BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF025A08

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13254.1|  unnamed protein product                                340   1e-110   Coffea canephora [robusta coffee]
ref|XP_002515055.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    338   1e-109   Ricinus communis
gb|KHG05074.1|  Endoglucanase                                           338   2e-109   Gossypium arboreum [tree cotton]
gb|KJB15656.1|  hypothetical protein B456_002G188600                    337   3e-109   Gossypium raimondii
ref|XP_009765489.1|  PREDICTED: uncharacterized protein LOC104217035    337   4e-109   Nicotiana sylvestris
gb|KDO82155.1|  hypothetical protein CISIN_1g008330mg                   332   8e-109   Citrus sinensis [apfelsine]
ref|XP_011034023.1|  PREDICTED: uncharacterized protein LOC105132312    335   3e-108   Populus euphratica
ref|XP_002312657.2|  hypothetical protein POPTR_0008s18380g             334   4e-108   Populus trichocarpa [western balsam poplar]
ref|XP_006378253.1|  hypothetical protein POPTR_0010s059502g            328   1e-107   
ref|XP_002285424.1|  PREDICTED: uncharacterized protein LOC100244027    332   2e-107   Vitis vinifera
ref|XP_007223308.1|  hypothetical protein PRUPE_ppa003807mg             332   2e-107   Prunus persica
ref|XP_006438205.1|  hypothetical protein CICLE_v10031098mg             332   3e-107   Citrus clementina [clementine]
gb|KDO82151.1|  hypothetical protein CISIN_1g008330mg                   332   4e-107   Citrus sinensis [apfelsine]
ref|XP_004245178.1|  PREDICTED: uncharacterized protein LOC101258288    332   5e-107   
ref|XP_006483983.1|  PREDICTED: uncharacterized protein LOC102624331    332   8e-107   Citrus sinensis [apfelsine]
ref|XP_009359244.1|  PREDICTED: uncharacterized protein LOC103949843    330   9e-107   Pyrus x bretschneideri [bai li]
ref|XP_008221942.1|  PREDICTED: uncharacterized protein LOC103321869    330   2e-106   
ref|XP_011042367.1|  PREDICTED: uncharacterized protein LOC105138074    329   3e-106   Populus euphratica
ref|XP_006367511.1|  PREDICTED: uncharacterized protein LOC102589547    329   3e-106   
ref|XP_004239150.1|  PREDICTED: uncharacterized protein LOC101248575    329   7e-106   Solanum lycopersicum
ref|XP_002315653.2|  hypothetical protein POPTR_0010s05960g             322   8e-106   
ref|XP_010250986.1|  PREDICTED: uncharacterized protein LOC104593039    329   8e-106   Nelumbo nucifera [Indian lotus]
ref|XP_011042368.1|  PREDICTED: uncharacterized protein LOC105138075    328   9e-106   Populus euphratica
gb|KDP26669.1|  hypothetical protein JCGZ_17827                         326   5e-105   Jatropha curcas
ref|XP_010248702.1|  PREDICTED: uncharacterized protein LOC104591536    325   1e-104   Nelumbo nucifera [Indian lotus]
ref|XP_007159685.1|  hypothetical protein PHAVU_002G258500g             322   2e-103   Phaseolus vulgaris [French bean]
ref|XP_007044872.1|  Cellulase protein                                  322   3e-103   
ref|XP_008389746.1|  PREDICTED: uncharacterized protein LOC103452050    320   2e-102   
ref|XP_010100346.1|  hypothetical protein L484_027655                   320   2e-102   
gb|EYU30606.1|  hypothetical protein MIMGU_mgv1a018920mg                318   2e-102   Erythranthe guttata [common monkey flower]
ref|XP_010904543.1|  PREDICTED: uncharacterized protein LOC105031942    319   3e-102   Elaeis guineensis
gb|KEH20742.1|  cellulase (glycosyl hydrolase family 5)                 317   2e-101   Medicago truncatula
ref|XP_003539156.1|  PREDICTED: uncharacterized protein LOC100816102    316   3e-101   Glycine max [soybeans]
gb|AES72136.2|  cellulase (glycosyl hydrolase family 5)                 318   3e-101   Medicago truncatula
ref|XP_007132485.1|  hypothetical protein PHAVU_011G098000g             315   4e-101   Phaseolus vulgaris [French bean]
ref|XP_003601885.1|  Endoglucanase                                      318   5e-101   
ref|XP_008446127.1|  PREDICTED: uncharacterized protein LOC103488945    315   8e-101   Cucumis melo [Oriental melon]
ref|XP_004135502.1|  PREDICTED: uncharacterized protein LOC101217177    314   1e-100   
gb|KGN51727.1|  hypothetical protein Csa_5G593400                       314   2e-100   Cucumis sativus [cucumbers]
ref|XP_008793719.1|  PREDICTED: uncharacterized protein LOC103709945    313   3e-100   
ref|XP_010682344.1|  PREDICTED: uncharacterized protein LOC104897211    314   3e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004504142.1|  PREDICTED: uncharacterized protein LOC101503968    312   9e-100   Cicer arietinum [garbanzo]
ref|XP_008236799.1|  PREDICTED: uncharacterized protein LOC103335561    311   1e-99    Prunus mume [ume]
ref|XP_004309996.1|  PREDICTED: uncharacterized protein LOC101307271    311   2e-99    Fragaria vesca subsp. vesca
gb|KHN29014.1|  Endoglucanase                                           310   3e-99    Glycine soja [wild soybean]
ref|XP_003532808.1|  PREDICTED: uncharacterized protein LOC100818309    310   1e-98    Glycine max [soybeans]
ref|XP_008389747.1|  PREDICTED: uncharacterized protein LOC103452051    308   3e-98    
ref|XP_010249431.1|  PREDICTED: uncharacterized protein LOC104591975    308   4e-98    Nelumbo nucifera [Indian lotus]
gb|KJB78033.1|  hypothetical protein B456_012G173600                    308   1e-97    Gossypium raimondii
ref|XP_010044528.1|  PREDICTED: uncharacterized protein LOC104433472    306   4e-97    Eucalyptus grandis [rose gum]
ref|XP_003524249.1|  PREDICTED: uncharacterized protein LOC100789885    305   1e-96    Glycine max [soybeans]
gb|KHN06534.1|  Endoglucanase                                           305   1e-96    Glycine soja [wild soybean]
ref|XP_009387346.1|  PREDICTED: uncharacterized protein LOC103974285    301   1e-96    
ref|XP_004504189.1|  PREDICTED: uncharacterized protein LOC101490831    303   2e-96    Cicer arietinum [garbanzo]
ref|XP_010250979.1|  PREDICTED: uncharacterized protein LOC104593...    296   7e-94    
ref|XP_011086688.1|  PREDICTED: uncharacterized protein LOC105168334    297   2e-93    Sesamum indicum [beniseed]
gb|AAD31066.1|AC007357_15  F3F19.15                                     294   4e-93    Arabidopsis thaliana [mouse-ear cress]
emb|CDY40992.1|  BnaA02g27820D                                          291   4e-93    Brassica napus [oilseed rape]
ref|NP_172772.2|  Cellulase (glycosyl hydrolase family 5) protein       295   6e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292902.1|  hypothetical protein CARUB_v10019167mg             293   9e-93    
ref|XP_003552802.1|  PREDICTED: uncharacterized protein LOC100805196    293   1e-92    Glycine max [soybeans]
ref|XP_010458756.1|  PREDICTED: uncharacterized protein LOC104739...    293   1e-92    
ref|XP_006307168.1|  hypothetical protein CARUB_v10008758mg             294   1e-92    Capsella rubella
ref|XP_006417151.1|  hypothetical protein EUTSA_v10007253mg             294   1e-92    Eutrema salsugineum [saltwater cress]
gb|KCW59703.1|  hypothetical protein EUGRSUZ_H02464                     291   2e-92    Eucalyptus grandis [rose gum]
ref|XP_010495004.1|  PREDICTED: uncharacterized protein LOC104772051    293   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_009385963.1|  PREDICTED: uncharacterized protein LOC103973...    293   3e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010458755.1|  PREDICTED: uncharacterized protein LOC104739...    293   4e-92    Camelina sativa [gold-of-pleasure]
ref|XP_007159684.1|  hypothetical protein PHAVU_002G258400g             293   4e-92    Phaseolus vulgaris [French bean]
ref|XP_009385956.1|  PREDICTED: uncharacterized protein LOC103973...    293   6e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010250982.1|  PREDICTED: uncharacterized protein LOC104593...    291   1e-91    
ref|XP_010691763.1|  PREDICTED: uncharacterized protein LOC104905020    291   1e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009152076.1|  PREDICTED: uncharacterized protein LOC103875318    291   1e-91    Brassica rapa
ref|XP_002876948.1|  glycosyl hydrolase family 5 protein                290   1e-91    
emb|CDY13613.1|  BnaA06g33100D                                          291   1e-91    Brassica napus [oilseed rape]
ref|XP_010249430.1|  PREDICTED: uncharacterized protein LOC104591974    290   2e-91    
ref|XP_002889989.1|  glycosyl hydrolase family 5 protein                291   2e-91    Arabidopsis lyrata subsp. lyrata
ref|XP_006395579.1|  hypothetical protein EUTSA_v10003968mg             289   2e-91    
emb|CDX83590.1|  BnaC07g23300D                                          291   2e-91    
ref|XP_010514260.1|  PREDICTED: uncharacterized protein LOC104790246    289   3e-91    
ref|XP_006395580.1|  hypothetical protein EUTSA_v10003968mg             290   5e-91    Eutrema salsugineum [saltwater cress]
ref|XP_010026597.1|  PREDICTED: uncharacterized protein LOC104416968    289   5e-91    
ref|XP_010476303.1|  PREDICTED: uncharacterized protein LOC104755594    290   5e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010425288.1|  PREDICTED: uncharacterized protein LOC104710406    290   5e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010026596.1|  PREDICTED: uncharacterized protein LOC104416965    288   6e-91    
emb|CDY16066.1|  BnaC08g40570D                                          290   6e-91    Brassica napus [oilseed rape]
gb|KFK43579.1|  hypothetical protein AALP_AA1G144700                    292   7e-91    Arabis alpina [alpine rockcress]
gb|KCW59699.1|  hypothetical protein EUGRSUZ_H02457                     289   7e-91    Eucalyptus grandis [rose gum]
ref|XP_010026595.1|  PREDICTED: uncharacterized protein LOC104416964    288   1e-90    Eucalyptus grandis [rose gum]
ref|NP_189245.1|  Cellulase (glycosyl hydrolase family 5) protein       288   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010026599.1|  PREDICTED: uncharacterized protein LOC104416971    285   1e-90    Eucalyptus grandis [rose gum]
ref|XP_010026600.1|  PREDICTED: uncharacterized protein LOC104416972    291   2e-90    Eucalyptus grandis [rose gum]
ref|XP_009152075.1|  PREDICTED: uncharacterized protein LOC103875317    287   3e-90    Brassica rapa
ref|XP_010502524.1|  PREDICTED: uncharacterized protein LOC104779826    286   6e-90    
dbj|BAK05121.1|  predicted protein                                      286   1e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY19395.1|  BnaC05g09040D                                          285   2e-89    Brassica napus [oilseed rape]
gb|ACU18247.1|  unknown                                                 274   2e-89    Glycine max [soybeans]
ref|XP_006395581.1|  hypothetical protein EUTSA_v10003934mg             285   5e-89    
ref|NP_001130915.1|  hydrolase, hydrolyzing O-glycosyl compound p...    285   6e-89    Zea mays [maize]
gb|ACF79301.1|  unknown                                                 285   6e-89    Zea mays [maize]
ref|XP_006290844.1|  hypothetical protein CARUB_v10016955mg             284   1e-88    
ref|XP_010556350.1|  PREDICTED: uncharacterized protein LOC104825676    284   1e-88    Tarenaya hassleriana [spider flower]
ref|XP_009148543.1|  PREDICTED: uncharacterized protein LOC103871957    283   2e-88    Brassica rapa
ref|XP_010528075.1|  PREDICTED: uncharacterized protein LOC104805267    283   5e-88    Tarenaya hassleriana [spider flower]
ref|NP_189244.1|  Cellulase (glycosyl hydrolase family 5) protein       282   6e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006648806.1|  PREDICTED: uncharacterized protein LOC102721430    275   6e-88    
emb|CDX98009.1|  BnaA06g07600D                                          282   7e-88    
dbj|BAB02432.1|  unnamed protein product                                282   8e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284888.2|  PREDICTED: uncharacterized protein LOC100258876    280   1e-87    Vitis vinifera
ref|XP_002446675.1|  hypothetical protein SORBIDRAFT_06g020270          281   2e-87    Sorghum bicolor [broomcorn]
ref|XP_004975985.1|  PREDICTED: uncharacterized protein LOC101760765    280   3e-87    Setaria italica
gb|KFK33555.1|  hypothetical protein AALP_AA5G028800                    280   3e-87    Arabis alpina [alpine rockcress]
ref|XP_002876947.1|  predicted protein                                  279   5e-87    
ref|XP_010535458.1|  PREDICTED: uncharacterized protein LOC104810759    275   6e-87    Tarenaya hassleriana [spider flower]
ref|XP_010556349.1|  PREDICTED: uncharacterized protein LOC104825675    278   2e-86    Tarenaya hassleriana [spider flower]
ref|XP_010514258.1|  PREDICTED: uncharacterized protein LOC104790245    278   3e-86    Camelina sativa [gold-of-pleasure]
ref|XP_002284895.1|  PREDICTED: uncharacterized protein LOC100253729    275   2e-85    Vitis vinifera
ref|XP_010240029.1|  PREDICTED: uncharacterized protein LOC100839976    276   2e-85    Brachypodium distachyon [annual false brome]
ref|XP_010502521.1|  PREDICTED: uncharacterized protein LOC104779823    275   3e-85    Camelina sativa [gold-of-pleasure]
ref|XP_002284881.1|  PREDICTED: uncharacterized protein LOC100264047    273   3e-85    Vitis vinifera
ref|NP_001047320.1|  Os02g0596200                                       271   4e-85    
gb|AIZ06017.1|  hypothetical protein                                    273   2e-84    Zea nicaraguensis
gb|EEE61202.1|  hypothetical protein OsJ_15212                          271   1e-83    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ23667.1|  hypothetical protein OsJ_07369                          271   1e-83    Oryza sativa Japonica Group [Japonica rice]
gb|EMT10461.1|  Endoglucanase E1                                        269   2e-83    
ref|XP_002446674.1|  hypothetical protein SORBIDRAFT_06g020260          268   1e-82    Sorghum bicolor [broomcorn]
gb|EEC77495.1|  hypothetical protein OsI_16343                          268   1e-82    Oryza sativa Indica Group [Indian rice]
gb|EAY86525.1|  hypothetical protein OsI_07905                          268   3e-82    Oryza sativa Indica Group [Indian rice]
ref|NP_001132121.1|  hypothetical protein precursor                     266   6e-82    Zea mays [maize]
gb|AFW62836.1|  hypothetical protein ZEAMMB73_750687                    261   2e-81    
ref|XP_010248705.1|  PREDICTED: uncharacterized protein LOC104591...    264   3e-81    Nelumbo nucifera [Indian lotus]
ref|XP_010248706.1|  PREDICTED: uncharacterized protein LOC104591...    264   4e-81    Nelumbo nucifera [Indian lotus]
ref|XP_006400290.1|  hypothetical protein EUTSA_v10015581mg             261   3e-80    Eutrema salsugineum [saltwater cress]
ref|XP_003579979.1|  PREDICTED: uncharacterized protein LOC100845861    262   4e-80    Brachypodium distachyon [annual false brome]
ref|XP_008678767.1|  PREDICTED: uncharacterized protein LOC100501...    261   9e-80    Zea mays [maize]
dbj|BAK00694.1|  predicted protein                                      258   7e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002452393.1|  hypothetical protein SORBIDRAFT_04g024910          258   1e-78    
ref|XP_002871770.1|  glycosyl hydrolase family 5 protein                257   2e-78    
ref|XP_010492706.1|  PREDICTED: uncharacterized protein LOC104770057    256   3e-78    Camelina sativa [gold-of-pleasure]
ref|XP_006289374.1|  hypothetical protein CARUB_v10002868mg             256   5e-78    Capsella rubella
ref|XP_010420476.1|  PREDICTED: uncharacterized protein LOC104706046    255   6e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010492589.1|  PREDICTED: uncharacterized protein LOC104769...    254   7e-78    Camelina sativa [gold-of-pleasure]
ref|XP_004955049.1|  PREDICTED: uncharacterized protein LOC101776534    255   1e-77    Setaria italica
ref|XP_010492588.1|  PREDICTED: uncharacterized protein LOC104769...    254   1e-77    Camelina sativa [gold-of-pleasure]
ref|XP_004975262.1|  PREDICTED: uncharacterized protein LOC101779133    256   2e-77    Setaria italica
ref|XP_004975980.1|  PREDICTED: uncharacterized protein LOC101758857    254   3e-77    Setaria italica
ref|XP_009107523.1|  PREDICTED: uncharacterized protein LOC103833179    253   4e-77    Brassica rapa
ref|XP_010453833.1|  PREDICTED: uncharacterized protein LOC104735704    252   5e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010437048.1|  PREDICTED: uncharacterized protein LOC104720...    251   6e-77    Camelina sativa [gold-of-pleasure]
ref|XP_009126336.1|  PREDICTED: uncharacterized protein LOC103851244    243   1e-76    Brassica rapa
