|  PREDICTED: 60S ribosomal protein L5                186   5e-54   
ref|XP_005521032.1|  PREDICTED: 60S ribosomal protein L5                186   5e-54   
gb|KFV85217.1|  60S ribosomal protein L5                                186   5e-54   
emb|CDW60565.1|  Ribosomal L18p and Ribosomal L18 c domain contai...    186   5e-54   
gb|AFM87650.1|  60S ribosomal protein L5-like protein                   186   5e-54   
gb|AFM88396.1|  ribosomal protein L5                                    186   5e-54   
ref|XP_004337717.1|  ribosomal L18p/L5e family                          186   5e-54   
gb|AER35073.1|  60S ribosomal protein L5                                186   5e-54   
gb|AFM86481.1|  ribosomal protein L5                                    186   5e-54   
ref|XP_005985559.1|  PREDICTED: 60S ribosomal protein L5-like           186   5e-54   
ref|XP_005727289.1|  PREDICTED: 60S ribosomal protein L5-like           186   5e-54   
gb|AFM89421.1|  ribosomal protein L5                                    186   5e-54   
ref|XP_010870379.1|  PREDICTED: 60S ribosomal protein L5                186   5e-54   
gb|AFM88337.1|  ribosomal protein L5                                    186   5e-54   
ref|XP_007882704.1|  PREDICTED: 60S ribosomal protein L5-like           186   6e-54   
gb|AFM90058.1|  ribosomal protein L5                                    186   6e-54   
ref|XP_009075975.1|  PREDICTED: 60S ribosomal protein L5                186   6e-54   
ref|XP_006790548.1|  PREDICTED: 60S ribosomal protein L5-like           186   6e-54   
gb|ABI26260.1|  ribosomal protein L5                                    186   6e-54   
gb|AFM85809.1|  ribosomal protein L5                                    186   6e-54   
ref|XP_006534747.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     186   6e-54   
ref|XP_004552954.1|  PREDICTED: 60S ribosomal protein L5-like           186   6e-54   
gb|KFO56565.1|  60S ribosomal protein L5                                186   6e-54   
ref|XP_009959874.1|  PREDICTED: 60S ribosomal protein L5                186   6e-54   
ref|XP_010022288.1|  PREDICTED: 60S ribosomal protein L5                186   6e-54   
gb|ACI69521.1|  60S ribosomal protein L5                                186   7e-54   
gb|EOA96368.1|  60S ribosomal protein L5                                186   7e-54   
ref|XP_004068201.1|  PREDICTED: 60S ribosomal protein L5                186   7e-54   
ref|XP_005482139.1|  PREDICTED: 60S ribosomal protein L5                186   7e-54   
dbj|BAE31169.1|  unnamed protein product                                186   7e-54   
ref|XP_537074.4|  PREDICTED: 60S ribosomal protein L5 isoform 1         189   7e-54   
gb|EDL14330.1|  mCG1026389                                              186   7e-54   
gb|EFA80391.1|  60S ribosomal protein L5                                186   7e-54   
ref|XP_010291146.1|  PREDICTED: 60S ribosomal protein L5                186   7e-54   
ref|XP_009512323.1|  PREDICTED: 60S ribosomal protein L5                186   7e-54   
emb|CEF66000.1|  60S ribosomal protein L5                               186   7e-54   
ref|XP_005422184.1|  PREDICTED: 60S ribosomal protein L5                186   7e-54   
ref|NP_058676.1|  60S ribosomal protein L5                              186   7e-54   
ref|XP_006727091.1|  PREDICTED: 60S ribosomal protein L5-like           184   7e-54   
emb|CCQ18634.1|  60S ribosomal protein L5                               186   7e-54   
ref|XP_010713879.1|  PREDICTED: 60S ribosomal protein L5                186   7e-54   
ref|XP_010303651.1|  PREDICTED: 60S ribosomal protein L5                186   7e-54   
gb|KFO98657.1|  60S ribosomal protein L5                                186   7e-54   
ref|XP_008942395.1|  PREDICTED: 60S ribosomal protein L5                186   7e-54   
gb|ACN10317.1|  60S ribosomal protein L5                                186   7e-54   
emb|CDQ69914.1|  unnamed protein product                                186   7e-54   
emb|CEG01741.1|  Ribosomal protein L18/L5                               186   8e-54   
ref|XP_010159869.1|  PREDICTED: 60S ribosomal protein L5                186   8e-54   
ref|XP_009818493.1|  PREDICTED: 60S ribosomal protein L5                186   8e-54   
ref|XP_003283302.1|  60S ribosomal protein L5                           186   8e-54   
ref|XP_005026595.1|  PREDICTED: 60S ribosomal protein L5                186   8e-54   
ref|XP_009963721.1|  PREDICTED: 60S ribosomal protein L5                186   8e-54   
gb|KFP17477.1|  60S ribosomal protein L5                                186   8e-54   
gb|KFO69584.1|  60S ribosomal protein L5                                186   8e-54   
ref|XP_009087107.1|  PREDICTED: 60S ribosomal protein L5                186   8e-54   
gb|AFM86790.1|  60S ribosomal protein L5-A                              186   8e-54   
ref|XP_006021921.1|  PREDICTED: 60S ribosomal protein L5                186   8e-54   
gb|KFO07226.1|  60S ribosomal protein L5                                186   8e-54   
ref|NP_001030383.1|  60S ribosomal protein L5                           186   8e-54   
gb|KFM02490.1|  60S ribosomal protein L5                                186   8e-54   
emb|CDJ88514.1|  Ribosomal protein L18 L5 domain containing protein     186   8e-54   
ref|XP_010196863.1|  PREDICTED: 60S ribosomal protein L5                186   9e-54   
gb|ELK34439.1|  60S ribosomal protein L5                                187   9e-54   
ref|XP_005690639.1|  PREDICTED: 60S ribosomal protein L5-like           184   9e-54   
ref|XP_005451204.1|  PREDICTED: 60S ribosomal protein L5-like           186   9e-54   
tpg|DAA23524.1|  TPA: ribosomal protein L5-like                         186   9e-54   
ref|XP_008406082.1|  PREDICTED: 60S ribosomal protein L5                187   9e-54   
gb|ACI34044.1|  60S ribosomal protein L5                                186   9e-54   
ref|XP_009920773.1|  PREDICTED: 60S ribosomal protein L5                186   9e-54   
ref|XP_952624.1|  60S ribosomal protein l5                              186   9e-54   
ref|XP_008489183.1|  PREDICTED: 60S ribosomal protein L5                186   9e-54   
ref|XP_010005060.1|  PREDICTED: 60S ribosomal protein L5                186   1e-53   
gb|KHG04393.1|  60S ribosomal L5                                        184   1e-53   
gb|ACH70844.1|  ribosomal protein L5a                                   186   1e-53   
gb|ACO07720.1|  60S ribosomal protein L5                                185   1e-53   
ref|XP_004589426.1|  PREDICTED: 60S ribosomal protein L5-like           185   1e-53   
ref|NP_001002106.1|  ribosomal protein L5                               185   1e-53   
ref|XP_005445628.1|  PREDICTED: 60S ribosomal protein L5                186   1e-53   
ref|XP_010891931.1|  PREDICTED: 60S ribosomal protein L5-like           185   1e-53   
ref|NP_988881.1|  ribosomal protein L5                                  185   1e-53   
ref|XP_011354001.1|  PREDICTED: 60S ribosomal protein L5                186   1e-53   
gb|AFM86403.1|  60S ribosomal protein L5-A                              185   1e-53   
emb|CBI38286.3|  unnamed protein product                                181   1e-53   
ref|XP_009554761.1|  PREDICTED: 60S ribosomal protein L5                186   1e-53   
ref|XP_010581057.1|  PREDICTED: 60S ribosomal protein L5                186   1e-53   
gb|AEI69274.1|  ribosomal protein L5                                    185   1e-53   
ref|XP_010731643.1|  PREDICTED: 60S ribosomal protein L5-like           185   1e-53   
ref|XP_002109848.1|  expressed hypothetical protein                     185   1e-53   
ref|XP_010732697.1|  PREDICTED: 60S ribosomal protein L5                186   1e-53   
gb|AFM89559.1|  ribosomal protein L5                                    185   2e-53   
ref|XP_764651.1|  60S ribosomal protein L5e                             185   2e-53   
ref|XP_004848203.1|  PREDICTED: 60S ribosomal protein L5-like           185   2e-53   
gb|ABB29646.1|  ribosomal protein 5 large subunit                       180   2e-53   
ref|XP_004468431.1|  PREDICTED: 60S ribosomal protein L5-like           185   2e-53   
ref|XP_003264168.1|  PREDICTED: 60S ribosomal protein L5-like iso...    185   2e-53   
ref|XP_005806012.1|  PREDICTED: 60S ribosomal protein L5-like           186   2e-53   
gb|ADV40159.1|  putative 60S ribosomal protein L5                       184   2e-53   
ref|XP_004018164.1|  PREDICTED: 60S ribosomal protein L5-like           187   2e-53   
gb|KHG10378.1|  60S ribosomal protein L5                                184   2e-53   
gb|AFM74205.1|  ribosomal protein L5                                    185   2e-53   
ref|XP_003856228.1|  60S ribosomal protein L5                           185   2e-53   
ref|XP_005050402.1|  PREDICTED: 60S ribosomal protein L5                186   2e-53   
gb|KIN05730.1|  hypothetical protein OIDMADRAFT_16965                   184   2e-53   
gb|ETP30123.1|  hypothetical protein F442_20806                         185   2e-53   
ref|XP_002949803.1|  component of cytosolic 80S ribosome and 60S ...    184   2e-53   
ref|XP_004635786.1|  PREDICTED: 60S ribosomal protein L5                184   2e-53   
gb|KGL78260.1|  60S ribosomal protein L5                                184   2e-53   
ref|XP_009690096.1|  60S ribosomal protein L5                           184   2e-53   
ref|NP_001279541.1|  60S ribosomal protein L5-like                      184   2e-53   
ref|XP_008992670.1|  PREDICTED: 60S ribosomal protein L5                184   2e-53   
ref|XP_006114225.1|  PREDICTED: 60S ribosomal protein L5                184   2e-53   
ref|XP_004002245.1|  PREDICTED: 60S ribosomal protein L5                184   2e-53   