ref|XP_010437042.1|  PREDICTED: uncharacterized protein LOC104720...    251   1e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010549752.1|  PREDICTED: uncharacterized protein LOC104820833    251   2e-76    Tarenaya hassleriana [spider flower]
ref|XP_008793758.1|  PREDICTED: uncharacterized protein LOC103709981    251   3e-76    
ref|XP_006652422.1|  PREDICTED: uncharacterized protein LOC102702088    250   4e-76    Oryza brachyantha
ref|NP_197252.1|  Glycosyl hydrolase superfamily protein                250   5e-76    Arabidopsis thaliana [mouse-ear cress]
gb|EAY94563.1|  hypothetical protein OsI_16341                          251   6e-76    Oryza sativa Indica Group [Indian rice]
emb|CAH67676.1|  H0510A06.1                                             251   6e-76    Oryza sativa [red rice]
gb|KHN43979.1|  Endoglucanase E1                                        248   7e-76    Glycine soja [wild soybean]
ref|NP_001053105.1|  Os04g0480900                                       250   9e-76    
gb|EEC77494.1|  hypothetical protein OsI_16340                          249   2e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_009121460.1|  PREDICTED: uncharacterized protein LOC103846306    249   2e-75    Brassica rapa
emb|CDX69429.1|  BnaA10g17780D                                          249   2e-75    
emb|CAD41089.2|  OSJNBb0011N17.6                                        249   2e-75    Oryza sativa Japonica Group [Japonica rice]
gb|EYU23408.1|  hypothetical protein MIMGU_mgv1a020519mg                249   3e-75    Erythranthe guttata [common monkey flower]
ref|XP_009121461.1|  PREDICTED: uncharacterized protein LOC103846308    247   4e-75    Brassica rapa
emb|CAH66880.1|  OSIGBa0158F13.11                                       249   4e-75    Oryza sativa [red rice]
emb|CDX94333.1|  BnaC01g18510D                                          242   4e-75    
ref|XP_006400209.1|  hypothetical protein EUTSA_v10015466mg             245   2e-74    Eutrema salsugineum [saltwater cress]
gb|KFK25904.1|  hypothetical protein AALP_AA8G177600                    246   2e-74    Arabis alpina [alpine rockcress]
ref|XP_010420372.1|  PREDICTED: uncharacterized protein LOC104705962    244   3e-74    Camelina sativa [gold-of-pleasure]
ref|NP_197172.1|  glycosyl hydrolase family protein                     244   3e-74    Arabidopsis thaliana [mouse-ear cress]
emb|CDY16914.1|  BnaC09g40410D                                          245   5e-74    Brassica napus [oilseed rape]
emb|CDY38435.1|  BnaA10g17230D                                          244   7e-74    Brassica napus [oilseed rape]
ref|XP_002871731.1|  glycosyl hydrolase family 5 protein                243   8e-74    
ref|XP_009142284.1|  PREDICTED: uncharacterized protein LOC103866155    243   1e-73    Brassica rapa
ref|XP_009142293.1|  PREDICTED: uncharacterized protein LOC103866164    243   2e-73    Brassica rapa
ref|XP_009126137.1|  PREDICTED: uncharacterized protein LOC103851062    243   2e-73    Brassica rapa
gb|EYU23411.1|  hypothetical protein MIMGU_mgv1a004205mg                244   2e-73    Erythranthe guttata [common monkey flower]
emb|CDY38091.1|  BnaC02g06820D                                          243   2e-73    Brassica napus [oilseed rape]
gb|KCW59700.1|  hypothetical protein EUGRSUZ_H02458                     243   2e-73    Eucalyptus grandis [rose gum]
gb|EMT27118.1|  hypothetical protein F775_19072                         244   2e-73    
emb|CDX89335.1|  BnaA01g15580D                                          243   4e-73    
ref|XP_010904544.1|  PREDICTED: uncharacterized protein LOC105031943    243   4e-73    Elaeis guineensis
gb|KHN06535.1|  Endoglucanase                                           241   4e-73    Glycine soja [wild soybean]
gb|EPS62091.1|  hypothetical protein M569_12701                         241   1e-72    Genlisea aurea
emb|CAH67677.1|  H0510A06.2                                             241   4e-72    Oryza sativa [red rice]
gb|KHN19917.1|  hypothetical protein glysoja_032397                     238   5e-72    Glycine soja [wild soybean]
ref|XP_011080895.1|  PREDICTED: uncharacterized protein LOC105164045    239   7e-72    Sesamum indicum [beniseed]
gb|AFW62835.1|  hypothetical protein ZEAMMB73_750687                    234   2e-71    
emb|CAD41090.2|  OSJNBb0011N17.7                                        238   3e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010053198.1|  PREDICTED: uncharacterized protein LOC104441706    235   4e-70    Eucalyptus grandis [rose gum]
ref|XP_008678768.1|  PREDICTED: uncharacterized protein LOC100501...    235   5e-70    Zea mays [maize]
ref|XP_002272534.1|  PREDICTED: uncharacterized protein LOC100257079    233   4e-69    Vitis vinifera
ref|XP_011080894.1|  PREDICTED: uncharacterized protein LOC105164044    229   4e-69    
ref|XP_006439449.1|  hypothetical protein CICLE_v10023534mg             232   5e-69    
emb|CBI34404.3|  unnamed protein product                                233   6e-69    Vitis vinifera
gb|ABR17494.1|  unknown                                                 232   8e-69    Picea sitchensis
ref|XP_010658499.1|  PREDICTED: uncharacterized protein LOC100267...    229   2e-68    
ref|XP_002272422.2|  PREDICTED: uncharacterized protein LOC100245045    230   3e-68    Vitis vinifera
ref|XP_002272491.1|  PREDICTED: uncharacterized protein LOC100262188    229   6e-68    Vitis vinifera
ref|XP_002272454.2|  PREDICTED: uncharacterized protein LOC100267...    229   1e-67    
ref|XP_002272386.2|  PREDICTED: uncharacterized protein LOC100250178    226   2e-66    Vitis vinifera
ref|XP_008467257.1|  PREDICTED: uncharacterized protein LOC103504654    225   3e-66    Cucumis melo [Oriental melon]
emb|CBI34405.3|  unnamed protein product                                230   5e-66    Vitis vinifera
ref|XP_009381699.1|  PREDICTED: uncharacterized protein LOC103969775    223   6e-66    
gb|EMS46776.1|  hypothetical protein TRIUR3_23304                       216   2e-65    Triticum urartu
gb|ACF85134.1|  unknown                                                 221   3e-65    Zea mays [maize]
ref|XP_002893942.1|  predicted protein                                  218   7e-65    
gb|KGN50395.1|  hypothetical protein Csa_5G171770                       221   9e-65    Cucumis sativus [cucumbers]
gb|KGN50394.1|  hypothetical protein Csa_5G171760                       220   2e-64    Cucumis sativus [cucumbers]
gb|KHG22500.1|  Endoglucanase E1                                        219   2e-64    Gossypium arboreum [tree cotton]
ref|XP_008459280.1|  PREDICTED: uncharacterized protein LOC103498458    223   3e-64    Cucumis melo [Oriental melon]
emb|CDX83591.1|  BnaC07g23310D                                          218   4e-64    
gb|EYU23409.1|  hypothetical protein MIMGU_mgv1a004243mg                217   3e-63    Erythranthe guttata [common monkey flower]
ref|XP_004168760.1|  PREDICTED: uncharacterized protein LOC101223816    216   6e-63    
emb|CDY13614.1|  BnaA06g33090D                                          214   6e-63    Brassica napus [oilseed rape]
ref|XP_008810943.1|  PREDICTED: uncharacterized protein LOC103722247    214   4e-62    
ref|XP_009605826.1|  PREDICTED: uncharacterized protein LOC104100317    213   1e-61    Nicotiana tomentosiformis
ref|XP_009773950.1|  PREDICTED: uncharacterized protein LOC104224082    212   2e-61    Nicotiana sylvestris
emb|CDP12092.1|  unnamed protein product                                214   2e-60    Coffea canephora [robusta coffee]
gb|EYU23410.1|  hypothetical protein MIMGU_mgv1a004297mg                208   5e-60    Erythranthe guttata [common monkey flower]
ref|XP_002509879.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    208   7e-60    Ricinus communis
ref|XP_010325669.1|  PREDICTED: uncharacterized protein LOC101257885    206   2e-59    Solanum lycopersicum
gb|KDP25365.1|  hypothetical protein JCGZ_20521                         209   1e-58    Jatropha curcas
ref|XP_001767510.1|  predicted protein                                  200   1e-58    
gb|KDP25366.1|  hypothetical protein JCGZ_20522                         205   1e-58    Jatropha curcas
ref|XP_002509878.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    204   1e-58    
ref|XP_003621386.1|  Endoglucanase E1                                   199   1e-57    
ref|XP_001769398.1|  predicted protein                                  196   5e-57    
gb|AES77604.2|  hydrolyzing O-glycosyl compounds hydrolase              200   7e-57    Medicago truncatula
ref|XP_004510834.1|  PREDICTED: uncharacterized protein LOC101496378    200   7e-57    
ref|XP_007135020.1|  hypothetical protein PHAVU_010G095100g             199   1e-56    Phaseolus vulgaris [French bean]
gb|KGN45940.1|  hypothetical protein Csa_6G028440                       199   2e-56    Cucumis sativus [cucumbers]
gb|KEH18775.1|  hydrolyzing O-glycosyl compounds hydrolase              198   4e-56    Medicago truncatula
ref|XP_007159232.1|  hypothetical protein PHAVU_002G220300g             197   1e-55    Phaseolus vulgaris [French bean]
gb|KEH28356.1|  hydrolyzing O-glycosyl compounds hydrolase              196   1e-55    Medicago truncatula
ref|XP_002509877.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    197   1e-55    
ref|XP_004170746.1|  PREDICTED: endoglucanase E1-like                   196   3e-55    
ref|XP_003621392.1|  Endoglucanase E1                                   196   3e-55    
gb|AES77610.2|  hydrolyzing O-glycosyl compounds hydrolase              196   4e-55    Medicago truncatula
ref|XP_003621369.1|  Endoglucanase E1                                   195   5e-55    
gb|KFK38059.1|  hypothetical protein AALP_AA3G064700                    193   8e-55    Arabis alpina [alpine rockcress]
emb|CDY16991.1|  BnaC09g41180D                                          194   9e-55    Brassica napus [oilseed rape]
ref|XP_010261410.1|  PREDICTED: uncharacterized protein LOC104600255    191   3e-54    Nelumbo nucifera [Indian lotus]
ref|XP_010916958.1|  PREDICTED: uncharacterized protein LOC105041671    191   5e-54    
gb|KGN57439.1|  hypothetical protein Csa_3G186170                       183   1e-53    Cucumis sativus [cucumbers]
gb|AFK46453.1|  unknown                                                 181   2e-53    Lotus japonicus
ref|XP_003621368.1|  Endoglucanase                                      189   2e-53    
ref|XP_003617143.1|  Oligoribonuclease                                  197   2e-53    
emb|CBI34407.3|  unnamed protein product                                189   3e-53    Vitis vinifera
ref|XP_004158142.1|  PREDICTED: uncharacterized LOC101213113            186   1e-52    
emb|CDX69431.1|  BnaA10g17800D                                          186   1e-52    
gb|KHN45741.1|  Endoglucanase                                           187   3e-52    Glycine soja [wild soybean]
ref|XP_004143723.1|  PREDICTED: uncharacterized protein LOC101213113    186   2e-51    Cucumis sativus [cucumbers]
ref|XP_008467306.1|  PREDICTED: uncharacterized protein LOC103504686    183   1e-50    Cucumis melo [Oriental melon]
ref|XP_003608279.1|  Endoglucanase                                      182   4e-50    Medicago truncatula
ref|XP_002298005.2|  hypothetical protein POPTR_0001s10020g             180   2e-49    
ref|XP_011026965.1|  PREDICTED: uncharacterized protein LOC105127394    179   6e-49    Populus euphratica
emb|CBI16819.3|  unnamed protein product                                169   4e-47    Vitis vinifera
gb|KGN50047.1|  hypothetical protein Csa_5G151630                       171   7e-46    Cucumis sativus [cucumbers]
ref|XP_004143963.1|  PREDICTED: uncharacterized protein LOC101211910    170   1e-45    
gb|KDP25367.1|  hypothetical protein JCGZ_20523                         167   9e-45    Jatropha curcas
gb|KHM98801.1|  Chaperone protein ClpB3, chloroplastic                  170   2e-44    Glycine soja [wild soybean]
gb|AFK48266.1|  unknown                                                 157   8e-44    Lotus japonicus
gb|EPS64690.1|  hypothetical protein M569_10090                         161   2e-43    Genlisea aurea
ref|XP_006344017.1|  PREDICTED: uncharacterized protein LOC102582487    163   3e-43    Solanum tuberosum [potatoes]
ref|XP_008437726.1|  PREDICTED: uncharacterized protein LOC103483073    162   5e-43    Cucumis melo [Oriental melon]
ref|XP_008437728.1|  PREDICTED: uncharacterized protein LOC103483074    159   6e-42    Cucumis melo [Oriental melon]
ref|XP_006653527.1|  PREDICTED: uncharacterized protein LOC102709173    156   1e-41    
ref|XP_006289055.1|  hypothetical protein CARUB_v10002452mg             154   1e-41    
emb|CDP16213.1|  unnamed protein product                                155   1e-40    Coffea canephora [robusta coffee]
gb|EEC73517.1|  hypothetical protein OsI_07900                          151   1e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_006341815.1|  PREDICTED: uncharacterized protein LOC102587665    154   3e-40    
ref|XP_004143962.1|  PREDICTED: uncharacterized protein LOC101211675    153   1e-39    Cucumis sativus [cucumbers]
ref|XP_006671920.1|  cellulase family protein                           147   1e-37    Cordyceps militaris CM01
gb|KHN29015.1|  E3 ubiquitin-protein ligase RGLG2                       150   1e-37    Glycine soja [wild soybean]
gb|KGN57438.1|  hypothetical protein Csa_3G185670                       147   1e-37    Cucumis sativus [cucumbers]
gb|AFW58605.1|  hypothetical protein ZEAMMB73_652830                    139   2e-37    
gb|KHN04647.1|  Endoglucanase                                           146   3e-37    Glycine soja [wild soybean]
gb|AFW58606.1|  hypothetical protein ZEAMMB73_652830                    138   3e-37    
dbj|GAM34669.1|  hypothetical protein TCE0_015f02391                    145   3e-37    
ref|XP_004170960.1|  PREDICTED: uncharacterized LOC101217177            145   5e-37    
gb|KEY64284.1|  hypothetical protein S7711_06330                        144   7e-37    
ref|XP_003717168.1|  cellulase                                          144   7e-37    
gb|KFA75266.1|  hypothetical protein S40288_00156                       144   9e-37    
gb|EKG14335.1|  Glycoside hydrolase family 5                            143   1e-36    
ref|XP_002340189.1|  cellulase family protein                           143   2e-36    
ref|XP_007814668.1|  cellulase family protein                           143   2e-36    
ref|XP_009224314.1|  hypothetical protein GGTG_08211                    143   2e-36    
gb|KHO00841.1|  cellulase family protein                                142   4e-36    
ref|XP_010497223.1|  PREDICTED: uncharacterized protein LOC104774279    140   7e-36    
ref|XP_002145195.1|  cellulase family protein                           141   8e-36    
ref|NP_001053106.2|  Os04g0481000                                       133   1e-35    
gb|EAY94564.1|  hypothetical protein OsI_16342                          139   1e-35    
ref|XP_007910862.1|  putative cellulase family protein                  140   2e-35    
ref|XP_008437725.1|  PREDICTED: uncharacterized protein LOC103483072    135   3e-35    
ref|XP_007585086.1|  putative cellulase family protein                  139   4e-35    
ref|XP_008597845.1|  cellulase-like protein                             139   4e-35    
gb|KDO82152.1|  hypothetical protein CISIN_1g008330mg                   139   6e-35    
gb|KFA63501.1|  hypothetical protein S40285_00384                       139   6e-35    
gb|EPS61076.1|  hypothetical protein M569_13724                         139   9e-35    
ref|XP_007357340.1|  glycosyl hydrolase family 5 protein/cellulase      138   9e-35    
gb|KFH44162.1|  Endoglucanase-like protein                              138   2e-34    
ref|XP_007834259.1|  hypothetical protein PFICI_07487                   137   3e-34    
gb|KGN50359.1|  hypothetical protein Csa_5G168955                       131   3e-34    
emb|CBI20317.3|  unnamed protein product                                130   8e-34    
gb|KIE00366.1|  cellulase family protein                                135   1e-33    
gb|EQK97843.1|  cellulase family protein                                135   2e-33    
ref|XP_007819785.1|  cellulase family protein                           135   2e-33    
ref|XP_007590702.1|  beta-1,6-galactanase                               134   3e-33    
ref|XP_007792420.1|  putative cellulase family protein                  134   3e-33    
ref|XP_003662646.1|  glycoside hydrolase family 5 protein               134   4e-33    
gb|KID89157.1|  cellulase family protein                                134   5e-33    
gb|KGQ09067.1|  hypothetical protein BBAD15_g5599                       134   5e-33    
gb|KIY63779.1|  glycoside hydrolase family 5 protein                    134   6e-33    
emb|CDY34588.1|  BnaC03g56880D                                          132   7e-33    
gb|ENH81172.1|  cellulase family protein                                133   7e-33    
emb|CBI20315.3|  unnamed protein product                                127   7e-33    
gb|KFG83308.1|  cellulase family protein                                133   9e-33    
ref|XP_008445780.1|  PREDICTED: uncharacterized protein LOC103488703    133   1e-32    
gb|KID73106.1|  cellulase family protein                                132   1e-32    
ref|XP_003655929.1|  glycoside hydrolase family 5 protein               132   2e-32    
gb|EMT72253.1|  Endoglucanase                                           132   2e-32    
ref|XP_001836746.2|  glycosyl hydrolase family 5 protein/cellulase      132   2e-32    
dbj|GAD95395.1|  cellulase family protein                               132   3e-32    
gb|ERS96619.1|  hypothetical protein HMPREF1624_06828                   131   3e-32    
emb|CEJ81391.1|  hypothetical protein VHEMI01518                        131   4e-32    
ref|XP_010494994.1|  PREDICTED: uncharacterized protein LOC104772040    130   5e-32    
gb|EQB46738.1|  cellulase                                               131   5e-32    
gb|EWZ81068.1|  hypothetical protein FOWG_15056                         130   8e-32    
gb|EXK27375.1|  hypothetical protein FOMG_16183                         130   8e-32    
gb|EWZ43433.1|  hypothetical protein FOZG_04542                         130   9e-32    
gb|EWY97310.1|  hypothetical protein FOYG_02170                         130   1e-31    
ref|XP_004168759.1|  PREDICTED: uncharacterized protein LOC101223591    130   1e-31    
ref|XP_007273044.1|  cellulase family protein                           130   1e-31    
gb|EFQ33294.1|  cellulase                                               129   2e-31    
gb|EXM17989.1|  hypothetical protein FOTG_13958                         129   2e-31    
gb|ENH72329.1|  Endoglucanase                                           129   2e-31    
gb|EXA33415.1|  hypothetical protein FOVG_15480                         129   3e-31    
ref|XP_007594136.1|  cellulase                                          129   3e-31    
gb|EXL60764.1|  hypothetical protein FOCG_00055                         129   4e-31    
gb|KDN66432.1|  putative cellulase                                      128   5e-31    
gb|EXK80342.1|  hypothetical protein FOQG_15124                         128   5e-31    
gb|KDN63966.1|  putative beta-1,6-galactanase                           128   6e-31    
ref|XP_003663765.1|  glycoside hydrolase family 5 protein               128   6e-31    
emb|CBI20318.3|  unnamed protein product                                127   7e-31    
ref|XP_001908470.1|  hypothetical protein                               128   8e-31    
ref|XP_007286355.1|  beta-1,6-galactanase                               126   2e-30    
gb|EPE03278.1|  cellulase family protein                                126   3e-30    
emb|CCF32701.1|  cellulase                                              126   3e-30    
emb|CCF37606.1|  beta-1,6-galactanase                                   126   4e-30    
gb|KIH89233.1|  glycosyl hydrolase family 5 protein/cellulase           125   4e-30    
gb|KIY64332.1|  glycoside hydrolase family 5 protein                    125   6e-30    
gb|EQB54091.1|  beta-1,6-galactanase                                    124   1e-29    
gb|KFH46053.1|  hypothetical protein ACRE_031990                        124   2e-29    
ref|XP_003654775.1|  glycoside hydrolase family 5 protein               123   2e-29    
gb|EFQ30340.1|  beta-1,6-galactanase                                    123   3e-29    
ref|XP_007829998.1|  hypothetical protein PFICI_03226                   123   4e-29    
ref|XP_007797018.1|  putative beta- -galactanase protein                126   5e-29    
ref|XP_001589233.1|  hypothetical protein SS1G_09866                    122   6e-29    
gb|ENH76760.1|  beta-galactanase                                        121   1e-28    
gb|KIH93867.1|  cellulase family protein                                121   2e-28    
gb|ESZ94649.1|  hypothetical protein SBOR_4958                          120   3e-28    
ref|XP_007602986.1|  endo-beta-1                                        120   4e-28    
ref|XP_003716571.1|  beta-1,6-galactanase                               120   5e-28    
gb|ERS98824.1|  hypothetical protein HMPREF1624_04014                   119   1e-27    
ref|XP_009218474.1|  cellulase                                          119   1e-27    
ref|XP_001558669.1|  hypothetical protein BC1G_02740                    119   1e-27    
ref|XP_682435.1|  hypothetical protein AN9166.2                         119   1e-27    
ref|XP_001228860.1|  hypothetical protein CHGG_02344                    118   2e-27    
ref|XP_007788083.1|  putative beta- -galactanase protein                118   2e-27    
emb|CDY38093.1|  BnaC02g06800D                                          117   3e-27    
emb|CCF42701.1|  endo-beta-1                                            115   3e-27    
emb|CDX85491.1|  BnaA02g03220D                                          117   3e-27    
ref|XP_007673934.1|  glycoside hydrolase family 5 protein               117   5e-27    
gb|EPE02619.1|  beta- -galactanase                                      116   8e-27    
ref|XP_001727126.2|  cellulase family protein                           116   1e-26    
ref|XP_002375352.1|  cellulase family protein                           115   1e-26    
gb|KEZ38898.1|  hypothetical protein SAPIO_CDS10213                     115   2e-26    
ref|XP_009853760.1|  hypothetical protein NEUTE1DRAFT_148368            115   2e-26    
ref|XP_003719440.1|  cellulase                                          115   2e-26    
gb|EFQ25644.1|  endo-beta-1                                             114   3e-26    
ref|XP_003346057.1|  hypothetical protein SMAC_08559                    114   5e-26    
ref|XP_001218590.1|  conserved hypothetical protein                     115   6e-26    
gb|KDO76363.1|  hypothetical protein CISIN_1g039248mg                   113   8e-26    
ref|XP_959873.1|  cellulase                                             113   8e-26    
gb|KHE83132.1|  glycoside hydrolase family 5 protein                    113   1e-25    
gb|KIM98514.1|  glycoside hydrolase family 5 protein                    113   1e-25    
ref|XP_007828900.1|  hypothetical protein PFICI_02128                   113   2e-25    
gb|KEQ69124.1|  glycosyl hydrolase family 5 protein-like protein/...    112   2e-25    
gb|KDN70454.1|  putative endo-beta-1                                    112   3e-25    
ref|XP_009254229.1|  hypothetical protein FPSE_02835                    112   3e-25    
gb|EYB22881.1|  hypothetical protein FG05_11184                         111   4e-25    
ref|XP_007916764.1|  putative beta- -galactanase protein                111   4e-25    
ref|XP_011325159.1|  hypothetical protein FGSG_11184                    111   4e-25    
ref|XP_009221743.1|  beta-1,6-galactanase                               110   7e-25    
ref|XP_003834169.1|  similar to glycosyl hydrolase family 5 prote...    110   1e-24    
ref|XP_008020410.1|  glycoside hydrolase family 5 protein               110   1e-24    
dbj|BAE60287.1|  unnamed protein product                                109   3e-24    
gb|EIT75924.1|  hypothetical protein Ao3042_07759                       109   3e-24    
gb|KIL93951.1|  hypothetical protein FAVG1_02513                        112   3e-24    
gb|EWG53981.1|  hypothetical protein FVEG_12299                         108   3e-24    
gb|KEQ65714.1|  glycosyl hydrolase family 5 protein-like protein/...    108   4e-24    
dbj|BAF42338.1|  beta-1,6-galactanase                                   108   5e-24    
ref|XP_001221670.1|  hypothetical protein CHGG_05575                    108   5e-24    
gb|EXM21364.1|  hypothetical protein FOTG_10887                         108   5e-24    
gb|EWZ31143.1|  hypothetical protein FOZG_15552                         108   6e-24    
gb|EMT67612.1|  Endoglucanase E1                                        108   6e-24    
gb|EXL52466.1|  hypothetical protein FOCG_08258                         108   6e-24    
gb|ENH63669.1|  Endoglucanase E1                                        108   6e-24    
gb|EWY82241.1|  hypothetical protein FOYG_14356                         108   6e-24    
gb|EGU84192.1|  hypothetical protein FOXB_05301                         108   6e-24    
gb|EQB45939.1|  endo-beta-1                                             108   7e-24    
gb|EGU83355.1|  hypothetical protein FOXB_06135                         107   1e-23    
ref|XP_001390007.2|  cellulase family protein                           107   1e-23    
emb|CAK38078.1|  unnamed protein product                                107   1e-23    
ref|XP_003049455.1|  hypothetical protein NECHADRAFT_45063              107   2e-23    
dbj|GAA92545.1|  cellulase family protein                               107   2e-23    
ref|XP_753201.1|  cellulase family protein                              106   2e-23    
ref|XP_009652661.1|  beta-1,6-galactanase                               106   2e-23    
ref|XP_001259223.1|  cellulase, putative                                106   2e-23    
ref|XP_007290132.1|  putative glycosyl hydrolase family 5 protein...    105   8e-23    
ref|XP_007283182.1|  cellulase family protein                           104   2e-22    
ref|XP_003000334.1|  beta-1,6-galactanase                               104   2e-22    
ref|XP_007880014.1|  hypothetical protein PFL1_04296                    104   2e-22    
ref|XP_008079151.1|  (Trans)glycosidase                                 103   2e-22    
gb|EHL01724.1|  putative endoglucanase E1                               103   2e-22    
gb|EFW98553.1|  cellulase family protein                                103   3e-22    
gb|KIN05076.1|  glycoside hydrolase family 5 protein                    102   5e-22    
gb|ELQ40532.1|  cellulase family protein                                103   5e-22    
gb|EMF10750.1|  glycoside hydrolase family 5 protein                    102   6e-22    
gb|KEQ97289.1|  glycoside hydrolase family 5 protein                    102   6e-22    
gb|KEQ88759.1|  putative endoglucanase E1                               101   1e-21    
gb|EMD93538.1|  glycoside hydrolase family 5 protein                    100   4e-21    
ref|XP_007695874.1|  glycoside hydrolase family 5 protein               100   4e-21    
gb|KFY05071.1|  hypothetical protein O988_00287                         100   5e-21    
ref|XP_003710230.1|  beta-1,6-galactanase                               100   5e-21    
gb|KDN62736.1|  putative beta-1,6-galactanase                           100   8e-21    
gb|EUN23705.1|  glycoside hydrolase family 5 protein                  99.4    8e-21    
gb|KFA65247.1|  hypothetical protein S40285_01463                     99.0    2e-20    
gb|KFY97953.1|  hypothetical protein V498_01781                       98.2    2e-20    
ref|XP_003852017.1|  hypothetical protein MYCGRDRAFT_71681            97.8    2e-20    
ref|XP_007788248.1|  putative beta- -galactanase protein              98.6    3e-20    
ref|WP_020706673.1|  hypothetical protein                             97.4    3e-20    
gb|KFY54743.1|  hypothetical protein V496_07185                       97.8    3e-20    
ref|XP_007714643.1|  glycoside hydrolase family 5 protein             97.1    5e-20    
gb|KFA77893.1|  hypothetical protein S40288_02553                     96.7    1e-19    
gb|KEY74323.1|  hypothetical protein S7711_00479                      96.7    1e-19    
gb|EYF06416.1|  Hypothetical protein CAP_1946                         95.5    2e-19    
gb|KDN53057.1|  glycoside hydrolase family 5 protein                  95.9    3e-19    
gb|ENH86025.1|  beta-galactanase                                      95.1    5e-19    
ref|XP_007688994.1|  glycoside hydrolase family 5 protein             94.4    5e-19    
gb|EQB45951.1|  beta-1,6-galactanase                                  94.7    6e-19    
gb|KFZ18118.1|  hypothetical protein V502_04277                       94.0    8e-19    
gb|KFZ08766.1|  hypothetical protein V501_05827                       93.6    1e-18    
gb|KFX85816.1|  hypothetical protein V490_09391                       95.1    1e-18    
ref|XP_007601021.1|  beta-1,6-galactanase                             93.2    2e-18    
gb|KFY38525.1|  hypothetical protein V495_06511                       94.7    2e-18    
emb|CCF49355.1|  related to cellulase                                 93.2    2e-18    
dbj|GAC98490.1|  glycoside hydrolase                                  93.2    2e-18    
ref|XP_003299126.1|  hypothetical protein PTT_10061                   92.8    3e-18    
gb|KFY79089.1|  hypothetical protein V499_01878                       92.0    4e-18    
ref|XP_007285746.1|  cellulase family protein                         92.4    5e-18    
emb|CAD19084.1|  cellulase                                            92.8    5e-18    
ref|XP_007715431.1|  glycoside hydrolase family 5 protein             91.7    7e-18    
gb|KFY18769.1|  hypothetical protein V493_08357                       90.9    1e-17    
ref|XP_008031104.1|  glycoside hydrolase family 5 protein             91.3    1e-17    
ref|XP_001937210.1|  beta-1,6-galactanase                             90.9    2e-17    
ref|XP_007698919.1|  glycoside hydrolase family 5 protein             90.5    2e-17    
gb|KEQ91282.1|  glycoside hydrolase family 5 protein                  89.7    3e-17    
ref|WP_002615846.1|  glycosyl hydrolase family 5                      90.9    3e-17    
gb|KIH86669.1|  endoglucanase                                         89.7    3e-17    
gb|ERT03116.1|  hypothetical protein HMPREF1624_01421                 89.7    3e-17    
ref|WP_002631146.1|  hypothetical protein                             90.5    3e-17    
ref|XP_003841187.1|  hypothetical protein LEMA_P091170.1              89.4    5e-17    
gb|KEQ66985.1|  Exo-beta-1,3-glucanase                                89.4    5e-17    
gb|EMD89616.1|  glycoside hydrolase family 5 protein                  89.4    5e-17    
ref|WP_037441468.1|  hypothetical protein                             86.7    5e-17    
gb|ETS60461.1|  hypothetical protein PaG_05301                        89.4    5e-17    
ref|XP_011391775.1|  hypothetical protein UMAG_12007                  89.0    7e-17    
ref|XP_007690633.1|  glycoside hydrolase family 5 protein             89.0    7e-17    
emb|CDI55906.1|  related to cellulase                                 89.0    7e-17    
emb|CBQ69840.1|  related to cellulase                                 88.6    8e-17    
ref|XP_003850716.1|  Exo-beta-1,3-glucanase                           88.6    9e-17    
ref|WP_037440274.1|  hypothetical protein                             86.3    9e-17    
dbj|GAC77343.1|  hypothetical protein PANT_26c00006                   88.2    1e-16    
dbj|GAK66794.1|  beta- -galactanase protein                           88.2    1e-16    
gb|KEQ82680.1|  Exo-beta-1,3-glucanase                                87.8    2e-16    
gb|KEQ69326.1|  Exo-beta-1,3-glucanase                                87.8    2e-16    
ref|XP_009221446.1|  hypothetical protein GGTG_05380                  87.4    2e-16    
gb|EPZ34200.1|  Glycoside hydrolase, family 5 domain-containing p...  86.7    2e-16    
gb|ENH81328.1|  beta-galactanase                                      86.7    3e-16    
ref|XP_007915538.1|  putative endoglucanase e1 protein                86.3    4e-16    
ref|XP_001796881.1|  hypothetical protein SNOG_06513                  86.3    4e-16    
ref|XP_003718526.1|  endoglucanase E1                                 86.3    4e-16    
emb|CCF35420.1|  cellulase                                            86.7    5e-16    
ref|XP_007927008.1|  glycoside hydrolase family 5 protein             86.3    5e-16    
ref|XP_007593142.1|  cellulase                                        86.7    5e-16    
gb|EFQ29335.1|  cellulase                                             85.5    7e-16    
gb|KDN65196.1|  putative cellulase                                    85.1    2e-15    