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EA GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLEANGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   281 bits (718),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+E  GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNLEVNGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   281 bits (718),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+E  GEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNLEVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGDMILASAYA ELP+YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EA+GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNTEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   278 bits (711),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGDMILASAYA ELP+YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EA+GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNPEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQ+VSASIAGDMILASAYANELPRYGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQVVSASIAGDMILASAYANELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+E  GEDYSVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNLEVNGEDYSVEPAENRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   276 bits (705),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGDMILASAYA ELP YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPHYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN++  GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGDMILASAYA ELPRYGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN++  GEDYSVEP E RRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGDMILASAYA ELP++GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EA+GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH EKRFA
Sbjct  121  GNPEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   274 bits (700),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   272 bits (695),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK++AY+KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   273 bits (698),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK+RAYFKR+QVKF+RRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFRRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L KLEMDQEYE
Sbjct  61   TAQIISASITGDSVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLTKLEMDQEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGDMILASAYA ELP++GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EA+GEDYSVE  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH EKRFA
Sbjct  121  GNPEASGEDYSVELAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK++AY+KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQILSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   271 bits (693),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   271 bits (692),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F K QK+RAYFKRFQVK++RRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFAKAQKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK+RAYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASI GD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD++YE
Sbjct  61   TAQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEDYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +2

Query  53   LSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNK  232
            L+P+ET      S +A M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNK
Sbjct  26   LNPKETQALLPFSPSA-MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNK  84

Query  233  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  412
            YNTPKYRFVVRF+NKDIVAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGL
Sbjct  85   YNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGL  144

Query  413  llarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalk  592
            LLARR+L+ LEMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALK
Sbjct  145  LLARRVLKTLEMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALK  204

Query  593  galdggldIPHSEKRFAGF  649
            GALDGGLDIPHS+KRFAGF
Sbjct  205  GALDGGLDIPHSDKRFAGF  223



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN+DI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNRDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGDMILASAYA+ELP +GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN++  GEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  644  GFT  652
            G++
Sbjct  181  GYS  183



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QIVSASIAGDMILASAYA+ELP +GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   ITQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN++  GEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  644  GFT  652
            G++
Sbjct  181  GYS  183



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_006447906.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61146.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=217

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_006447904.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61144.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=268

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K  K+RAYFKRFQVK++RRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKALKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   270 bits (690),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +2

Query  53   LSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNK  232
            + P  + L G  S  + M F+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNK
Sbjct  16   ICPLLSLLEGRGSRASAMVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNK  75

Query  233  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  412
            YNTPKYRFVVRFTNKDI+AQI SASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGL
Sbjct  76   YNTPKYRFVVRFTNKDIIAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGL  135

Query  413  llarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalk  592
            LLARR+L+ LEMD EYEGNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALK
Sbjct  136  LLARRVLKMLEMDGEYEGNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALK  195

Query  593  galdggldIPHSEKRFAGFT  652
            GALDGGLDIPHS+KRFAGF+
Sbjct  196  GALDGGLDIPHSDKRFAGFS  215



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   269 bits (687),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   269 bits (687),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   269 bits (687),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   IAQIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   268 bits (686),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   268 bits (685),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K  K++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LASAYA+ELP YGL+ GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPHYGLDFGLTNYAAAYCTGLLLARRVLKTLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|KDO51034.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=217

 Score =   265 bits (677),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   268 bits (684),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   268 bits (685),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASI GDM+LA+AYA+ELP YGLEVGL+NYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   VAQIVSASITGDMVLAAAYAHELPHYGLEVGLSNYAAAYCTGLLLARRVLKKLEMDDEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
            AF+K QK+RAYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKD+ 
Sbjct  4    AFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNKDVT  63

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
            AQI+SASI GD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD++YEG
Sbjct  64   AQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEDYEG  123

Query  467  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  646
            NVEATGEDYSVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  NVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  183

Query  647  FT  652
            F+
Sbjct  184  FS  185



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K  K+RAYFKRFQVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L KLEM  EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNVEATGEDYSVEPSESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGDM+LA+AY++ELP++GLEVGLTNYAAAYCTGLLLARR L+KLEMD+EYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EATGEDYSVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNEEATGEDYSVEPAETRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI+SASIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EY+
Sbjct  61   IAQILSASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K  K+RAYFKRFQVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L KLEM  EYE
Sbjct  61   VAQIISASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNVEATGEDYSVEPSESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AYA+ELP+YGLEVGLTNYAAAYCTGLLLARR+L  LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLNTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K  KTRAY KRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTLKTRAYSKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   265 bits (678),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD+EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AY KR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTQKTKAYSKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQ++SASIAGD++LASAYA+ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  61   CAQVISASIAGDLVLASAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LA+AYA+ELP YGL+VGLTNYAAAYCTGLLLARR L+ LEMD+EY+
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHYGLDVGLTNYAAAYCTGLLLARRTLKMLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIVSA+IAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR LQKLEMD+EYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIVSA+IAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR LQKLEMD+EYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+A
Sbjct  5    FVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIA  64

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+GN
Sbjct  65   QIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQGN  124

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIPHS+KRFAGF
Sbjct  125  VEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFAGF  184



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LA+AYA+ELP +GLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEA+GEDYSVEP +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD+EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIK  K RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKASKPRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+S++I+GD++LASAY++ELPRYGL VGLTNYAA+YCTGLLLARR L+KLEMD+EYE
Sbjct  61   VAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAASYCTGLLLARRTLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEPGESRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+D+PHSEKRFA
Sbjct  121  GNLEATGEDFSVEPGESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDVPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   266 bits (679),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   265 bits (676),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   265 bits (678),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKR+QVK+KRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSQKTKAYFKRYQVKYKRRRVGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   AAQIISASIAGDLVLASAYAHELPHYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEPGESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPGESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   264 bits (675),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   266 bits (679),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDIVA
Sbjct  21   YVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVA  80

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGN
Sbjct  81   QIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYEGN  140

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  141  VEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  200



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGDM+LA+AY++ELP++GLEVGLTNYAAAYCTGLLLARR L+KLEMD+EYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EATGEDYSVEP E+RRPFRALLDVGL+RTTTGN VFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNEEATGEDYSVEPAETRRPFRALLDVGLVRTTTGNHVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K +K++AYFKR++VKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSRKSKAYFKRYRVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPVESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  18   MAFVKAQKTKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  77

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  78   IAQILSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDDEYQ  137

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  138  GNLEATGEDYSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  197

Query  644  GFT  652
            GF+
Sbjct  198  GFS  200



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKR+QV FKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFT KDI
Sbjct  55   MAFVKAQKTKAYFKRYQVPFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTKKDI  114

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGD++LA+AY++ELP +GLEVGLTNYAAAY TGLLLARR+L+KLEMD+EYE
Sbjct  115  IAQIVSASIAGDLVLAAAYSHELPHFGLEVGLTNYAAAYATGLLLARRVLKKLEMDEEYE  174

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEPG+SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  175  GNVEATGEDYSVEPGDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  234

Query  644  GF  649
            GF
Sbjct  235  GF  236



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAY KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SA+I GDM+LASAY++ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEMDSEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+S+EP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSIEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK++AYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+S+SIAGD++LASA+A+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   VAQIISSSIAGDLVLASAFAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLD+PHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGVLKGALDGGLDVPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA+ K QK+RAY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSRAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA+ K QK++AY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARRLL+ LEMD+EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA+ K QK++AY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARRLL+ LEMD+EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQ+ SASIAGD +LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KL+MD+EYE
Sbjct  61   IAQVSSASIAGDHVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLRKLDMDKEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ESRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            G+T
Sbjct  181  GYT  183



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI SASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDGEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK+RAYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI SASIAGD++LASAYA+ELPRYGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIASASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF 
Sbjct  181  GFA  183



>gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   263 bits (672),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK++AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR L+ LEMD EY+
Sbjct  61   VAQIVSASIAGDLVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRTLKMLEMDDEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDNRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GFT
Sbjct  181  GFT  183



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI+ ASI+GD++LA+AY +ELP YGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEPGESRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFA  180

Query  644  GFT  652
            GF 
Sbjct  181  GFN  183



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LA+AY++ELP +GL+VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   266 bits (679),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVR  265
            +S    MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR
Sbjct  82   NSKVRAMAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVR  141

Query  266  FTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklE  445
            FTNKDI+AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LE
Sbjct  142  FTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLE  201

Query  446  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPH  625
            MD EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPH
Sbjct  202  MDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPH  261

Query  626  SEKRFAGFT  652
            S+KRFAGF+
Sbjct  262  SDKRFAGFS  270



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   263 bits (671),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIVS+SIAGDM+LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIVSSSIAGDMVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFA
Sbjct  121  GNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEA+GED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK+RAYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI SASIAGD++LASAYA+ELPRYGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQITSASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            G+
Sbjct  181  GY  182



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA++K QKT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIVSASIAGD +LA+AYA ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K  KTRAYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTLKTRAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   TAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATG+D+SVE  ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGDDFSVESAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KJB22671.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KJB22672.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+R TNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRITNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIVS+SIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLL+ARR+L+KLEMD EYE
Sbjct  61   TAQIVSSSIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLVARRVLKKLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFA
Sbjct  121  GNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA++K QKT+AY KR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKD+
Sbjct  57   MAYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNKDL  116

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIV ASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  117  IAQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAEYE  176

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  177  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFA  236

Query  644  GF  649
            GF
Sbjct  237  GF  238



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  467  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  646
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  647  F  649
            F
Sbjct  183  F  183



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LA+AY++ELP +GL+VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGL++TT GNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTIGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS++RFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDQRFA  180