>emb|CDP13254.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            + QPL TNSRWIVN SG+RVKLACVNW THLEVVVAEGLSKQPVDVIS+ IVDMGFNCVR
Sbjct  1    MGQPLYTNSRWIVNGSGQRVKLACVNWATHLEVVVAEGLSKQPVDVISRSIVDMGFNCVR  60

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LTWPLFLFTND+LASL+VRQSF+ LGL ESIAG QANNPSIVDL LI AYQAVV SLA  
Sbjct  61   LTWPLFLFTNDTLASLSVRQSFQKLGLTESIAGFQANNPSIVDLSLINAYQAVVASLASN  120

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             VMIILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT+VA MF G +NVVG+SLRN
Sbjct  121  NVMIILDNHISKPGWCCSNFDGNGFFGDRYFNPDLWIRGLTEVAAMFCGINNVVGISLRN  180

Query  648  ELRGPKQNVNDWYRYM  695
            ELRGPKQNV+DWYRYM
Sbjct  181  ELRGPKQNVDDWYRYM  196



>ref|XP_002515055.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF47609.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=566

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PLSTNSRWIV+E+G+RVKLACVNWV+HLE VVAEGLSKQP+D+I+KKIV MGFNCV
Sbjct  29   VTALPLSTNSRWIVDENGQRVKLACVNWVSHLEAVVAEGLSKQPMDMIAKKIVSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TND+LASL+VRQSF+ LGLLESI+G+QANNPSI+DLPLI AYQAVV SL  
Sbjct  89   RLTWPLYLVTNDTLASLSVRQSFQGLGLLESISGIQANNPSIIDLPLIKAYQAVVSSLGD  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++AT+FNG +NV+GMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDTYFNPDLWIKGLTQMATLFNGVTNVIGMSLR  208

Query  645  NELRGPKQNVNDWYRYM  695
            NELRG KQNVNDWYRYM
Sbjct  209  NELRGQKQNVNDWYRYM  225



>gb|KHG05074.1| Endoglucanase [Gossypium arboreum]
Length=563

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 179/203 (88%), Gaps = 2/203 (1%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H  P   ++ PLSTNSRWIV+E GRRVKLACVNWV+HLE VVAEGLSKQP+D+ISK+IV 
Sbjct  22   HAKP--AMSLPLSTNSRWIVDEEGRRVKLACVNWVSHLEPVVAEGLSKQPMDMISKRIVT  79

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVR TWPLFL TNDSLASLTVRQSF+ LGLLESIAG+Q+NNPSI+D+ LI AYQAV
Sbjct  80   MGFNCVRFTWPLFLITNDSLASLTVRQSFQRLGLLESIAGIQSNNPSIIDVSLIKAYQAV  139

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL K  VM+ILDNH+SKPGWCCS +DGNGFFGD YF+P LW+ GLT++AT+FNG +NV
Sbjct  140  VSSLGKNDVMVILDNHLSKPGWCCSDFDGNGFFGDQYFNPDLWITGLTRMATLFNGVTNV  199

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRG KQNVNDWYRYM
Sbjct  200  VGMSLRNELRGHKQNVNDWYRYM  222



>gb|KJB15656.1| hypothetical protein B456_002G188600 [Gossypium raimondii]
Length=563

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 181/203 (89%), Gaps = 2/203 (1%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H  P   ++ PLSTNSRWIV+E GRRVKLACVNWV+HLE VVAEGLSKQP+D+I+K+IV 
Sbjct  22   HAKP--AMSLPLSTNSRWIVDEEGRRVKLACVNWVSHLEPVVAEGLSKQPMDMIAKRIVT  79

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVR TWPLFL TNDSLAS+TVRQSF+ LGLLESIAG+Q+NNPSI+D+ LI AYQAV
Sbjct  80   MGFNCVRFTWPLFLITNDSLASITVRQSFQRLGLLESIAGIQSNNPSIIDVSLIKAYQAV  139

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL K  VM+ILDNH+SKPGWCCS++DGNGFFGD YF+P LW+ GLT++AT+FNG ++V
Sbjct  140  VSSLGKNDVMVILDNHLSKPGWCCSNFDGNGFFGDQYFNPDLWITGLTRMATLFNGVTHV  199

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRGPKQNVNDWYRYM
Sbjct  200  VGMSLRNELRGPKQNVNDWYRYM  222



>ref|XP_009765489.1| PREDICTED: uncharacterized protein LOC104217035 [Nicotiana sylvestris]
Length=562

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            TV +QPL T SRWIVN +G+RVKLACVNWV+H+EV+VAEGL++QPVD IS+ I++MGFNC
Sbjct  27   TVSSQPLYTKSRWIVNSTGQRVKLACVNWVSHMEVMVAEGLNQQPVDAISRAIINMGFNC  86

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            VRLTWPLFLFTNDSL S+TVRQSFKNLGL  SI GLQANNPSIVDL ++ AYQAVV SLA
Sbjct  87   VRLTWPLFLFTNDSLGSITVRQSFKNLGLFASIVGLQANNPSIVDLSVLDAYQAVVASLA  146

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            K  VMIILDNHISKPGWCCS +DGNGFFGD YFDP LW+ GLTKVAT+F GT+NVVGMSL
Sbjct  147  KNNVMIILDNHISKPGWCCSRFDGNGFFGDKYFDPDLWLQGLTKVATIFKGTNNVVGMSL  206

Query  642  RNELRGPKQNVNDWYRYM  695
            RNELRGP QN +DWYRYM
Sbjct  207  RNELRGPLQNAHDWYRYM  224



>gb|KDO82155.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=435

 Score =   332 bits (851),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
             +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK++VDMGFNCV
Sbjct  34   AIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCV  93

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL  
Sbjct  94   RLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGN  153

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGMSLR
Sbjct  154  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLR  213

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV DWYRYM
Sbjct  214  NELRGPKQNVKDWYRYM  230



>ref|XP_011034023.1| PREDICTED: uncharacterized protein LOC105132312 [Populus euphratica]
Length=566

 Score =   335 bits (859),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PLSTNSRWIV+E+G+RVKLACVNWV+HLEV+VAEGLS+QP+D I+K+IV MGFNCV
Sbjct  29   VMALPLSTNSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSEQPMDAIAKRIVSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++LGLLESI+G+QANNPSI+DLPL+  YQAVV +L  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLRSLGLLESISGIQANNPSIIDLPLLDVYQAVVSNLGD  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS++DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLR  208

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDWYRYM
Sbjct  209  NELRGPKQNVNDWYRYM  225



>ref|XP_002312657.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
 gb|EEE90024.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
Length=566

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PLSTNSRWIV+E+G+RVKLACVNWV+HLEV+VAEGLS+QP+D I+K+IV MGFNCV
Sbjct  29   VTALPLSTNSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSEQPMDAIAKRIVSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++LGLLESI+G+QANNPSI+DLPL+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLRSLGLLESISGIQANNPSIIDLPLLNVYQAVVSSLGD  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLR  208

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDWYRYM
Sbjct  209  NELRGPKQNVNDWYRYM  225



>ref|XP_006378253.1| hypothetical protein POPTR_0010s059502g, partial [Populus trichocarpa]
 gb|ERP56050.1| hypothetical protein POPTR_0010s059502g, partial [Populus trichocarpa]
Length=396

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEGLSKQP+D I+K+I+ MGFNCV
Sbjct  29   VMALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSKQPLDGIAKRILSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS++DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLR  208

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDWYRYM
Sbjct  209  NELRGPKQNVNDWYRYM  225



>ref|XP_002285424.1| PREDICTED: uncharacterized protein LOC100244027 [Vitis vinifera]
Length=552

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVA PL TNSRWIV+E G RVKLACVNW +HLE VVAEGLSKQPV +ISKKI  MGFNCV
Sbjct  24   VVALPLYTNSRWIVDEDGARVKLACVNWPSHLEAVVAEGLSKQPVAMISKKIGSMGFNCV  83

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPLFL TN SLASLTVRQSF+ LGLLESIAG QANNPS+VDLPLI+AYQAVV  LA 
Sbjct  84   RLTWPLFLATNQSLASLTVRQSFQRLGLLESIAGFQANNPSMVDLPLISAYQAVVSGLAD  143

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH+SKPGWCCSS+DGNGFFGD YF+P LWV GLT++ATMF G +NVVGMSLR
Sbjct  144  NNVMVILDNHLSKPGWCCSSFDGNGFFGDQYFNPDLWVQGLTRMATMFRGVTNVVGMSLR  203

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV DWYRYM
Sbjct  204  NELRGPKQNVKDWYRYM  220



>ref|XP_007223308.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
 gb|EMJ24507.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
Length=547

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P TV A PLST+SRWIV+ESG+RVKLACVNWV+HLE VVAEGLSKQPVD ISK+I  +GF
Sbjct  29   PATVSAVPLSTSSRWIVDESGQRVKLACVNWVSHLEPVVAEGLSKQPVDAISKRIASLGF  88

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVRLTWP FL TND+LAS+TVRQSF++LGL ESIAGLQ+NNPSI+DL LI AYQAVV S
Sbjct  89   NCVRLTWPTFLATNDTLASVTVRQSFQSLGLSESIAGLQSNNPSIIDLTLIQAYQAVVSS  148

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L K  VM+ILDN +SKPGWCCSS+DGNGFFGD YF P +W+ GLT++AT+F G +NVVGM
Sbjct  149  LGKNNVMVILDNQVSKPGWCCSSFDGNGFFGDQYFSPDIWIKGLTRMATLFKGVANVVGM  208

Query  636  SLRNELRGPKQNVNDWYRYM  695
            SLRNELRGPKQNV+DWY+YM
Sbjct  209  SLRNELRGPKQNVDDWYKYM  228



>ref|XP_006438205.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
 gb|ESR51445.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
Length=570

 Score =   332 bits (852),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
             +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK+IVDMGFNCV
Sbjct  34   AIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRIVDMGFNCV  93

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL  
Sbjct  94   RLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGN  153

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGMSLR
Sbjct  154  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLR  213

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV DWYRYM
Sbjct  214  NELRGPKQNVKDWYRYM  230



>gb|KDO82151.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=570

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
             +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK++VDMGFNCV
Sbjct  34   AIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCV  93

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL  
Sbjct  94   RLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGN  153

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGMSLR
Sbjct  154  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLR  213

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV DWYRYM
Sbjct  214  NELRGPKQNVKDWYRYM  230



>ref|XP_004245178.1| PREDICTED: uncharacterized protein LOC101258288 [Solanum lycopersicum]
Length=561

 Score =   332 bits (850),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  278
            P      LSTNSRWIVNE G+RVKL+CVNWV+HLEV+VAEGLSKQP+D ISK I +MGFN
Sbjct  27   PQYSHATLSTNSRWIVNEGGQRVKLSCVNWVSHLEVMVAEGLSKQPIDTISKSITNMGFN  86

Query  279  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            CVRLTWPLFLFTNDSL+SL+VRQSF NLGL+ESIAGLQ NNPSI+DL L+ AYQAVV  L
Sbjct  87   CVRLTWPLFLFTNDSLSSLSVRQSFNNLGLVESIAGLQVNNPSILDLSLLQAYQAVVSGL  146

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  638
                VM+ILDNHISKPGWCCS++DGNGFFGD YF+P LWV GLTKVAT F   +NVVGMS
Sbjct  147  GNNNVMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWVQGLTKVATTFINVTNVVGMS  206

Query  639  LRNELRGPKQNVNDWYRYM  695
            LRNELRGPKQNVNDWYRYM
Sbjct  207  LRNELRGPKQNVNDWYRYM  225



>ref|XP_006483983.1| PREDICTED: uncharacterized protein LOC102624331 [Citrus sinensis]
Length=588

 Score =   332 bits (850),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
             +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK++VDMGFNCV
Sbjct  52   AIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCV  111

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL  
Sbjct  112  RLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGN  171

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGMSLR
Sbjct  172  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLR  231

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV DWYRYM
Sbjct  232  NELRGPKQNVKDWYRYM  248



>ref|XP_009359244.1| PREDICTED: uncharacterized protein LOC103949843 [Pyrus x bretschneideri]
Length=552

 Score =   330 bits (847),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  278
            P V A PLST+SRWIV+ESG+RVKLACVNWV+HL+ VVAEGLSKQPVD I+K+I  +GFN
Sbjct  22   PAVSALPLSTSSRWIVDESGQRVKLACVNWVSHLDTVVAEGLSKQPVDAIAKRITSLGFN  81

Query  279  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            CVRLTWPLFL TN++LA++TVRQSF++LGLL+SI+G+Q+NNP++VDLPL+ AYQAVV SL
Sbjct  82   CVRLTWPLFLATNETLAAVTVRQSFQSLGLLDSISGIQSNNPALVDLPLLKAYQAVVSSL  141

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  638
                VM+ILDNH+SKPGWCCS+ DGNGFFGD YF+P LW+ GLT++AT+F G SNVVGMS
Sbjct  142  GSNNVMVILDNHLSKPGWCCSNTDGNGFFGDQYFNPDLWITGLTRMATLFKGVSNVVGMS  201

Query  639  LRNELRGPKQNVNDWYRYM  695
            LRNELRGPKQNVNDWY+YM
Sbjct  202  LRNELRGPKQNVNDWYKYM  220



>ref|XP_008221942.1| PREDICTED: uncharacterized protein LOC103321869 [Prunus mume]
Length=584

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P TV A PLST+SRWIV+ESG+RVKLACVNWV+HLE VVAEGLSKQPVD ISK+I  +GF
Sbjct  66   PATVSAVPLSTSSRWIVDESGQRVKLACVNWVSHLEPVVAEGLSKQPVDAISKRIASLGF  125

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVRLTWP FL TND+LAS+TVRQSF++LGL ESIAGLQ+NNPSI+DL LI AYQAVV S
Sbjct  126  NCVRLTWPTFLATNDTLASVTVRQSFQSLGLSESIAGLQSNNPSIIDLTLIQAYQAVVSS  185

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L K  VM+ILDN +SKPGWCCSS DGNGFFGD YF+P +W+ GLT++AT+F G +NVVGM
Sbjct  186  LGKNNVMVILDNQVSKPGWCCSSSDGNGFFGDQYFNPDIWIKGLTRMATLFKGVANVVGM  245

Query  636  SLRNELRGPKQNVNDWYRYM  695
            SLRNELRGPKQNV+DWY+YM
Sbjct  246  SLRNELRGPKQNVDDWYKYM  265



>ref|XP_011042367.1| PREDICTED: uncharacterized protein LOC105138074 [Populus euphratica]
Length=561

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEGLSKQP+D I+K+I+ MGFNCV
Sbjct  29   VIALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSKQPMDGIAKRILSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS++DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLR  208

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDWYRYM
Sbjct  209  NELRGPKQNVNDWYRYM  225



>ref|XP_006367511.1| PREDICTED: uncharacterized protein LOC102589547 [Solanum tuberosum]
Length=560

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  278
            P      LSTNSRWIVNE G+RVKL+CVNWV+HLEV+VAEGLSKQP+D ISK I +MGFN
Sbjct  26   PQYSHATLSTNSRWIVNEGGQRVKLSCVNWVSHLEVMVAEGLSKQPIDTISKSITNMGFN  85

Query  279  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            CVRLTWPLFLFTNDSL+SLTVRQSF NLGL+ESIAGLQ NNPSI+DL L+ AYQAVV  L
Sbjct  86   CVRLTWPLFLFTNDSLSSLTVRQSFSNLGLVESIAGLQVNNPSILDLSLLHAYQAVVSGL  145

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  638
                VM+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT VAT F   +NVVGMS
Sbjct  146  GNNNVMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIQGLTNVATTFINVTNVVGMS  205

Query  639  LRNELRGPKQNVNDWYRYM  695
            LRNELRGPKQNVNDWYRYM
Sbjct  206  LRNELRGPKQNVNDWYRYM  224



>ref|XP_004239150.1| PREDICTED: uncharacterized protein LOC101248575 [Solanum lycopersicum]
Length=572

 Score =   329 bits (843),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H+    V +QPL TNSRWIVN  G+RVKL CVNWV+H++V++AEGL+ QP+D ISK I++
Sbjct  31   HVVVVIVSSQPLYTNSRWIVNSKGQRVKLTCVNWVSHMDVMLAEGLNHQPIDAISKSIIN  90

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWPL+LFTNDSL+S++VRQSFKNLGL  SI GLQANNPSIVDL ++ AY+AV
Sbjct  91   MGFNCVRLTWPLYLFTNDSLSSISVRQSFKNLGLFSSILGLQANNPSIVDLSVLDAYKAV  150

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SLAK  VMIILDNHISKPGWCCS +DGNGFFGD YFDP LW+ GLTKVAT F  T+NV
Sbjct  151  VASLAKNNVMIILDNHISKPGWCCSRFDGNGFFGDEYFDPHLWIQGLTKVATTFKATTNV  210

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRGP QNV+DWYRYM
Sbjct  211  VGMSLRNELRGPLQNVDDWYRYM  233



>ref|XP_002315653.2| hypothetical protein POPTR_0010s05960g [Populus trichocarpa]
 gb|EEF01824.2| hypothetical protein POPTR_0010s05960g [Populus trichocarpa]
Length=377

 Score =   322 bits (826),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEG+SKQP+D I+K+I+ MGFNCV
Sbjct  7    VMALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGISKQPMDGIAKRILSMGFNCV  66

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  67   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  126

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++A+MF G  NVVGMSLR
Sbjct  127  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFKGVPNVVGMSLR  186

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDWYRYM
Sbjct  187  NELRGPKQNVNDWYRYM  203



>ref|XP_010250986.1| PREDICTED: uncharacterized protein LOC104593039 [Nelumbo nucifera]
Length=583

 Score =   329 bits (843),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            ++P   VA PL TNSRWIV+E G+RVKLACVNW +HLE +VAEGLSK+P+DVISK+IV M
Sbjct  16   VSPVVAVALPLYTNSRWIVDEDGQRVKLACVNWASHLEAMVAEGLSKRPLDVISKRIVSM  75

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TNDSLAS+TVRQSF++LGL E+I G+Q NNPS+VDLPLI AYQAVV
Sbjct  76   GFNCVRLTWPLFLATNDSLASVTVRQSFRSLGLSETIVGIQVNNPSLVDLPLIQAYQAVV  135

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
             +L +  +M+ILDNHISKPGWCCSS+DGNGFFGD YFDP +W+ GLT +ATMFN T NVV
Sbjct  136  SNLGENNLMVILDNHISKPGWCCSSFDGNGFFGDKYFDPGVWIKGLTSMATMFNATPNVV  195

Query  630  GMSLRNELRGPKQNVNDWYRYM  695
            GMSLRNELRG KQNV DWYRYM
Sbjct  196  GMSLRNELRGNKQNVKDWYRYM  217



>ref|XP_011042368.1| PREDICTED: uncharacterized protein LOC105138075 [Populus euphratica]
Length=542

 Score =   328 bits (840),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEGLSKQP+D I+K+I+ MGFNCV
Sbjct  29   VIALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSKQPMDGIAKRILSMGFNCV  88

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  148

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLR  208

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDWYRYM
Sbjct  209  NELRGPKQNVNDWYRYM  225



>gb|KDP26669.1| hypothetical protein JCGZ_17827 [Jatropha curcas]
Length=563

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PLST+SRWIV+E G+RVKLACVNWV+HLE VVAEGLS++P+D+I+KKIV MGFNCV
Sbjct  28   VSAVPLSTDSRWIVDEKGQRVKLACVNWVSHLEAVVAEGLSREPMDLIAKKIVSMGFNCV  87