Query  644  GFT  652
            G +
Sbjct  181  GIS  183



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   261 bits (667),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK++AYFKR+QVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++LASAY +ELPRYGLEVGLT+YAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLASAYGHELPRYGLEVGLTSYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   260 bits (665),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  5    FVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  64

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIVSASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEGN
Sbjct  65   QIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEGN  124

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGED+SVEP E RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  125  VEATGEDFSVEPAEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  184



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   261 bits (668),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  119  VQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIV  298
             QKT+AYFKR+QV+FKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVAQIV
Sbjct  36   AQKTKAYFKRYQVQFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDIVAQIV  95

Query  299  SASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEA  478
            SASIAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR+L++L+MD+EYEGNVEA
Sbjct  96   SASIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRVLKELQMDEEYEGNVEA  155

Query  479  TGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            TGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAGF
Sbjct  156  TGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAGF  212



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   260 bits (665),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K  K+RAYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAHKSRAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSA+IAGD++L +AY++ELPRYGLE+GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLTAAYSHELPRYGLEIGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|AFW84310.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=233

 Score =   258 bits (658),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  467  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  646
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  647  F  649
            F
Sbjct  183  F  183



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   260 bits (664),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK+RAY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYCKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   260 bits (664),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK+RAY+KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAY++ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            G+
Sbjct  181  GY  182



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKTRAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKTRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQ++ + I GD++LA+AY++ELP YGL+VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQVIHSRIVGDIVLAAAYSHELPCYGLDVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EATGEDYSVEPGESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNTEATGEDYSVEPGESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQ++SASIAGD++LA+A  +ELPRYGLEVGLTNYAAAYC GLLLARR+L+ LEMD+EY+
Sbjct  61   IAQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATG D+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  121  GNIEATGLDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
            A++K QKT+AY KR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKD++
Sbjct  4    AYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNKDLI  63

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
            AQIV ASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYC GLLLARR+L++LEMD EYEG
Sbjct  64   AQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAEYEG  123

Query  467  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  646
            NVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGGLDIPHS+KRFAG
Sbjct  124  NVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFAG  183

Query  647  F  649
            F
Sbjct  184  F  184



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SA+I GDMILASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGN VFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK++AYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EATGED+SVEP ++RRPFRALLDVGL+RTTTGNR+FGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNTEATGEDFSVEPTDTRRPFRALLDVGLLRTTTGNRIFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SA+I GDMILASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGN VFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK+RAY+KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGD++LA+AY++ELP +GLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQIVSASIAGDIVLAAAYSHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEA+GED+SVEP ++RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDFSVEPADTRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMDQEYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEGN
Sbjct  64   QIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGN  123

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF
Sbjct  124  VEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF  183



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+SASIAGD++LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMDQEYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QK+RAY KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  67   FVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  126

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QI+SA+I GDM+LASAY++ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYEGN
Sbjct  127  QIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEMDSEYEGN  186

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGED+S+EP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF
Sbjct  187  VEATGEDFSIEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF  246

Query  650  T  652
            +
Sbjct  247  S  247



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   258 bits (659),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIVSASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEGN
Sbjct  64   QIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEGN  123

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  124  VEATGEDFSVEPADERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  183



>gb|KJB10809.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=230

 Score =   255 bits (652),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA++K QK++AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+ ASI+GD++LA+AY++ELP YGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATG+D++VEP ESRRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIPHSEKRFA
Sbjct  121  GNVEATGDDFTVEPAESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   258 bits (659),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRF+VRFTNKDI+A
Sbjct  4    FVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFIVRFTNKDIIA  63

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIVSASI GD+ILA+AY+ ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEGN
Sbjct  64   QIVSASITGDIILAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEGN  123

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGED+SVEP E RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  124  VEATGEDFSVEPAEERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  183



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   258 bits (658),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  467  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  646
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  647  F  649
            F
Sbjct  183  F  183



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   258 bits (658),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 1/184 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA++K QKT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNY-AAAYCTGlllarrllqklEMDQEY  460
             AQIVSASIAGD +LA+AYA ELP YGLEVGLTNY AAAYCTGLLLARR+L+KLEMD EY
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAAYCTGLLLARRVLKKLEMDDEY  120

Query  461  EGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            EGNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRF
Sbjct  121  EGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF  180

Query  641  AGFT  652
            AGF+
Sbjct  181  AGFS  184



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   260 bits (665),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 181/210 (86%), Gaps = 10/210 (5%)
 Frame = +2

Query  23   LLRALPRSSYLSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRAR  202
            L R L  S Y  P           T   AF+K  K+RAY KR+QVK+KRRR+GKTDYRAR
Sbjct  65   LFRVLSVSDYTCP----------CTVYQAFVKALKSRAYSKRYQVKYKRRRDGKTDYRAR  114

Query  203  NRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLT  382
             RLINQDKNKYNTPKYR VVRF+NK IVAQI+SASIAGD++LA+AY++ELP YGLEVGLT
Sbjct  115  IRLINQDKNKYNTPKYRIVVRFSNKFIVAQIISASIAGDLVLAAAYSHELPHYGLEVGLT  174

Query  383  NYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTT  562
            NYAAAYCTGLLLARR+L+KLEMDQEYEGNVEATGED+SVEP E+RRPFRALLDVGL+RTT
Sbjct  175  NYAAAYCTGLLLARRVLKKLEMDQEYEGNVEATGEDFSVEPAETRRPFRALLDVGLLRTT  234

Query  563  TGNRVFgalkgaldggldIPHSEKRFAGFT  652
            TGNRVFGALKGALDGGLDIPHS+KRFAGF+
Sbjct  235  TGNRVFGALKGALDGGLDIPHSDKRFAGFS  264



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   258 bits (658),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIV A+IAGD+++A+AY++ELPRYGL VGLTNYAAAYCTGLLLARR+L+  E+DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLTVGLTNYAAAYCTGLLLARRILKYRELDQEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|EPS64989.1| hypothetical protein M569_09790, partial [Genlisea aurea]
Length=207

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QK++AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+A
Sbjct  1    FVKSQKSKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIA  60

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIVSA+IAGD +LA+AY++EL  YGLEVGLTNYAAAYCTGLLL RR+L+KL++DQEY+GN
Sbjct  61   QIVSATIAGDRVLAAAYSHELRHYGLEVGLTNYAAAYCTGLLLGRRVLKKLDLDQEYKGN  120

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALD G+DIPHS+KRFAGF
Sbjct  121  VEATGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDAGIDIPHSDKRFAGF  180

Query  650  T  652
            +
Sbjct  181  S  181



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +2

Query  176  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELP  355
            EGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDIVAQI+SASIAGD++LA+AYA+ELP
Sbjct  28   EGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELP  87

Query  356  RYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRAL  535
            RYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGNVEATGEDYSVEP ESRRPFRAL
Sbjct  88   RYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYEGNVEATGEDYSVEPAESRRPFRAL  147

Query  536  LDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            LDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  148  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  185



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QIVSA+I GD +LA+AYA+ELP +GLEVGL+NYAAAYCTGLLL+RR+L+ LEMD+EYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLEVGLSNYAAAYCTGLLLSRRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            G+
Sbjct  181  GY  182



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
            AF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+
Sbjct  4    AFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDII  63

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
            AQ++SASIAGD++LA+A  +ELPRYGLEVGLTNYAAAYC GLLLARR+L+ LEMD+EY+G
Sbjct  64   AQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQG  123

Query  467  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  646
            N+EATG D+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAG
Sbjct  124  NIEATGLDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAG  183

Query  647  F  649
            F
Sbjct  184  F  184



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  467  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  646
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  647  F  649
            F
Sbjct  183  F  183



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP   RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPSGERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M FIK QK RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNT KYRFVVR TNKDI
Sbjct  1    MVFIKAQKPRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTAKYRFVVRSTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI+S++IAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQIISSTIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP E+R PFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRGPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKFRDLDQEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEA+GED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDKEYEG  122

Query  467  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  646
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  647  F  649
            F
Sbjct  183  F  183



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   256 bits (653),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   256 bits (654),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QIVSA+I GD +LA+AYA+ELP +GL+VGL+NYAAAYCTGLLL+RR+L+KLEMD+EYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLDVGLSNYAAAYCTGLLLSRRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            G+
Sbjct  181  GY  182



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA++K QK++AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+ ASI+GD++LA+AY++ELP YGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATG+D++VEP ESRRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIPHSEKRFA
Sbjct  121  GNVEATGDDFTVEPAESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   257 bits (656),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  31   MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  90

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  91   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  150

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  151  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  210

Query  644  GF  649
            GF
Sbjct  211  GF  212



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPHYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   256 bits (653),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QKTRAY KRFQVKF+RRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFRRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   256 bits (654),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 181/211 (86%), Gaps = 12/211 (6%)
 Frame = +2

Query  17   FKLLRALPRSSYLSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYR  196
             +  R  P S + SPQ+T           M F+K  K+ AYFKR+QVKF+RRR GKTDYR
Sbjct  5    LRQFRLFP-SLHSSPQQT-----------MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYR  52

Query  197  ARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVG  376
            AR RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGD++ ASAYA+ELP+YGL VG
Sbjct  53   ARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVG  112

Query  377  LTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIR  556
            LTNYAAAYCTGLLLARR+L+ LEMD EYEGN+EATGED+SVEP +SRRPFRALLDVGLIR
Sbjct  113  LTNYAAAYCTGLLLARRVLKMLEMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIR  172

Query  557  TTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            TTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  173  TTTGNRVFGALKGALDGGLDIPHSDKRFAGF  203



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   255 bits (652),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   255 bits (652),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   255 bits (652),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
             F+K  K+ AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKSNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  467  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  646
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  647  F  649
            F
Sbjct  183  F  183



>gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   255 bits (652),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+ ++IAGD++LA+AY++ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ L+MD EYE
Sbjct  61   TAQIIHSTIAGDIVLAAAYSHELPKYGLEVGLTNYAAAYCTGLLLARRVLKTLQMDGEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP   RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAGERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   255 bits (651),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +K QK +AYFKR+QVKF+RRREGKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQ+VSA+IAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEA+GEDYSVEP +SRRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDYSVEPTDSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K  KT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            Q++ ASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EY+GN
Sbjct  64   QVIYASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQGN  123