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL+L TN++ ASLTV+QSF+NLGLLESI+G+QANNP+I+DLPLI AYQAVV SL  
Sbjct  88   RLTWPLYLVTNETYASLTVKQSFQNLGLLESISGIQANNPAIIDLPLIKAYQAVVSSLGD  147

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              V++ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++AT+FNG  NVVG+SLR
Sbjct  148  NNVLVILDNHISKPGWCCSNFDGNGFFGDSYFNPDLWINGLTQMATIFNGVPNVVGLSLR  207

Query  645  NELRGPKQNVNDWYRYM  695
            NELRG KQNVNDWYRYM
Sbjct  208  NELRGQKQNVNDWYRYM  224



>ref|XP_010248702.1| PREDICTED: uncharacterized protein LOC104591536 [Nelumbo nucifera]
Length=555

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PL TNSRWIV+E+G+RVKLACVNW +HLE +VAEGLSKQP+DVISK+IV MGFNCV
Sbjct  28   VTALPLYTNSRWIVDETGQRVKLACVNWASHLESMVAEGLSKQPLDVISKQIVSMGFNCV  87

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPLFL TN SLAS+TVRQSFK+LGL+E+IAG++ NNPS+VDLPLI AYQ VV +LA 
Sbjct  88   RLTWPLFLVTNSSLASITVRQSFKSLGLIETIAGIEVNNPSLVDLPLIRAYQVVVANLAD  147

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              +M+ILDNHISK GWCCSS DGNGFFGD YFDP LW+ GLT++ATMF GT+NVVGMSLR
Sbjct  148  NNLMVILDNHISKSGWCCSSVDGNGFFGDKYFDPSLWINGLTRMATMFRGTANVVGMSLR  207

Query  645  NELRGPKQNVNDWYRYM  695
            NELRG +Q+VNDWYRYM
Sbjct  208  NELRGARQSVNDWYRYM  224



>ref|XP_007159685.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
 gb|ESW31679.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
Length=565

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
             + P      PL T+SRWIV + GRRVKLACVNWV+HLEVVVAEGLSK+PVD ISK I  
Sbjct  27   EVRPVAATGLPLRTDSRWIVGQDGRRVKLACVNWVSHLEVVVAEGLSKKPVDAISKGIKS  86

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWP+ L TNDSLASLTVR SF+NLGLLES+AG+Q NNPSI+DLPLI A+Q V
Sbjct  87   MGFNCVRLTWPILLVTNDSLASLTVRSSFQNLGLLESVAGVQTNNPSIIDLPLIQAFQVV  146

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL    VM+ILDNHI++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG +NV
Sbjct  147  VKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKYFDPNLWMLGLTKMATLFNGVTNV  206

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRG KQNV+DWY+YM
Sbjct  207  VGMSLRNELRGAKQNVDDWYKYM  229



>ref|XP_007044872.1| Cellulase protein [Theobroma cacao]
 gb|EOY00704.1| Cellulase protein [Theobroma cacao]
Length=563

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTNSRWIV+E G+RVKLACVNWV+HLE +VAEGLSK P+DVI+K+IV  GFNCVRLTW
Sbjct  30   PLSTNSRWIVDEKGQRVKLACVNWVSHLEPMVAEGLSKLPMDVIAKRIVSTGFNCVRLTW  89

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            PLFL TNDSLASLTVRQSF+ LGLLESIAG+Q NNPSI+D+ L+ AYQAVV SL +  VM
Sbjct  90   PLFLVTNDSLASLTVRQSFQRLGLLESIAGIQTNNPSIIDVSLLKAYQAVVCSLGENNVM  149

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDNHISKPGWCCS++DGNGFFGD YF+P +W+ GLT++AT+ N  +NVVGMSLRNELR
Sbjct  150  VILDNHISKPGWCCSNFDGNGFFGDQYFNPDIWITGLTRMATLVNAVTNVVGMSLRNELR  209

Query  657  GPKQNVNDWYRYM  695
            GPKQ VNDWYRYM
Sbjct  210  GPKQTVNDWYRYM  222



>ref|XP_008389746.1| PREDICTED: uncharacterized protein LOC103452050 [Malus domestica]
Length=552

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 175/199 (88%), Gaps = 0/199 (0%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  278
            P   A PLST+SRWIV+ESG+RVKLACVNWV+HL+ VVAEGLSKQPVD I+K+I  +GFN
Sbjct  22   PAASALPLSTSSRWIVDESGQRVKLACVNWVSHLDAVVAEGLSKQPVDAIAKRIASLGFN  81

Query  279  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            CVRLTWPL L TN++LA++TVRQSF++LGLLESI+G+Q+NNP++VDLPL+ AYQAVV SL
Sbjct  82   CVRLTWPLLLATNETLAAVTVRQSFQSLGLLESISGIQSNNPALVDLPLLKAYQAVVSSL  141

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  638
                VM+ILDNH+S PGWCC++ D NGFFGD YF+P LW+ GLT++AT+F G SNVVGMS
Sbjct  142  GSNNVMVILDNHLSTPGWCCNNNDDNGFFGDKYFNPDLWITGLTRMATLFKGVSNVVGMS  201

Query  639  LRNELRGPKQNVNDWYRYM  695
            LRNELRGPKQNV+DWY+YM
Sbjct  202  LRNELRGPKQNVDDWYKYM  220



>ref|XP_010100346.1| hypothetical protein L484_027655 [Morus notabilis]
 gb|EXB82480.1| hypothetical protein L484_027655 [Morus notabilis]
Length=559

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 169/195 (87%), Gaps = 0/195 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A+PL TNSRWIV+E GRRVKLACVNWV+HLE VVAEGLSKQP+DVI+ +I  +GFNCVRL
Sbjct  35   AEPLYTNSRWIVDEGGRRVKLACVNWVSHLEPVVAEGLSKQPLDVIAAQISALGFNCVRL  94

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWP++L TNDSLASLTVR SF+ LGL ESIAGLQ  NPSIVDL LI AYQAVV SL    
Sbjct  95   TWPIYLATNDSLASLTVRDSFQRLGLEESIAGLQTYNPSIVDLSLIQAYQAVVSSLGSKN  154

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  650
            VM++LDNH++KPGWCCS++DGNGFFGD YFDP LW+ GLT +AT+F G  NV+GMSLRNE
Sbjct  155  VMVVLDNHVTKPGWCCSNFDGNGFFGDQYFDPDLWIKGLTHMATLFKGVQNVIGMSLRNE  214

Query  651  LRGPKQNVNDWYRYM  695
            LRGPKQNVNDW++YM
Sbjct  215  LRGPKQNVNDWFKYM  229



>gb|EYU30606.1| hypothetical protein MIMGU_mgv1a018920mg, partial [Erythranthe 
guttata]
Length=504

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 168/193 (87%), Gaps = 1/193 (1%)
 Frame = +3

Query  120  LSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            LST SRWIV+ES GRRVKL CVNW +HL+ VVAEGLSKQPVD IS++I++MGFNCVRLTW
Sbjct  4    LSTESRWIVDESSGRRVKLVCVNWPSHLDAVVAEGLSKQPVDEISQEIINMGFNCVRLTW  63

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            PLFLFTND+LASLTVRQSF NLGL ES+AG Q NNPSI+DL LI AYQ VV SL + KVM
Sbjct  64   PLFLFTNDTLASLTVRQSFTNLGLSESVAGFQTNNPSIIDLSLIDAYQEVVASLGRKKVM  123

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            IILDNH SKPGWCCS+ DGNGFFGD YF+P+LW+ GLT+VAT FN T NVV MSLRNELR
Sbjct  124  IILDNHTSKPGWCCSNSDGNGFFGDEYFNPQLWLKGLTRVATTFNNTKNVVAMSLRNELR  183

Query  657  GPKQNVNDWYRYM  695
            G +QNVNDWYRYM
Sbjct  184  GRRQNVNDWYRYM  196



>ref|XP_010904543.1| PREDICTED: uncharacterized protein LOC105031942 [Elaeis guineensis]
Length=563

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            L  PT  A PL T+SRWIV+ESG+RVKLACVNW +HL+ V+AEG+ KQP+D ISKKI  M
Sbjct  21   LQKPTT-ALPLFTSSRWIVDESGQRVKLACVNWPSHLDTVLAEGMGKQPLDTISKKIASM  79

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TNDSLA+LTVRQSF++LGL ES A +Q NNP++VDLPLI A+QAVV
Sbjct  80   GFNCVRLTWPLFLATNDSLANLTVRQSFQSLGLAESFAAIQVNNPALVDLPLIQAFQAVV  139

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
             +L +  +M+ILDNHISKPGWCCS++DGNGFFGD YFDP +WV GLT++ATMFNGT+NVV
Sbjct  140  TNLGENNIMVILDNHISKPGWCCSNFDGNGFFGDKYFDPDVWVKGLTRMATMFNGTTNVV  199

Query  630  GMSLRNELRGPKQNVNDWYRYM  695
            GMSLRNELRG +QN  DWYRYM
Sbjct  200  GMSLRNELRGARQNATDWYRYM  221



>gb|KEH20742.1| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=558

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T+SRWIVN+ G RVKLAC+NWV+HL+ VVAEGLSK+PVDVIS  I  MGFNCVRLTW
Sbjct  29   PLGTSSRWIVNQDGERVKLACLNWVSHLDAVVAEGLSKKPVDVISNGIKSMGFNCVRLTW  88

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P+ L TND+L+SLTVRQSF+NLGLL+S+A  Q+NNPSI+D+ LI A+QAVV SL    VM
Sbjct  89   PILLLTNDTLSSLTVRQSFQNLGLLQSVAAFQSNNPSIIDVSLIQAFQAVVKSLGDNDVM  148

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDNHI++PGWCCS+ DGNGFFGD YFDP LW+ GLTK+AT+FNG SNVVGMSLRNELR
Sbjct  149  VILDNHITQPGWCCSNSDGNGFFGDQYFDPNLWIQGLTKMATLFNGVSNVVGMSLRNELR  208

Query  657  GPKQNVNDWYRYM  695
            GPKQNVNDWYRYM
Sbjct  209  GPKQNVNDWYRYM  221



>ref|XP_003539156.1| PREDICTED: uncharacterized protein LOC100816102 [Glycine max]
Length=544

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P  V   PL T+ RWIV+ESG+RVKLACVNWV+HL+ VVAEGLS+QP+D ISK+I  MGF
Sbjct  24   PVVVKGFPLHTSERWIVDESGKRVKLACVNWVSHLDAVVAEGLSQQPLDEISKRIKTMGF  83

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVRLTWPLFL TNDS+ASLT+R SF+NLGL++S+ G+QA NPSI+DLPLI AYQAVV S
Sbjct  84   NCVRLTWPLFLVTNDSIASLTLRNSFQNLGLIQSLNGVQAINPSIIDLPLIKAYQAVVKS  143

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L +  VM+ILDNH+S+PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+F G +NVV M
Sbjct  144  LGENDVMVILDNHVSQPGWCCSNLDGNGFFGDQYFDPDLWIMGLTKMATIFKGVTNVVAM  203

Query  636  SLRNELRGPKQNVNDWYRYM  695
            SLRNELRGP+QNVN WYRYM
Sbjct  204  SLRNELRGPRQNVNVWYRYM  223



>gb|AES72136.2| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=608

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PL TN RWIVNES +RVKLACVNW +HL+  VAEGLS QP+DVISK I  MGFNCV
Sbjct  27   VTALPLHTNGRWIVNESEKRVKLACVNWASHLDTSVAEGLSHQPLDVISKGIKSMGFNCV  86

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL L TNDS AS+ VR S  NLGLL+SI+G+QANNPSI+DLPLI AYQ VV SL  
Sbjct  87   RLTWPLLLLTNDSFASIKVRHSLHNLGLLQSISGIQANNPSIIDLPLIKAYQTVVKSLGD  146

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              +M+ILDNH+++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG +NVVGMSLR
Sbjct  147  MDLMVILDNHVTQPGWCCSNSDGNGFFGDQYFDPDLWLMGLTKMATLFNGVTNVVGMSLR  206

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGP+QN+NDWYRYM
Sbjct  207  NELRGPRQNLNDWYRYM  223



>ref|XP_007132485.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
 gb|ESW04479.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
Length=530

 Score =   315 bits (808),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            TV   PL T+ RWIVNE+G+RVKLACVNWV+HL+ VVAEGLS+QP+D ISK+I  MGFNC
Sbjct  21   TVKGFPLHTSDRWIVNENGKRVKLACVNWVSHLDTVVAEGLSQQPLDTISKRIKSMGFNC  80

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            VRLTWPL L TN SLASLTVR SFKNL LL+SI  +QA NPSI+DLPLI AYQ VV SL 
Sbjct  81   VRLTWPLLLLTNHSLASLTVRNSFKNLALLQSIDAVQAINPSIIDLPLIKAYQEVVKSLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  VM+ILDNH++ PGWCCSS DGNGFFGD YFDP LW+IGLT +AT+F G SNVVGMSL
Sbjct  141  ENDVMVILDNHVTVPGWCCSSMDGNGFFGDQYFDPDLWIIGLTNMATLFKGVSNVVGMSL  200

Query  642  RNELRGPKQNVNDWYRYM  695
            RNELRGPKQ+VN WYRYM
Sbjct  201  RNELRGPKQDVNQWYRYM  218



>ref|XP_003601885.1| Endoglucanase [Medicago truncatula]
Length=655

 Score =   318 bits (816),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V A PL TN RWIVNES +RVKLACVNW +HL+  VAEGLS QP+DVISK I  MGFNCV
Sbjct  17   VTALPLHTNGRWIVNESEKRVKLACVNWASHLDTSVAEGLSHQPLDVISKGIKSMGFNCV  76

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL L TNDS AS+ VR S  NLGLL+SI+G+QANNPSI+DLPLI AYQ VV SL  
Sbjct  77   RLTWPLLLLTNDSFASIKVRHSLHNLGLLQSISGIQANNPSIIDLPLIKAYQTVVKSLGD  136