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGEDY+VEP ESRRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  124  VEATGEDYAVEPTESRRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  183



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +K QK +AYFKR+QVKF+RRREGKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQ+VSA+IAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEA+GEDYSVEP +SRRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDYSVEPTDSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  36   FVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  95

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGN
Sbjct  96   QIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGN  155

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            +EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  156  LEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  215



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F++ QK  AY+KRFQV+FKRRR+GKTDYRAR RLINQ+KNKY+TPKYRFVVRFTNKDI
Sbjct  1    MGFVRTQKANAYYKRFQVQFKRRRDGKTDYRARIRLINQEKNKYSTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGDM+LASAY++ELPRYGLEVGL NYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIMSASIAGDMVLASAYSHELPRYGLEVGLANYAAAYCTGLLLARRVLKLRDLDQEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+ VEP + RRPFRALLDVGLIRTTTGNRVF ALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFCVEPADGRRPFRALLDVGLIRTTTGNRVFAALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EY 
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYG  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  9    WVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  68

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  69   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  128

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  129  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  188

Query  644  GF  649
            GF
Sbjct  189  GF  190



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  10   FVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  69

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGN
Sbjct  70   QIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGN  129

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            +EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  130  LEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  189



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   253 bits (647),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  18   FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  77

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  78   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  137

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  138  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  197

Query  644  GF  649
            GF
Sbjct  198  GF  199



>gb|AFK41626.1| unknown [Lotus japonicus]
Length=207

 Score =   249 bits (636),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVF  580
            GNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVF
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLVKTTTGNRVF  159



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   253 bits (647),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  27   FVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  86

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGN
Sbjct  87   QIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGN  146

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            +EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  147  LEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  206



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   253 bits (645),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASI GD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIVGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 168/183 (92%), Gaps = 3/183 (2%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI+ ASI+GD++LA+AY +ELP YGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  58   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEPGESRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFA
Sbjct  118  GNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFA  177

Query  644  GFT  652
            GF 
Sbjct  178  GFN  180



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYC GLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCAGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  13   FVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  72

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYEGN
Sbjct  73   QIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEGN  132

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
             EATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  133  AEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  192



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   250 bits (638),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QKTRAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR VVRF+NKD+
Sbjct  1    MVFVKAQKTRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFSNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+ A++AGD+++A+AY+ ELPRYGLEVGLTNYAAAYCTGLLLARR+L++LEMD+EY 
Sbjct  61   VAQIIYATLAGDVVMAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDEEYV  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EA+GEDYSVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNEEASGEDYSVEPNDARRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            G+
Sbjct  181  GY  182



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L    +DQEYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGN  123

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  183



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN  123

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            +EATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  124  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  183



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 169/182 (93%), Gaps = 3/182 (2%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  58   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  118  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  177

Query  644  GF  649
            GF
Sbjct  178  GF  179



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +2

Query  176  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELP  355
            EGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSA+IAGD +LA+AYA+EL 
Sbjct  1    EGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSATIAGDRVLAAAYAHELR  60

Query  356  RYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRAL  535
             YGLEVGLTNYAAAYCTGLLL RR+L KL++DQEYEGNVEATGEDYSVEP ESRRPFRAL
Sbjct  61   HYGLEVGLTNYAAAYCTGLLLGRRVLNKLDLDQEYEGNVEATGEDYSVEPAESRRPFRAL  120

Query  536  LDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGFT  652
            LDVGL+RTTTGNRVFGALKGALD G+DIPHS+KRFAGF+
Sbjct  121  LDVGLLRTTTGNRVFGALKGALDAGIDIPHSDKRFAGFS  159



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT AY+KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTNAYYKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN  123

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            +EATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  124  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  183



>gb|KDO51035.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=252

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVF  580
            G+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVF
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVF  159



>ref|XP_006858792.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI+SASIAGD++LAS+YA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L++LEMD EYE
Sbjct  61   IAQIISASIAGDLVLASSYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDSEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP ESRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            G++
Sbjct  181  GYS  183



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 165/185 (89%), Gaps = 3/185 (2%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgg---ldIPHSEK  634
            GNV ATGED+S+EP ESRRPFRALLDVGLIRTTTGNRVFGALK         LDIPHS+K
Sbjct  121  GNVVATGEDFSIEPTESRRPFRALLDVGLIRTTTGNRVFGALKVLKGALDGGLDIPHSDK  180

Query  635  RFAGF  649
            RFAGF
Sbjct  181  RFAGF  185



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
            AF+K+QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    AFVKLQKTHAYHKRFQVKFKRRRQGKTDYRARVRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
             QI  A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEG
Sbjct  63   CQIAYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRDLDQEYEG  122

Query  467  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  646
            NVEA GEDYSVEP + RRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAG
Sbjct  123  NVEAAGEDYSVEPSDERRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAG  182

Query  647  F  649
            F
Sbjct  183  F  183



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 191/214 (89%), Gaps = 8/214 (4%)
 Frame = +2

Query  26   LRALPRSSYLSPQETPLRG*SSSTAP-----MAFIKVQKTRAYfkrfqvkfkrrrEGKTD  190
            + ALPR  + S   +PL   S   AP     M ++K QKT+AYFKRFQVKFKRRR+GKTD
Sbjct  1    MEALPRCFFCS---SPLPPKSDLGAPKRGSAMVYVKTQKTKAYFKRFQVKFKRRRQGKTD  57

Query  191  YRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLE  370
            YRAR RLINQDKNKYNTPKYRFVVRFTNKDI+AQI+SASIAGD++LA+AY++ELPRYGLE
Sbjct  58   YRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIISASIAGDLVLAAAYSHELPRYGLE  117

Query  371  VGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGL  550
            VGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGNVEATGED+SVEP ESRRPFRALLDVGL
Sbjct  118  VGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGNVEATGEDFSVEPTESRRPFRALLDVGL  177

Query  551  IRTTTGNRVFgalkgaldggldIPHSEKRFAGFT  652
            +RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+
Sbjct  178  VRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFS  211



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   248 bits (633),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIV A+IAGD+++A+AY++ELPRYGLE GLTNYAAAYCTGLLLARR+L+   +DQEYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGN  123

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  183



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   248 bits (633),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 174/183 (95%), Gaps = 3/183 (2%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
             AF+K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV   TNK+I
Sbjct  9    FAFVKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFV---TNKNI  65

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQIVSASIAGD++LA+AY+ ELP+YGLEVGLTNYAAAYCTGLL+ARR+L++LEMD EYE
Sbjct  66   IAQIVSASIAGDIVLAAAYSYELPQYGLEVGLTNYAAAYCTGLLVARRVLKQLEMDGEYE  125

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  126  GNVEATGEDFSVEPTENRRPFRALLDVGLIQTTTGNRVFGALKGALDGGLDIPHSEKRFA  185

Query  644  GFT  652
            GF+
Sbjct  186  GFS  188



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   248 bits (632),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  7    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  66

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIV A+IAGD+++A+AY++ELPRYGLE GLTNYAAAYCTGLLLARR+L+   +DQEYEGN
Sbjct  67   QIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGN  126

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  127  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  186



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRAR-NRLINQDKNKYNTPKYRFVVRFTNKD  280
            M  +K Q +R Y  R+QVK++RRR+GKTDYRAR  RLINQDKNKYNTPKYRFVVRFTNKD
Sbjct  1    MVLVKPQNSRPYSMRYQVKYRRRRDGKTDYRARIRRLINQDKNKYNTPKYRFVVRFTNKD  60

Query  281  IVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEY  460
            I AQ+VSASIAGD+ILA+AYA+ELP+YGL VGLTNY+AAYCTGLLLARR+L+  EMD EY
Sbjct  61   ITAQLVSASIAGDVILAAAYAHELPQYGLNVGLTNYSAAYCTGLLLARRVLKMFEMDAEY  120

Query  461  EGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            EGN+EA+GED+SVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRF
Sbjct  121  EGNLEASGEDFSVEPTENRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF  180

Query  641  AGFT  652
            AGF+
Sbjct  181  AGFS  184



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI+A
Sbjct  95   FVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDIIA  154

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYEGN
Sbjct  155  QIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEGN  214

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
             EATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  215  AEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  274



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 4/186 (2%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  464  GNVE----ATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSE  631
            GN E    ATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+
Sbjct  121  GNAEVRLIATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSD  180

Query  632  KRFAGF  649
            KRFAGF
Sbjct  181  KRFAGF  186



>gb|KJB22673.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=197

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVF  580
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVF
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVF  159



>gb|KJB22670.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=171

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVF  580
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVF
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVF  159



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QK + YFKR+QVKF+RRREGKTDYRAR RLINQDKNKYN+PK+R+VVRFTNKDI
Sbjct  1    MVFVKPQKKQPYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNSPKFRYVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QIVSA+I GD +LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IVQIVSATITGDNVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN EATGEDYSVEP E+RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNAEATGEDYSVEPTETRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK+ AYFKRFQVKFKRRREGKTDYRAR  LI QD NKY TPKYR+VVR TNKDI
Sbjct  1    MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANKYGTPKYRYVVRLTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            V QIVSA+IAGD++LA+AYA+ELP++GL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGLLLARRVLKTLEMDDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNV ATGEDYSVEP +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVVATGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++K QKT+AYFKR+QVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKTQKTKAYFKRYQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 3/182 (2%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  117

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  118  GNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  177

Query  644  GF  649
            GF
Sbjct  178  GF  179



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QK+ AYFKRFQVKFKRRREGKTDYRAR  LI QD NKY TPKYR+VVR TNKDI
Sbjct  32   MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANKYGTPKYRYVVRLTNKDI  91

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            V QIVSA+IAGD++LA+AYA+ELP++GL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  92   VCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGLLLARRVLKTLEMDDEYE  151

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNV ATGEDYSVEP +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  152  GNVVATGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  211

Query  644  GF  649
            GF
Sbjct  212  GF  213



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 168/182 (92%), Gaps = 3/182 (2%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M +IK QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D+EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  118  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  177

Query  644  GF  649
            GF
Sbjct  178  GF  179



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K  KT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NK I
Sbjct  1    MAFVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKHI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI+SASIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EYE
Sbjct  61   IAQIISASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYE  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGEDYSVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 167/182 (92%), Gaps = 3/182 (2%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M +IK QKTRAY KRFQVKFKRRR GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRRGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D+EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  118  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  177

Query  644  GF  649
            GF
Sbjct  178  GF  179



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+DQEY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN  ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNETATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  644  GFT  652
            GF+
Sbjct  181  GFS  183



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 171/186 (92%), Gaps = 4/186 (2%)
 Frame = +2

Query  92   STAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFT  271
            + AP+ +IK QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   T
Sbjct  2    AAAPV-YIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---T  57

Query  272  NKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMD  451
            NKD+ AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D
Sbjct  58   NKDVTAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLD  117

Query  452  QEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSE  631
            +EYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+
Sbjct  118  EEYEGNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSD  177

Query  632  KRFAGF  649
            KRFAGF
Sbjct  178  KRFAGF  183



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 164/180 (91%), Gaps = 3/180 (2%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI A
Sbjct  7    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITA  63

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L    +DQEYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGN  123

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            VEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  183



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRLVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+DQEY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN +ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNEQATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  644  GFT  652
            G++
Sbjct  181  GYS  183



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 164/180 (91%), Gaps = 3/180 (2%)
 Frame = +2

Query  110  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  289
            F+K QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI A
Sbjct  4    FVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITA  60

Query  290  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  469
            QIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEGN
Sbjct  61   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN  120

Query  470  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
            +EATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  121  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  180



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   237 bits (605),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRYVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+DQEY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN  ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNETATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  644  GFT  652
            G++
Sbjct  181  GYS  183



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  ++D EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNYDLDDEYV  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GN +ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNEQATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  644  GF  649
            G+
Sbjct  181  GY  182



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  206  RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTN  385
            RLINQDKNKYNTPKYRFVVRF+NKDIVAQI SASI GD +LASAYA+ELPRYGLEVGLTN
Sbjct  30   RLINQDKNKYNTPKYRFVVRFSNKDIVAQITSASITGDTVLASAYAHELPRYGLEVGLTN  89

Query  386  YAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTT  565
            YAAAYCTGLLLARRLL+ LEMD+EYEGNVEATGED+SVEP ++RRPFRALLDVGL+RTTT
Sbjct  90   YAAAYCTGLLLARRLLKMLEMDEEYEGNVEATGEDFSVEPADTRRPFRALLDVGLVRTTT  149

Query  566  GNRVFgalkgaldggldIPHSEKRFAGF  649
            GNRVFGALKGALDGGLDIPHSEKRFAGF
Sbjct  150  GNRVFGALKGALDGGLDIPHSEKRFAGF  177



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 166/184 (90%), Gaps = 1/184 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA  + QK+++Y+KR+QVK++RRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI  A+IAGD+I+A+AYA+ELPRYGL+VGLTNYAAAYCTGLLLARRLL K+ M   YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  464  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            GN +  GEDY+VE   E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRF
Sbjct  121  GNTDVNGEDYNVETLDENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRF  180

Query  641  AGFT  652
            AG++
Sbjct  181  AGYS  184



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 166/184 (90%), Gaps = 1/184 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA  + QK+++Y+KR+QVK++RRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI  A+IAGD+I+A+AYA+ELPRYGL+VGLTNYAAAYCTGLLLARRLL K+ M   YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  464  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            GN +  GEDY+VE   E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRF
Sbjct  121  GNTDVNGEDYNVETLDENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRF  180

Query  641  AGFT  652
            AG++
Sbjct  181  AGYS  184



>ref|XP_004310188.1| PREDICTED: 60S ribosomal protein L5-2-like [Fragaria vesca subsp. 
vesca]
Length=171

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +2

Query  218  QDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAA  397
            +DKNKYNTPKYRFVV FTNKDIVAQI+S++I+GD++LASAY++ELPRYGL VGLTNYAA+
Sbjct  14   KDKNKYNTPKYRFVVCFTNKDIVAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAAS  73

Query  398  YCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRV  577
            YCTGLLLARR L+KLEMD+EYEGN+EATGED+SVEPGE+RRPFRALLDVGL+ TTTGNRV
Sbjct  74   YCTGLLLARRTLKKLEMDEEYEGNLEATGEDFSVEPGENRRPFRALLDVGLVLTTTGNRV  133

Query  578  FgalkgaldggldIPHSEKRFAGFT  652
            FGALKGALDGG+D+PHSEKRFAGF+
Sbjct  134  FGALKGALDGGIDVPHSEKRFAGFS  158



>sp|Q4KTI3.1|RL5_SUBDO RecName: Full=60S ribosomal protein L5 [Suberites domuncula]
 gb|AAX48835.1| L5 [Suberites domuncula]
Length=293

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKR+QVKF+RRREGKTDYRAR RL+ QDKNKYNTPKYR V+RFTN DI
Sbjct  1    MPFVKVIKNKAYFKRYQVKFRRRREGKTDYRARKRLVVQDKNKYNTPKYRIVIRFTNTDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QI+ A I GD +L SAYA+ELPRYG++VGLTNYAAAYCTGLLLARRLL  L +  +Y 
Sbjct  61   ICQIIYAKIEGDKVLVSAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTNLGLADKYA  120

Query  464  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            G  +  GED++VE  G+  RPFRA LDVGL RTTTGNRVF A+KGA+DGG+DIPHS  RF
Sbjct  121  GQTDIDGEDFNVEHMGDGPRPFRAFLDVGLTRTTTGNRVFAAMKGAVDGGIDIPHSPSRF  180

Query  641  AGF  649
             G+
Sbjct  181  VGY  183



>dbj|BAB33422.1| putative senescence-associated protein [Pisum sativum]
Length=279

 Score =   198 bits (503),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +2

Query  224  KNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYC  403
            ++KYN P      RFTNKDIVAQIVSASIAGD++L +AYA+ELP YGLEVGLTNYAAAYC
Sbjct  22   QDKYNFPSI-VCCRFTNKDIVAQIVSASIAGDIVLCAAYAHELPHYGLEVGLTNYAAAYC  80

Query  404  TGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFg  583
            TGLLLARR+L+ LEMD+EYEGNVEA+GEDYSVEP +SRRPFRALLDVGL++TTTGNRVFG
Sbjct  81   TGLLLARRVLKTLEMDEEYEGNVEASGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFG  140

Query  584  alkgaldggldIPHSEKRFAGF  649
            ALKGALDGGLDIPHS+KRFAGF
Sbjct  141  ALKGALDGGLDIPHSDKRFAGF  162



>ref|XP_005843140.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
 gb|EFN51038.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
Length=295

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 152/183 (83%), Gaps = 1/183 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA  KVQK  AYF R+QVK+KRRR GKTDYRAR R+  QDKNKYNTPKYR VVRFTN+ +
Sbjct  1    MALTKVQKGSAYFSRYQVKYKRRRAGKTDYRARLRMCTQDKNKYNTPKYRLVVRFTNRTV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            V Q+  A++AGD ++ +AY++ELPRYGL+VGLTNYAAAYCTGLL+ARR+L KL +D+ YE
Sbjct  61   VCQVAYATMAGDKVICAAYSSELPRYGLKVGLTNYAAAYCTGLLVARRMLNKLGLDKHYE  120

Query  464  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            GN E  GEDY+VE   ++ RPF+ +LD GL RT+TG++VF ALKGALDGGLDIPH+EKRF
Sbjct  121  GNTEDVGEDYNVEAEDDAPRPFQCILDAGLKRTSTGSKVFAALKGALDGGLDIPHNEKRF  180

Query  641  AGF  649
             GF
Sbjct  181  VGF  183



>sp|Q627R7.2|RL5_CAEBR RecName: Full=60S ribosomal protein L5 [Caenorhabditis briggsae]
 emb|CAP22065.2| Protein CBR-RPL-5 [Caenorhabditis briggsae]
Length=294

 Score =   196 bits (499),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  1    MGLVKVIKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQ+  + I GD+++ASAYA+ELPRYGL+ GLTNYAAAY TGLLLARR L+ + +D  Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|NP_495811.1| Protein RPL-5 [Caenorhabditis elegans]
 sp|P49405.1|RL5_CAEEL RecName: Full=60S ribosomal protein L5 [Caenorhabditis elegans]
 emb|CAA90251.1| RPL-5 [Caenorhabditis elegans]
Length=293

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +KV K +AYFKR+QVK +RRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKD+
Sbjct  1    MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRITNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQ+  + I GD+++ASAY++ELPRYGL+VGLTNYAAAY TGLLLARR L+ + +D  Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYSHELPRYGLKVGLTNYAAAYATGLLLARRHLKTIGLDSTYK  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>gb|EGT59634.1| hypothetical protein CAEBREN_19650 [Caenorhabditis brenneri]
Length=293

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +KV K +AYFKR+QVK +RRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  1    MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQ+  + I GD+++ASAYA+ELPRYGL+ GLTNYAAAY TGLLLARR L+ + +D  Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_002630158.1| C. briggsae CBR-RPL-5 protein [Caenorhabditis briggsae]
Length=297

 Score =   196 bits (498),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  4    MGLVKVIKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  63

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQ+  + I GD+++ASAYA+ELPRYGL+ GLTNYAAAY TGLLLARR L+ + +D  Y+
Sbjct  64   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  123

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  124  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  183