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              +M+ILDNH+++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG +NVVGMSLR
Sbjct  137  MDLMVILDNHVTQPGWCCSNSDGNGFFGDQYFDPDLWLMGLTKMATLFNGVTNVVGMSLR  196

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGP+QN+NDWYRYM
Sbjct  197  NELRGPRQNLNDWYRYM  213



>ref|XP_008446127.1| PREDICTED: uncharacterized protein LOC103488945 [Cucumis melo]
Length=554

 Score =   315 bits (807),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            +A    V  PL T++RWIV+  G RVKL CVNWV+HLE VVAEGLSKQP++ IS +I  +
Sbjct  14   VAASAAVGLPLHTDTRWIVDGEGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIEGL  73

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TN+SL SLTVRQSF+ LGL E+IAG+QANNP I+DLPL+ A++AVV
Sbjct  74   GFNCVRLTWPLFLATNESLNSLTVRQSFQRLGLTEAIAGIQANNPFIIDLPLLKAFEAVV  133

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
            G L + K+M+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++ATMFNG ++VV
Sbjct  134  GKLGEGKLMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRMATMFNGVNHVV  193

Query  630  GMSLRNELRGPKQNVNDWYRYM  695
             MSLRNELRGPKQNVNDWYRYM
Sbjct  194  AMSLRNELRGPKQNVNDWYRYM  215



>ref|XP_004135502.1| PREDICTED: uncharacterized protein LOC101217177 [Cucumis sativus]
Length=549

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            +A    V  PL T++RWIV+ +G RVKL CVNWV+HLE VVAEGLSKQP++ IS +I  +
Sbjct  11   VAASAAVGLPLHTDTRWIVDGAGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIQWL  70

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TN+SL SLTVRQSF+ LGL E+IAG+QANNP I+DLPL+ A++AVV
Sbjct  71   GFNCVRLTWPLFLATNESLNSLTVRQSFQRLGLAEAIAGIQANNPFIIDLPLLKAFEAVV  130

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
            G L + K+M+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++ATMFNG ++VV
Sbjct  131  GKLGEGKLMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRIATMFNGVNHVV  190

Query  630  GMSLRNELRGPKQNVNDWYRYM  695
             MSLRNELRGPKQNVNDWYRYM
Sbjct  191  AMSLRNELRGPKQNVNDWYRYM  212



>gb|KGN51727.1| hypothetical protein Csa_5G593400 [Cucumis sativus]
Length=550

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            +A    V  PL T++RWIV+ +G RVKL CVNWV+HLE VVAEGLSKQP++ IS +I  +
Sbjct  12   VAASAAVGLPLHTDTRWIVDGAGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIQWL  71

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFL TN+SL SLTVRQSF+ LGL E+IAG+QANNP I+DLPL+ A++AVV
Sbjct  72   GFNCVRLTWPLFLATNESLNSLTVRQSFQRLGLAEAIAGIQANNPFIIDLPLLKAFEAVV  131

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
            G L + K+M+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++ATMFNG ++VV
Sbjct  132  GKLGEGKLMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRIATMFNGVNHVV  191

Query  630  GMSLRNELRGPKQNVNDWYRYM  695
             MSLRNELRGPKQNVNDWYRYM
Sbjct  192  AMSLRNELRGPKQNVNDWYRYM  213



>ref|XP_008793719.1| PREDICTED: uncharacterized protein LOC103709945 [Phoenix dactylifera]
Length=530

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            ++A PLST+SRWIV+ESG+RVKLACVNW +HLE V+AEG+ KQP+D ISK+I  MGFNCV
Sbjct  1    MIALPLSTSSRWIVDESGQRVKLACVNWPSHLETVLAEGMGKQPLDTISKEIASMGFNCV  60

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPLFL TNDSLA+LTV+QSF+ LGL ES+A ++ NN ++VDLPLI A++AVV +L  
Sbjct  61   RLTWPLFLATNDSLANLTVQQSFQALGLAESLAAIRVNNQALVDLPLIQAFKAVVTNLGD  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              +M+ILDNHISKPGWCCS++DGNGFFGD YFDP +WV GLT++AT FNGT+NVVGMSLR
Sbjct  121  NNIMVILDNHISKPGWCCSNFDGNGFFGDKYFDPDVWVKGLTRMATTFNGTTNVVGMSLR  180

Query  645  NELRGPKQNVNDWYRYM  695
            NELRG +QNVNDWYRYM
Sbjct  181  NELRGARQNVNDWYRYM  197



>ref|XP_010682344.1| PREDICTED: uncharacterized protein LOC104897211 [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PLST+SRWIV+E G RVKLACVNW +HLE+VVAEGL +QPVDVISKKI D+GFNCVRL
Sbjct  30   ALPLSTSSRWIVDEEGHRVKLACVNWASHLELVVAEGLGQQPVDVISKKIKDLGFNCVRL  89

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWPL+L TN+SLA LTVR+SF N GL +SI+GLQANNPSIVDL LI A+QAVV SL   K
Sbjct  90   TWPLYLATNESLACLTVRESFVNAGLSDSISGLQANNPSIVDLSLINAFQAVVASLTNNK  149

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  650
            VM+ILDNHIS PGWCCS YDGNGFFGD YF+P LW+ GLTK+AT+F     V+GMSLRNE
Sbjct  150  VMVILDNHISTPGWCCSKYDGNGFFGDQYFNPDLWINGLTKMATLFKDNPFVIGMSLRNE  209

Query  651  LRGPKQNVNDWYRYM  695
            LRGPKQNVNDWYR M
Sbjct  210  LRGPKQNVNDWYRCM  224



>ref|XP_004504142.1| PREDICTED: uncharacterized protein LOC101503968 [Cicer arietinum]
Length=554

 Score =   312 bits (800),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 171/205 (83%), Gaps = 3/205 (1%)
 Frame = +3

Query  90   LAPPTVV---AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKI  260
            +A P V    A  L T+SRWIVN+ G RVKLACVNWV+HL+ VVAEGLSK+PVDVIS  I
Sbjct  18   VAEPVVAVSDALSLKTSSRWIVNQDGERVKLACVNWVSHLDAVVAEGLSKKPVDVISHGI  77

Query  261  VDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  440
              MGFNCVRLTWP+ L TN SL+SLTVRQSF+NLGLL++IAG Q+NNPSI+DL LI A+Q
Sbjct  78   KSMGFNCVRLTWPILLLTNQSLSSLTVRQSFQNLGLLDTIAGFQSNNPSIIDLSLIHAFQ  137

Query  441  AVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS  620
            AVV SL    VM+ILDNH+++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG  
Sbjct  138  AVVKSLGDNDVMVILDNHMTQPGWCCSNTDGNGFFGDQYFDPNLWILGLTKMATLFNGVP  197

Query  621  NVVGMSLRNELRGPKQNVNDWYRYM  695
             VV MSLRNELRGPKQNVNDWYRYM
Sbjct  198  TVVAMSLRNELRGPKQNVNDWYRYM  222



>ref|XP_008236799.1| PREDICTED: uncharacterized protein LOC103335561 [Prunus mume]
Length=544

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  278
            P  V+  LSTNSRWIV+  G+RVKLACVNWV+HLE V+AEGLSKQPVD ISK+I  +GFN
Sbjct  28   PATVSATLSTNSRWIVDYKGQRVKLACVNWVSHLEAVIAEGLSKQPVDTISKRIASLGFN  87

Query  279  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            CV+LTWP FL TND+LAS+TV+QSF++L L ESIAGLQ+NNPSI++L L+ AYQAVV SL
Sbjct  88   CVKLTWPTFLATNDTLASVTVQQSFQSLNLSESIAGLQSNNPSIINLTLLQAYQAVVNSL  147

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  638
             K  VM+ILDNH+SKPGWCCSS DGNGFFGD YF+P +W+ GLT++AT+FNG   VVGMS
Sbjct  148  GKNNVMVILDNHVSKPGWCCSSSDGNGFFGDQYFNPDVWIKGLTRMATLFNGVGFVVGMS  207

Query  639  LRNELRGPKQNVNDWYRYM  695
            LRNELRGPKQNV+DWY+ M
Sbjct  208  LRNELRGPKQNVDDWYKDM  226



>ref|XP_004309996.1| PREDICTED: uncharacterized protein LOC101307271 [Fragaria vesca 
subsp. vesca]
Length=550

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST+SRWIV+E+G+RVKLACVNWV+HL+ VVAEGLSKQP+D ISK+I  +GFNCVRLTW
Sbjct  25   PLSTSSRWIVDENGQRVKLACVNWVSHLDPVVAEGLSKQPLDSISKRITSLGFNCVRLTW  84

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            PL+L TNDSLA++TVRQSF++LGL ESIAG+Q+NNPS++DLPL+ A+Q VV +L    VM
Sbjct  85   PLYLATNDSLAAVTVRQSFQSLGLQESIAGVQSNNPSLIDLPLLKAFQEVVTNLGNNNVM  144

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDNH+SKPGWCCS+ D NGFFGD YF+P LW+ GLT++AT+F G SNVVGMSLRNELR
Sbjct  145  VILDNHVSKPGWCCSNNDDNGFFGDKYFNPDLWIKGLTQMATLFKGVSNVVGMSLRNELR  204

Query  657  GPKQNVNDWYRYM  695
            GPKQNV DWY+YM
Sbjct  205  GPKQNVEDWYKYM  217



>gb|KHN29014.1| Endoglucanase [Glycine soja]
Length=533

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            L T+SRWI+N+ G+RVKLACVNWV+HLEV VAEGLSK+PVD ISK I  MGFNCVRLTWP
Sbjct  7    LHTDSRWILNQDGQRVKLACVNWVSHLEVAVAEGLSKKPVDAISKGIKSMGFNCVRLTWP  66

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
              L TNDSLASL+VR+SF++LGLLES+AG+Q NNPSI+DLPLI A+QAVV SL    VM+
Sbjct  67   TLLATNDSLASLSVRRSFQSLGLLESVAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMV  126

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  659
            ILDNH++ PGWCC   DGNGFFGD +F+P  W+ GLTK+AT+FNG +NVVGMSLRNELRG
Sbjct  127  ILDNHLTNPGWCCGYSDGNGFFGDKFFNPDQWIFGLTKMATLFNGVTNVVGMSLRNELRG  186

Query  660  PKQNVNDWYRYM  695
            PKQNVNDWY+YM
Sbjct  187  PKQNVNDWYKYM  198



>ref|XP_003532808.1| PREDICTED: uncharacterized protein LOC100818309 [Glycine max]
Length=574

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            L T+SRWI+N+ G+RVKLACVNWV+HLEV VAEGLSK+PVD ISK I  MGFNCVRLTWP
Sbjct  48   LHTDSRWILNQGGQRVKLACVNWVSHLEVAVAEGLSKKPVDAISKGIKSMGFNCVRLTWP  107

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
              L TNDSLASL+VR+SF++LGLLES+AG+Q NNPSI+DLPLI A+QAVV SL    VM+
Sbjct  108  TLLATNDSLASLSVRRSFQSLGLLESVAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMV  167

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  659
            ILDNH++ PGWCC   DGNGFFGD +F+P  W+ GLTK+AT+FNG +NVVGMSLRNELRG
Sbjct  168  ILDNHLTNPGWCCGYSDGNGFFGDKFFNPDQWIFGLTKMATLFNGVTNVVGMSLRNELRG  227

Query  660  PKQNVNDWYRYM  695
            PKQNVNDWY+YM
Sbjct  228  PKQNVNDWYKYM  239



>ref|XP_008389747.1| PREDICTED: uncharacterized protein LOC103452051 [Malus domestica]
Length=545

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            S L+   V A PLST+ RWIV+E+GRRVKLACVNWV+HL+ V+AEGLSKQPV+ I K+I 
Sbjct  13   SILSLIAVSALPLSTHKRWIVDENGRRVKLACVNWVSHLDTVLAEGLSKQPVNAIIKRIT  72

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             +GFNCVRLTWPLFL TN +LA +TVRQSF++LGLL SI+GLQ+NNP  +DL LI A+QA
Sbjct  73   SLGFNCVRLTWPLFLATNSTLAEVTVRQSFQSLGLLGSISGLQSNNPGFLDLSLIKAFQA  132

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL K  VM++LDNH+SKPGWCCS+ DGNGFFGD YF+P  W++GLT++A +F+G  N
Sbjct  133  VVSSLGKNNVMVVLDNHLSKPGWCCSNTDGNGFFGDEYFNPDNWIVGLTRMAALFHGVRN  192

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGPKQNVNDWY YM
Sbjct  193  VVGMSLRNELRGPKQNVNDWYTYM  216



>ref|XP_010249431.1| PREDICTED: uncharacterized protein LOC104591975 [Nelumbo nucifera]
Length=541

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    A PL T+SRWIV+ESG+RVKLAC NWV+HL+ V+AEGL++QP+DVISK IV MGF
Sbjct  26   PAIATALPLYTDSRWIVDESGKRVKLACANWVSHLQPVLAEGLNRQPLDVISKWIVSMGF  85

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NC+RLTWPL++ TND+LASLTV+QSF++LGLLESI  ++ NNPS+++L +I A+QAVV +
Sbjct  86   NCIRLTWPLWVATNDTLASLTVQQSFESLGLLESIGAIRVNNPSMLNLTIIQAFQAVVSN  145

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L K  VM+I+DNHIS+PGWCC++ DGNGFFGDIYFDP LW+ GLT++AT+FNGTSNV+GM
Sbjct  146  LGKNGVMVIIDNHISQPGWCCANRDGNGFFGDIYFDPDLWIKGLTRMATLFNGTSNVIGM  205

Query  636  SLRNELRGPKQNVNDWYRYM  695
            SLRNELRGPKQNV+ WY+YM
Sbjct  206  SLRNELRGPKQNVSVWYKYM  225



>gb|KJB78033.1| hypothetical protein B456_012G173600 [Gossypium raimondii]
Length=579