Query  644  GF  649
            GF
Sbjct  184  GF  185



>gb|ERG79917.1| 60s ribosomal protein l5 [Ascaris suum]
Length=258

 Score =   195 bits (495),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKRFQVK KRRREGKTDY AR RL  QDKNKYNTPKYRF+VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRFIVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI  + I GD+I+ +AY++ELPRYG++VGLTNYAAAY TGLLLARR L KL M   Y+
Sbjct  61   IAQIAYSRIEGDVIVCAAYSHELPRYGIKVGLTNYAAAYATGLLLARRHLTKLNMADAYK  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G  E  GEDY+VE    R PFRA+LDVGL RTTTG ++F A+KG  DGG+DIPHSE RF 
Sbjct  121  GVEEVDGEDYNVEQEGERAPFRAVLDVGLARTTTGAKIFAAMKGVADGGIDIPHSETRFF  180

Query  644  GF  649
            G+
Sbjct  181  GY  182



>ref|XP_003117386.1| CRE-RPL-5 protein [Caenorhabditis remanei]
 gb|EFO86252.1| CRE-RPL-5 protein [Caenorhabditis remanei]
Length=293

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +KV K +AYFKR+QVK +RRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKD+
Sbjct  1    MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQ+  + I GD+++ASAY++ELPRYGL+ GLTNYAAAY TGLLLARR L+ + +D  Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYSHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSENRFF  180

Query  644  GF  649
            GF
Sbjct  181  GF  182



>ref|XP_005717676.1| unnamed protein product [Chondrus crispus]
 emb|CDF37805.1| unnamed protein product [Chondrus crispus]
Length=296

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MA +K  K +AY KR+Q K++RRREGKTDY+AR RL+ QDK KYN+P+YR VVRFTNKDI
Sbjct  1    MARVKFAKNKAYSKRYQTKWRRRREGKTDYQARRRLVTQDKRKYNSPRYRLVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + Q+V+A I GD IL SAYA+ELPRYG++ GLTN+AAAYC GLL ARR L KL +D+ Y+
Sbjct  61   ICQVVAARIQGDEILTSAYAHELPRYGIKHGLTNFAAAYCVGLLCARRHLSKLGLDELYK  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G  E +GE Y +E  + +RPF ALLD+GL RTTTG +VF  +KGA+DGG++IPH+EKRF 
Sbjct  121  GVEEVSGEMYEIEEDDEKRPFTALLDIGLTRTTTGKKVFATMKGAVDGGMNIPHNEKRFP  180

Query  644  GFT  652
             +T
Sbjct  181  AYT  183



>ref|XP_005536050.1| 60S ribosomal protein L5 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM79764.1| 60S ribosomal protein L5 [Cyanidioschyzon merolae strain 10D]
Length=298

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+KV K +AYFKRFQVK +RRREGKTDY AR  LI  DK KYNTPKYR VVR TN D+
Sbjct  1    MAFVKVVKNKAYFKRFQVKPRRRREGKTDYHARRALIIVDKTKYNTPKYRLVVRITNSDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QIV+A + GD ++A+AYA+ELPRYG++VGLTN+AAAY TGLL+ARR L  L +   Y+
Sbjct  61   ICQIVTARVEGDKVIAAAYAHELPRYGIKVGLTNFAAAYATGLLVARRTLTILGLADAYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G VEA GE Y VEP    RPFRA+LDVGL+RTTTG+RVF A+KGA+DGG+DIPHSEKRF 
Sbjct  121  GKVEADGELYQVEPVGETRPFRAVLDVGLVRTTTGHRVFAAMKGAVDGGIDIPHSEKRFP  180

Query  644  GF  649
             +
Sbjct  181  KY  182



>gb|ACZ13335.1| 60S ribosomal protein L5 [Bursaphelenchus xylophilus]
Length=297

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 147/183 (80%), Gaps = 1/183 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +KV K RAYFKRFQ K KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTNKD+
Sbjct  1    MGLVKVVKNRAYFKRFQTKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI  + I GD++++SAYA+ELPRYG++VGLTNYAAAY TGLLLARR L+ +++D  Y+
Sbjct  61   IAQIAYSKIGGDVVVSSAYAHELPRYGIKVGLTNYAAAYATGLLLARRHLKSIKLDTLYK  120

Query  464  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            G  E  GEDY+VE  G++  PF+A+LDVGL RTTTG +VF  +KG  DGG+++PHSE RF
Sbjct  121  GTEEVNGEDYNVEQEGDNPNPFQAVLDVGLARTTTGAKVFAVMKGVADGGINVPHSESRF  180

Query  641  AGF  649
             G+
Sbjct  181  YGY  183



>ref|XP_005706768.1| 60S ribosomal protein L5e [Galdieria sulphuraria]
 gb|EME30248.1| 60S ribosomal protein L5e [Galdieria sulphuraria]
Length=299

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKRFQVK +RRREGKTDYRAR +LI QD  KY++PKYR VVRFTN+DI
Sbjct  1    MVFVKVVKNKAYFKRFQVKPRRRREGKTDYRARLKLITQDLRKYSSPKYRLVVRFTNRDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            V Q V A + GD IL++AYA+ELPRYG++VGLTN+AAAY TGLLLARR L+KL +D+ Y 
Sbjct  61   VCQFVYARLEGDHILSAAYAHELPRYGIKVGLTNFAAAYATGLLLARRTLKKLNLDEVYV  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G     GE + VEP   RRPFRA LDVGLIRTTTGN+VF A+KGA+DGG+DIPH+EKRF 
Sbjct  121  GKESVDGEFFEVEPQGERRPFRAFLDVGLIRTTTGNKVFAAMKGAVDGGVDIPHNEKRFP  180

Query  644  GFT  652
             +T
Sbjct  181  KYT  183



>gb|KDD76608.1| ribosomal L18p/L5e [Helicosporidium sp. ATCC 50920]
Length=290

 Score =   194 bits (492),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +KV K  +Y+ R+QVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MPAMKVVKNSSYYSRYQVKYRRRREGKTDYRARLRLVTQDKNKYNTPKYRMVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            V Q+  +++AGD+++ASAY++ELP+YGL VGLTNYAAAY TGLLLARR+L K  + + Y 
Sbjct  61   VCQLAYSTLAGDVVVASAYSHELPKYGLTVGLTNYAAAYATGLLLARRVLSKYNLAKAYA  120

Query  464  GNVEATGEDYSVEPGE-SRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            GN E  GEDY+VE  E  +RPF ALLD GL RT+TG++VF ALKGALDGGLD+PHSEKRF
Sbjct  121  GNTEDVGEDYNVEEIEGEKRPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVPHSEKRF  180

Query  641  AGFT  652
             G++
Sbjct  181  VGYS  184



>gb|ABO26701.1| ribosomal protein l5 [Haliotis discus discus]
Length=251

 Score =   192 bits (487),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 155/184 (84%), Gaps = 3/184 (2%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKRFQVKF+RRREG+TDY AR RLI Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGRTDYFARKRLIFQEKNKYNTPKYRLIVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QI  A I GD+I+A+AY++ELPRYG++VGLTNYAAAYCTGLLLARRLLQKL++D  Y 
Sbjct  61   ICQIAYARIEGDIIIAAAYSHELPRYGVKVGLTNYAAAYCTGLLLARRLLQKLKLDSIYT  120

Query  464  GNVEATGEDYSVEPGESRRP--FRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKR  637
            G  EA GE+Y VE  E  +P  FRA LD+GL+RTTTG RVFGALKGA+DGG+DIPHS KR
Sbjct  121  GVEEANGEEYYVED-EDGKPGAFRAYLDIGLVRTTTGARVFGALKGAVDGGIDIPHSMKR  179

Query  638  FAGF  649
            F GF
Sbjct  180  FPGF  183



>gb|EPZ34992.1| 60S ribosomal protein L5 [Rozella allomycis CSF55]
Length=297

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 149/183 (81%), Gaps = 1/183 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+K  K +AYFKRFQ K++RRREGKTDY AR RLI QDKNKYN+PKYR VVRFTNKDI
Sbjct  1    MPFVKEIKNKAYFKRFQTKYRRRREGKTDYYARKRLIIQDKNKYNSPKYRMVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + Q+V A I GD+++ASAYA+ELPRYG++VGLTNYAAAYC GLLLARR+L K  +  +YE
Sbjct  61   ICQMVYARIQGDVVIASAYAHELPRYGVQVGLTNYAAAYCVGLLLARRVLTKFNLASKYE  120

Query  464  GNVEATGEDYSVEPGES-RRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            G  EA GE ++VE  E   RPF+A LDVGL RT+TG RVFGA+KGA DGG+ IPHSEKRF
Sbjct  121  GQTEADGEIFNVEAIEDGPRPFKAYLDVGLRRTSTGARVFGAMKGAADGGIFIPHSEKRF  180

Query  641  AGF  649
             G+
Sbjct  181  PGY  183



>gb|KIY93440.1| 60S ribosomal protein L5 [Monoraphidium neglectum]
Length=199

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++KV KT AYF R+QVK++RRR+GKTDYRAR RL  QDKNKYNT KYR VVRF+NKD+
Sbjct  1    MGYVKVLKTSAYFSRYQVKYRRRRQGKTDYRARLRLCTQDKNKYNTHKYRLVVRFSNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
              Q+V ASIAGD+++A+AYA+ELP+YGL VGL NYAAAYC GLLLARR+L K  + + Y 
Sbjct  61   TCQVVYASIAGDVVVAAAYAHELPKYGLSVGLKNYAAAYCVGLLLARRVLTKFGLAEHYA  120

Query  464  GNVEATGEDYSVEPGE-SRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            G  E  GEDY+V+P E   RPF  LLD GL RT+TG++ F ALKGALDGGLDIPH+EKRF
Sbjct  121  GQEEPDGEDYNVDPVEDGPRPFSCLLDAGLKRTSTGSKTFAALKGALDGGLDIPHNEKRF  180

Query  641  AGFT  652
             G+T
Sbjct  181  VGWT  184



>ref|XP_008049787.1| PREDICTED: 60S ribosomal protein L5, partial [Tarsius syrichta]
Length=199

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 148/183 (81%), Gaps = 1/183 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QI  A I GD+I+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL    MD+ YE
Sbjct  61   ICQIAYARIEGDVIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNSFGMDKTYE  120

Query  464  GNVEATGEDYSVEPGESRR-PFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            G VE TG++Y+VE  + +   F   LD GL RTTTGN+VFGALKGA+DGGL IPHS KRF
Sbjct  121  GQVEVTGDEYNVESVDGKAGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF  180

Query  641  AGF  649
             G+
Sbjct  181  PGY  183



>ref|XP_005107604.1| PREDICTED: 60S ribosomal protein L5-like [Aplysia californica]
Length=294

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 151/187 (81%), Gaps = 9/187 (5%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K++AYFKRFQVKFKRRREG TDY AR RLI QDKNKYNTPKYR +VRF+NKDI
Sbjct  1    MGFVKVVKSKAYFKRFQVKFKRRREGVTDYYARKRLIFQDKNKYNTPKYRLIVRFSNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            V QI  A I GD+I+ +AYA+ELPRYG++VGLTNYAAAYCTGLLLARRLL+K  +DQ YE
Sbjct  61   VCQIAYARIEGDVIVCAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLKKFGLDQTYE  120

Query  464  GNVEATGEDYSVE-----PGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHS  628
            G VE  GE++ VE     PG     FRA LDVGL RTTTG RVFGALKGA DGG+DIPHS
Sbjct  121  GQVEPDGEEFCVEDVDGAPG----AFRAYLDVGLARTTTGARVFGALKGAADGGIDIPHS  176

Query  629  EKRFAGF  649
             +RF G+
Sbjct  177  NRRFPGY  183



>ref|XP_003767272.1| PREDICTED: 60S ribosomal protein L5 [Sarcophilus harrisii]
Length=344

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 160/219 (73%), Gaps = 12/219 (5%)
 Frame = +2

Query  17   FKLLRALPRSSYLSPQETPLRG*S---SSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKT  187
            F+  R   R+S   P E  +R      S +    F+KV K +AYFKR+QVKF+RRREGKT
Sbjct  16   FRGRRVFARASVWGPSEERVRKAGRTLSLSLSKGFVKVVKNKAYFKRYQVKFRRRREGKT  75

Query  188  DYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGL  367
            DY AR RL+ QDKNKYNTPKYR +VR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG+
Sbjct  76   DYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGV  135

Query  368  EVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVE-----PGESRRPFRA  532
            +VGLTNYAAAYCTGLLLARRLL +  MD+ YEG VE TG++Y+VE     PG     F  
Sbjct  136  KVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPG----AFTC  191

Query  533  LLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  649
             LD GL RTTTGN+VFGALKGA+DGGL IPHS KRF G+
Sbjct  192  YLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGY  230



>ref|XP_001689859.1| ribosomal protein L5, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09597.1| ribosomal protein L5 [Chlamydomonas reinhardtii]
Length=293

 Score =   191 bits (486),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 146/183 (80%), Gaps = 1/183 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M ++KV KT  YF RFQVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR VVRFTN+DI
Sbjct  1    MGYVKVIKTSPYFSRFQVKYRRRREGKTDYRARLRLVKQDKNKYNTPKYRLVVRFTNRDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
              QIV ++I GD++ A+AYA+ELP YGLE GLTNYAA YC GLL+ARR+L K  +D+ Y 
Sbjct  61   TCQIVRSTIKGDIVEAAAYAHELPDYGLECGLTNYAACYCVGLLVARRILTKFGLDKHYP  120

Query  464  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            G  E  GEDY++EP  E  RPF  LLD GL RT+TG++VFG LKGALDGGLDIPH+EKR 
Sbjct  121  GQTEPDGEDYNIEPVEEGPRPFFCLLDTGLKRTSTGSKVFGCLKGALDGGLDIPHNEKRL  180

Query  641  AGF  649
             G+
Sbjct  181  VGY  183



>gb|KHJ46023.1| ribosomal L18p/L5e family protein [Trichuris suis]
Length=305

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKR+QVKF+RRR+GKTDY+AR  L+ QDKNKYNTPKYR +VR TNKD+
Sbjct  1    MGFLKVVKNKAYFKRYQVKFRRRRQGKTDYQARRFLVVQDKNKYNTPKYRLIVRITNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI  A I GD++L SAY++ELPRYG++VGLTNYAAAYCTGLLLARR L+K  +D  Y+
Sbjct  61   VAQIAYAKIGGDVVLTSAYSHELPRYGVKVGLTNYAAAYCTGLLLARRHLKKRNLDSVYK  120

Query  464  GNVEATGEDYSVEPGESRR-PFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            G  EATGEDY+VE  E +   FR  LDVGL RTTTG+RVFG +KGA+DGGLDIPH  +RF
Sbjct  121  GVEEATGEDYNVESEEGQPGAFRCFLDVGLARTTTGSRVFGVMKGAVDGGLDIPHEHRRF  180

Query  641  AGF  649
             G+
Sbjct  181  PGY  183



>tpg|DAA34076.1| TPA_exp: 60S ribosomal protein L5 [Amblyomma variegatum]
Length=210

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 150/184 (82%), Gaps = 3/184 (2%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RL+ QDKNKYN+PKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARRRLVVQDKNKYNSPKYRMIVRITNRDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QI  A I GD+I+ +AYA+ELPRYG+ +GLTNY AAYCTGLLLARR+LQK ++D+ Y+
Sbjct  61   ICQIAYARIEGDVIVCAAYAHELPRYGVRLGLTNYPAAYCTGLLLARRMLQKFKLDEVYK  120

Query  464  GNVEATGEDYSVEPGESRRP--FRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKR  637
            G  EATGEDY VE  E  +P  FR  LDVGL RTTTG R+FG LKGA+DGG+DIPHS KR
Sbjct  121  GCEEATGEDYCVES-EDGQPGAFRCFLDVGLARTTTGARIFGCLKGAVDGGMDIPHSNKR  179

Query  638  FAGF  649
            F G+
Sbjct  180  FPGY  183



>ref|XP_004171975.1| PREDICTED: 60S ribosomal protein L5-like, partial [Cucumis sativus]
Length=246

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  269  TNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEM  448
            TNKDI AQIVS+SIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLL+ARR+L+KLEM
Sbjct  1    TNKDITAQIVSSSIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLVARRVLKKLEM  60

Query  449  DQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHS  628
            D EYEGN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS
Sbjct  61   DDEYEGNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHS  120

Query  629  EKRFAGFT  652
             KRFAGF+
Sbjct  121  VKRFAGFS  128



>gb|KDO24705.1| hypothetical protein SPRG_10239 [Saprolegnia parasitica CBS 223.65]
Length=299

 Score =   191 bits (485),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 145/192 (76%), Gaps = 10/192 (5%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+KV K++AYFKR+Q K++RRREGKTDYRAR RLI QDKNKYN+PKYR VVR TNK +
Sbjct  1    MAFVKVNKSKAYFKRYQTKYRRRREGKTDYRARKRLITQDKNKYNSPKYRLVVRITNKRV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QI  A I GD ILASAY++EL RYGL+ G  NY AAYCTGLL+ RRLL KL +D +YE
Sbjct  61   ICQIAYAEIDGDKILASAYSDELKRYGLKCGFKNYPAAYCTGLLVGRRLLNKLGLDGDYE  120

Query  464  GNVEATGED----------YSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggl  613
            GN E  GE           Y  E  + +RPFRA LDVGL  T+TGNRVFGALKGA D GL
Sbjct  121  GNTEVDGEVVKTEANGRTYYVAEVADEKRPFRAFLDVGLRSTSTGNRVFGALKGATDAGL  180

Query  614  dIPHSEKRFAGF  649
            DIPHSEKRF G+
Sbjct  181  DIPHSEKRFPGY  192



>ref|NP_001104213.1| uncharacterized protein LOC100126642 [Xenopus laevis]
 gb|AAI53791.1| LOC100126642 protein [Xenopus laevis]
Length=302

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K+ K +AY+KRFQVK++RRREGKTDY AR RL+ Q KNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKLVKNKAYYKRFQVKYRRRREGKTDYYARKRLVAQSKNKYNTPKYRLVVRFTNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQ+  A I GD I+A+AY++ELPRYG++VGLTNYAA Y TGLL+ARRLL KL +  +YE
Sbjct  61   IAQVAYAKIEGDQIIAAAYSHELPRYGIKVGLTNYAACYATGLLVARRLLTKLGLADQYE  120

Query  464  GNVEAT--GED---YSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHS  628
            GN EA   GED   Y VE     RPFR  LDVGL+RTTTG +VF  +KGA+DGGLDIPH+
Sbjct  121  GNTEAAAPGEDGGLYHVEAEGDSRPFRCFLDVGLVRTTTGAKVFAVMKGAVDGGLDIPHN  180

Query  629  EKRFAGF  649
            EKRF G+
Sbjct  181  EKRFPGY  187



>emb|CDI98331.1| ribosomal protein l5 [Echinococcus multilocularis]
Length=299

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +KV K +AYFKRFQVKF+RRREGKTDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGLVKVTKNKAYFKRFQVKFRRRREGKTDYYARKRLIWQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            V QI+ A + GD ++A+AY++ELPRYG+++GLTNY+AAYCTGLLLARR+L+KL++D  Y+
Sbjct  61   VCQIIYACMDGDRVVATAYSHELPRYGVKIGLTNYSAAYCTGLLLARRVLKKLKLDGLYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G  E  GE+Y VE  E R  F+  LDVGL RT++G  +FGALKGA+DGGL+IPHS KRF 
Sbjct  121  GQTEVNGENYLVESKEKRGAFKCFLDVGLRRTSSGANIFGALKGAVDGGLNIPHSSKRFP  180

Query  644  G  646
            G
Sbjct  181  G  181



>gb|ACN25149.1| ribosomal-like protein [Pectinaria gouldii]
Length=269

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = +2

Query  107  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  286
             F+KVQKT AYF R+QVKFKRRREGKTDY AR RLI QDKNKYNTPKYR +VRFTNKDI+
Sbjct  3    GFVKVQKTTAYFSRYQVKFKRRREGKTDYFARKRLICQDKNKYNTPKYRLIVRFTNKDII  62

Query  287  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  466
             QI  A IAGD I+ SAYA+ELPRYGL+VGLTNY+AAYCTGLL+ARR+L+KL +DQ YE 
Sbjct  63   TQIAYARIAGDFIICSAYAHELPRYGLKVGLTNYSAAYCTGLLMARRVLKKLNLDQVYEV  122

Query  467  NVEATGEDYSVEP--GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            N E   E+Y VEP  GES  P +  LDVGL RT+TG ++F  LKGA DGGL+IPH  KRF
Sbjct  123  NTEVQ-EEYHVEPKDGES-DPLKVYLDVGLSRTSTGTKLFSVLKGASDGGLNIPHGTKRF  180

Query  641  AG  646
             G
Sbjct  181  IG  182



>emb|CDS19989.1| ribosomal protein l5 [Echinococcus granulosus]
Length=299

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M  +KV K +AYFKRFQVKF+RRREGKTDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGLVKVTKNKAYFKRFQVKFRRRREGKTDYYARKRLIWQDKNKYNTPKYRFVVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            V QI+ A + GD ++A+AY++ELPRYG+++GLTNY+AAYCTGLLLARR+L+KL++D  Y+
Sbjct  61   VCQIIYACMDGDRVVATAYSHELPRYGVKIGLTNYSAAYCTGLLLARRVLKKLKLDGLYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G  E  GE+Y VE  E R  F+  LDVGL RT++G  +FGALKGA+DGGL+IPHS KRF 
Sbjct  121  GQTEVNGENYLVESKEKRGAFKCFLDVGLRRTSSGANIFGALKGAVDGGLNIPHSSKRFP  180

Query  644  G  646
            G
Sbjct  181  G  181



>ref|XP_010948703.1| PREDICTED: 60S ribosomal protein L5 [Camelus bactrianus]
Length=329

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 152/192 (79%), Gaps = 1/192 (1%)
 Frame = +2

Query  77   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRF  256
            RG  S    M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR 
Sbjct  24   RGLGSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  83

Query  257  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  436
            VVR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  84   VVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  143

Query  437  klEMDQEYEGNVEATGEDYSVEPGESR-RPFRALLDVGLIRTTTGNRVFgalkgaldggl  613
            +  MD+ YEG VE TG++Y+VE  + +   F   LD GL RTTTGN+VFGALKGA+DGGL
Sbjct  144  RFGMDKIYEGQVEVTGDEYNVESIDGQPSAFTCYLDAGLARTTTGNKVFGALKGAVDGGL  203

Query  614  dIPHSEKRFAGF  649
             IPHS KRF G+
Sbjct  204  SIPHSTKRFPGY  215



>gb|KFD48731.1| hypothetical protein M513_10361 [Trichuris suis]
 gb|KFD67918.1| hypothetical protein M514_10361 [Trichuris suis]
Length=347

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKR+QVKF+RRR+GKTDY+AR  L+ QDKNKYNTPKYR +VR TNKD+
Sbjct  1    MGFLKVVKNKAYFKRYQVKFRRRRQGKTDYQARRFLVVQDKNKYNTPKYRLIVRITNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            VAQI  A I GD++L SAY++ELPRYG++VGLTNYAAAYCTGLLLARR L+K  +D  Y+
Sbjct  61   VAQIAYAKIGGDVVLTSAYSHELPRYGVKVGLTNYAAAYCTGLLLARRHLKKRNLDSVYK  120

Query  464  GNVEATGEDYSVEPGESRR-PFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            G  EATGEDY+VE  E +   FR  LDVGL RTTTG+RVFG +KGA+DGGLDIPH  +RF
Sbjct  121  GVEEATGEDYNVESEEGQPGAFRCFLDVGLARTTTGSRVFGVMKGAVDGGLDIPHEHRRF  180

Query  641  AGF  649
             G+
Sbjct  181  PGY  183



>gb|KHG14330.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 134/183 (73%), Gaps = 39/183 (21%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDDEYQ  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            GNVE                    LD GL                     DIPHS+KRFA
Sbjct  121  GNVEGA------------------LDAGL---------------------DIPHSDKRFA  141

Query  644  GFT  652
            GF+
Sbjct  142  GFS  144



>ref|XP_002588187.1| hypothetical protein BRAFLDRAFT_113823 [Branchiostoma floridae]
 gb|EEN44198.1| hypothetical protein BRAFLDRAFT_113823 [Branchiostoma floridae]
Length=322

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 153/183 (84%), Gaps = 1/183 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKRFQVKF+RRREG TDY AR RL+ Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGVTDYYARKRLVIQEKNKYNTPKYRLIVRFTNKDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + Q+  A I GD+I+++AYA+ELPRYG++VGLTNYAAAYCTGLLLARR+L+K  +D  YE
Sbjct  61   ICQVAYARIEGDIIVSAAYAHELPRYGIKVGLTNYAAAYCTGLLLARRILKKFSLDTIYE  120

Query  464  GNVEATGEDYSVEPGESR-RPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            G  +  G++Y+VE  + + RPFR  LDVGL+RT+TG RVFGA+KGA+DGGLDIPHS KRF
Sbjct  121  GCTDIDGDEYNVEEVDGQPRPFRCFLDVGLVRTSTGARVFGAMKGAVDGGLDIPHSTKRF  180

Query  641  AGF  649
             G+
Sbjct  181  PGY  183



>gb|EJW84695.1| 60S ribosomal protein L5 [Wuchereria bancrofti]
Length=295

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTN+D+
Sbjct  1    MGFVKVVKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNRDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI  + I GD+++ SAY++ELPRYG++VGLTNYA+AY TGLLLARR L  + + + Y+
Sbjct  61   IAQIAYSRIEGDVVVCSAYSHELPRYGIKVGLTNYASAYATGLLLARRHLLNIGLAETYK  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G  EATG+DY+VE    R PFRA+LDVGL RT TG +VF  +KG  DGG+D+PHSE RF 
Sbjct  121  GVEEATGDDYNVEKEGERAPFRAVLDVGLARTVTGAKVFAVMKGVADGGVDVPHSETRFF  180

Query  644  GF  649
            G+
Sbjct  181  GY  182



>gb|KGG50093.1| 60S ribosomal protein L5-2 [Microsporidia sp. UGP3]
Length=329

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 153/188 (81%), Gaps = 3/188 (2%)
 Frame = +2

Query  98   APMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  277
            A M F+K+ K +AYFKRFQVK++RRREGKTDY AR RL+ Q KNKYNTPKYR VVR TN 
Sbjct  29   ASMPFVKLVKNKAYFKRFQVKYRRRREGKTDYYARKRLVVQAKNKYNTPKYRLVVRITNT  88

Query  278  DIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQE  457
            DIV QI+ A I GD++ ASAYA+ELPRYG++VGLTN+A+AYCTGLL ARR L KL +D +
Sbjct  89   DIVCQIMYARIQGDIVFASAYAHELPRYGVKVGLTNFASAYCTGLLCARRALAKLGLDSK  148

Query  458  YEGNVEATGEDY---SVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHS  628
            YEG  +A GE +   S+E  +S RPF+A LDVGL RTTTG+R+FGALKGA+DGG+ +PHS
Sbjct  149  YEGKAKADGEYFLVDSIEGDDSPRPFKAFLDVGLSRTTTGSRIFGALKGAVDGGIYVPHS  208

Query  629  EKRFAGFT  652
            ++RF G++
Sbjct  209  DRRFPGYS  216



>ref|XP_001897856.1| 60S ribosomal protein L5 [Brugia malayi]
 emb|CDP94073.1| Protein BM-RPL-5, isoform b [Brugia malayi]
Length=295

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTN+D+
Sbjct  1    MGFVKVVKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNRDV  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            +AQI  + I GD+++ SAY++ELPRYG++VGLTNYA+AY TGLLLARR L  + + + Y+
Sbjct  61   IAQIAYSRIEGDVVVCSAYSHELPRYGIKVGLTNYASAYATGLLLARRHLLNIGLAEAYK  120

Query  464  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  643
            G  EATG+DY+VE    R PFRA+LDVGL RT TG +VF  +KG  DGG+D+PHSE RF 
Sbjct  121  GVEEATGDDYNVEKEGERAPFRAVLDVGLARTVTGAKVFAVMKGVADGGIDVPHSETRFF  180

Query  644  GF  649
            G+
Sbjct  181  GY  182



>ref|XP_006197385.1| PREDICTED: 60S ribosomal protein L5 [Vicugna pacos]
Length=297

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 149/183 (81%), Gaps = 1/183 (1%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR VVR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMVVRVTNRDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD+ YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  464  GNVEATGEDYSVEPGESR-RPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  640
            G VE TG++Y+VE  + +   F   LD GL RTTTGN+VFGALKGA+DGGL IPHS KRF
Sbjct  121  GQVEVTGDEYNVESIDGQPSAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF  180

Query  641  AGF  649
             G+
Sbjct  181  PGY  183



>ref|XP_002434050.1| 60S ribosomal protein L5, putative [Ixodes scapularis]
 gb|EEC05450.1| 60S ribosomal protein L5, putative [Ixodes scapularis]
Length=297

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 151/187 (81%), Gaps = 9/187 (5%)
 Frame = +2

Query  104  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  283
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARRRLVVQDKNKYNTPKYRMIVRITNRDI  60

Query  284  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  463
            + Q+  A I GD+I+ +AYA+ELPRYG+++GLTNYAAAYCTGLLLARR+LQK ++D+ Y+
Sbjct  61   ICQVAYARIEGDVIVCAAYAHELPRYGVKLGLTNYAAAYCTGLLLARRMLQKFKLDEIYK  120

Query  464  GNVEATGEDYSVE-----PGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHS  628
            G  EA GEDY VE     PG     FR  LDVGL RTTTG R+FGALKGA+DGG+DIPHS
Sbjct  121  GQEEANGEDYCVESIDGQPG----AFRCFLDVGLARTTTGARIFGALKGAVDGGMDIPHS  176

Query  629  EKRFAGF  649
             KRF G+
Sbjct  177  NKRFPGY  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250