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 176/204 (86%), Gaps = 3/204 (1%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            H+ P T +  PLSTNSRWIV+ ++ RRVKLACVNW +HLE V AEGLSK+ +D I+++IV
Sbjct  16   HVNPTTSL--PLSTNSRWIVDDQTDRRVKLACVNWPSHLEPVFAEGLSKRSMDSIAEQIV  73

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLTWPL+L TNDSL+SLTVR+SF+NLGL+E IAG+QANNPS++D+ LI A+QA
Sbjct  74   SMGFNCVRLTWPLYLVTNDSLSSLTVRRSFQNLGLMEPIAGIQANNPSVIDVSLIQAFQA  133

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL K  VM+ILDNH+SKPGWCC  +DG+GFF D YF+P LWV GLT++AT+FNG +N
Sbjct  134  VVSSLGKNNVMVILDNHLSKPGWCCGYFDGDGFFSDPYFNPDLWVTGLTRMATLFNGVTN  193

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGPKQN++DWYRYM
Sbjct  194  VVGMSLRNELRGPKQNIDDWYRYM  217



>ref|XP_010044528.1| PREDICTED: uncharacterized protein LOC104433472 [Eucalyptus grandis]
 gb|KCW86615.1| hypothetical protein EUGRSUZ_B03243 [Eucalyptus grandis]
Length=560

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              A PLST+SRWIV+ SGRRVKLAC NWV+HLE VVAEGLSKQP+  IS +I  +GFNCV
Sbjct  26   AAASPLSTSSRWIVDGSGRRVKLACANWVSHLEPVVAEGLSKQPLGAISARIASLGFNCV  85

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPLFL TNDSLASLTVRQSF+ LGL ++I+G+QANNP I+DL LI  +QAVV SL  
Sbjct  86   RLTWPLFLATNDSLASLTVRQSFQGLGLADAISGIQANNPDILDLSLIETFQAVVSSLGD  145

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC   DGNGFFGD YFDP LW+ GLT++AT+F G  NVVGMSLR
Sbjct  146  NDVMVILDNHLTKPGWCCGYSDGNGFFGDQYFDPDLWIHGLTRMATLFRGVGNVVGMSLR  205

Query  645  NELRGPKQNVNDWYRYM  695
            NELRG +QNV DWY+YM
Sbjct  206  NELRGARQNVKDWYKYM  222



>ref|XP_003524249.1| PREDICTED: uncharacterized protein LOC100789885 [Glycine max]
Length=571

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            L T+SRWI+++ GRRVKLACVNWV+HLE VVAEGLSK+PVDVISK I  MGFNCVRLTWP
Sbjct  45   LHTDSRWILDQDGRRVKLACVNWVSHLEAVVAEGLSKKPVDVISKGIKSMGFNCVRLTWP  104

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
              L TNDSLASLTVR+SF++LGLLESIAG+Q NNPSI+DL LI A+QAVV SL    VM+
Sbjct  105  TLLVTNDSLASLTVRRSFQSLGLLESIAGVQTNNPSIIDLSLIQAFQAVVKSLGDNDVMV  164

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  659
            ILDNH+++PGWCC + DGNGFFGD +FDP  W++GLTK+AT+F G + VVG+SLRNELRG
Sbjct  165  ILDNHVTQPGWCCGNTDGNGFFGDKFFDPNQWILGLTKMATLFKGVTAVVGISLRNELRG  224

Query  660  PKQNVNDWYRYM  695
             +QNVNDWY+YM
Sbjct  225  SRQNVNDWYKYM  236



>gb|KHN06534.1| Endoglucanase [Glycine soja]
Length=566

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            L T+SRWI+++ GRRVKLACVNWV+HLE VVAEGLSK+PVDVISK I  MGFNCVRLTWP
Sbjct  43   LHTDSRWILDQDGRRVKLACVNWVSHLEAVVAEGLSKKPVDVISKGIKSMGFNCVRLTWP  102

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
              L TNDSLASLTVR+SF++LGLLESIAG+Q NNPSI+DL LI A+QAVV SL    VM+
Sbjct  103  TLLVTNDSLASLTVRRSFQSLGLLESIAGVQTNNPSIIDLSLIQAFQAVVKSLGDNDVMV  162

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  659
            ILDNH+++PGWCC + DGNGFFGD +FDP  W++GLTK+AT+F G + VVG+SLRNELRG
Sbjct  163  ILDNHVTQPGWCCGNTDGNGFFGDKFFDPNQWILGLTKMATLFKGVTAVVGISLRNELRG  222

Query  660  PKQNVNDWYRYM  695
             +QNVNDWY+YM
Sbjct  223  SRQNVNDWYKYM  234



>ref|XP_009387346.1| PREDICTED: uncharacterized protein LOC103974285 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+ESG RVKLACVNWV+HLE VV EG+ KQP+D ISKKI  MGFNCVRLTWPLFL T
Sbjct  36   RWIVDESGLRVKLACVNWVSHLEPVVVEGMGKQPLDTISKKIAAMGFNCVRLTWPLFLVT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            NDSLA LTVRQSF+ LGL+ESIA +Q NNP +++L LI A++AVV +LA   VM+ILDNH
Sbjct  96   NDSLAGLTVRQSFQALGLMESIAAIQVNNPDLLNLTLIQAFKAVVSNLADNNVMVILDNH  155

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  674
            ISKPGWCCS++DGNGFFGD YFD + W+ GLTK+ATMFNG+ NVVGMSLRNELRGPKQ V
Sbjct  156  ISKPGWCCSNFDGNGFFGDKYFDAEEWIKGLTKMATMFNGSPNVVGMSLRNELRGPKQGV  215

Query  675  NDWYRYM  695
             +WYRYM
Sbjct  216  TEWYRYM  222



>ref|XP_004504189.1| PREDICTED: uncharacterized protein LOC101490831 [Cicer arietinum]
Length=527

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T+SRWIVN++G RVKLACVNWV+HL+ VVAEGLSK+PVD IS  I  MGFNCVRLTW
Sbjct  28   PLKTSSRWIVNQNGVRVKLACVNWVSHLDAVVAEGLSKKPVDAISNIIKSMGFNCVRLTW  87

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P+ L TN SL+SLTVRQSF+N GLL++IAG Q+NNPSI+DL LI A+QAVV SL    VM
Sbjct  88   PIHLLTNQSLSSLTVRQSFQNHGLLDTIAGFQSNNPSIIDLSLIQAFQAVVKSLGDNNVM  147

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDNH+++PGWCC++ DGNGFFGD YFDP LW+ GLTK+AT+FNG   VV MSLRNELR
Sbjct  148  VILDNHVTQPGWCCTNTDGNGFFGDQYFDPSLWITGLTKMATLFNGVPTVVAMSLRNELR  207

Query  657  GPKQNVNDWYRYM  695
            GPKQ+VN+WYRYM
Sbjct  208  GPKQDVNNWYRYM  220



>ref|XP_010250979.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010250981.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   296 bits (759),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PL T+SRWIV+E+G+RVKL CVNW +HL+ ++AEGL+KQP+DVISK+IV MGFNCVR 
Sbjct  29   ALPLYTDSRWIVDETGKRVKLGCVNWASHLQPLLAEGLNKQPLDVISKQIVAMGFNCVRF  88

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWPL++ TND+L+S+TV+QSF++LGLLESI  ++ NNPS+++L ++ A+Q VV +L +  
Sbjct  89   TWPLWMATNDTLSSMTVQQSFESLGLLESIGAIRVNNPSMLNLTILQAFQTVVSNLGENG  148

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  650
            VM+ILDNHISKPGWCCS+ DGNG+FGDIYFDP LW+ GLT++AT+FNGTSNV+GMSLRNE
Sbjct  149  VMVILDNHISKPGWCCSNTDGNGYFGDIYFDPNLWIEGLTRMATLFNGTSNVIGMSLRNE  208

Query  651  LRGPKQNVNDWYRYM  695
            LRGP Q+V+ WY+YM
Sbjct  209  LRGPNQDVSIWYKYM  223



>ref|XP_011086688.1| PREDICTED: uncharacterized protein LOC105168334 [Sesamum indicum]
Length=574

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            +A  TV AQPLST+SRWIV+E+G+RVKL+CVNW +HLEVVVAEGLSKQPVD IS++I  +
Sbjct  34   IAVSTVAAQPLSTDSRWIVDETGQRVKLSCVNWPSHLEVVVAEGLSKQPVDKISEEIRSL  93

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWPLFLFTND+LA+LTVRQS  NLGL E++AG Q NNP I+DL L+ AYQAVV
Sbjct  94   GFNCVRLTWPLFLFTNDTLAALTVRQSLTNLGLFEAVAGFQTNNPDIIDLSLMDAYQAVV  153

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
            GSL K  VM++LDNH SKPGWCC   DGNGFFGD YF+P LWV GLT+VAT F  T +VV
Sbjct  154  GSLGKKNVMVVLDNHTSKPGWCCGDGDGNGFFGDEYFNPDLWVKGLTRVATTFKDTKHVV  213

Query  630  GMSLRNELRGPKQNVNDWYRYM  695
            GMSLRNELRG +QNV DWYRYM
Sbjct  214  GMSLRNELRGRRQNVYDWYRYM  235



>gb|AAD31066.1|AC007357_15 F3F19.15 [Arabidopsis thaliana]
Length=522

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            ++ PLST+SRWIV+E+G RVKL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  1    MSYPLSTSSRWIVDENGLRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  60

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DLPLI AY+ VV +L  
Sbjct  61   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLPLIEAYKTVVTTLGN  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  FNG SNVVGMSLR
Sbjct  121  NDVMVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNVVGMSLR  180

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDW++YM
Sbjct  181  NELRGPKQNVNDWFKYM  197



>emb|CDY40992.1| BnaA02g27820D [Brassica napus]
Length=418

 Score =   291 bits (745),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLSTNSRWI+NE G+RVKLACVNW  HL++VVAEGLSKQP+D +SKKI+ MGFNCVR
Sbjct  25   MAYPLSTNSRWIINEKGQRVKLACVNWPAHLQLVVAEGLSKQPLDAVSKKIMAMGFNCVR  84

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + IAG Q  NPS++DLPLI AY++VV +L  
Sbjct  85   LTWPLDLATNETLATNVTVRQSFQSLGLSDDIAGFQTKNPSMIDLPLIEAYKSVVTTLGN  144

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
            + +M++LDNH++KPGWCC   D NGFFGD +F+P  W+ GLTK+AT+F   S VVGMSLR
Sbjct  145  HNLMVVLDNHLTKPGWCCRFNDSNGFFGDTFFEPGSWIAGLTKIATLFKDASYVVGMSLR  204

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGP+QNV+DW++YM
Sbjct  205  NELRGPRQNVDDWFKYM  221



>ref|NP_172772.2| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AAU05478.1| At1g13130 [Arabidopsis thaliana]
 gb|AEE28973.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=552

 Score =   295 bits (755),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            ++ PLST+SRWIV+E+G RVKL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MSYPLSTSSRWIVDENGLRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DLPLI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLPLIEAYKTVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  FNG SNVVGMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNVVGMSLR  210

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDW++YM
Sbjct  211  NELRGPKQNVNDWFKYM  227



>ref|XP_006292902.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
 gb|EOA25800.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
Length=511

 Score =   293 bits (750),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST SRWI++E+G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKIV+MGFNCVR
Sbjct  1    MAFPLSTKSRWIIDENGQRVKLACVNWPSHLQPVVAEGLSKQRVDDVAKKIVEMGFNCVR  60

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL++ I+G Q  NPS++DLPL+ AY+ VV  L  
Sbjct  61   LTWPLDLATNETLANNVTVRQSFQSLGLIDDISGFQTKNPSMIDLPLMEAYKTVVAKLGN  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC   DGNGFFGD YFDP  W+ GLTK+AT F GTSNVVGMSLR
Sbjct  121  KNVMVILDNHVTKPGWCCGYDDGNGFFGDTYFDPATWIAGLTKIATTFKGTSNVVGMSLR  180

Query  645  NELRGPKQNVNDWYRYM  695
            NELRG +QNV+DW++YM
Sbjct  181  NELRGARQNVDDWFKYM  197



>ref|XP_003552802.1| PREDICTED: uncharacterized protein LOC100805196 [Glycine max]
Length=533

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            L    V A PL T +RWIV+ +  RVKLACVNWV+HLE +VAEGL ++P+D I+K+I  M
Sbjct  24   LQTKVVKAFPLYTQNRWIVDGNATRVKLACVNWVSHLEYMVAEGLGERPLDGIAKEIKSM  83

Query  270  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  449
            GFNCVRLTWP++L TNDSLA+LTVRQSF NLGL ++I+ LQ NNPS++DLPLI AYQ VV
Sbjct  84   GFNCVRLTWPIYLITNDSLATLTVRQSFNNLGLPQAISALQVNNPSLIDLPLIKAYQDVV  143

Query  450  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  629
              L    +M+ILDNH+SKP WCCS+ DGNGFFGD YFDP LW+ GLTK+AT+F G +NVV
Sbjct  144  KGLGDKGLMVILDNHVSKPQWCCSNDDGNGFFGDQYFDPDLWIKGLTKMATLFKGVTNVV  203

Query  630  GMSLRNELRGPKQNVNDWYRYM  695
             MSLRNELRGP+QN NDW++YM
Sbjct  204  AMSLRNELRGPRQNANDWFKYM  225



>ref|XP_010458756.1| PREDICTED: uncharacterized protein LOC104739968 isoform X2 [Camelina 
sativa]
Length=516

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E G+R+KL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDEKGQRIKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNITVRQSFQSLGLYDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  151  NNVMVILDNHLTKPGWCCANNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGMSLR  210

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDW++YM
Sbjct  211  NELRGPKQNVNDWFKYM  227



>ref|XP_006307168.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
 gb|EOA40066.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
Length=552

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E G+RVKL CVNW +HL+ +VAEGLSKQPVD ++KKIVDMGFNCVR
Sbjct  31   MAHPLSTSSRWIVDEKGQRVKLVCVNWPSHLQPIVAEGLSKQPVDALAKKIVDMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC + DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCDNNDGNGFFGDQFFDPTVWVAALKKMAGTFDGVSNVVGMSLR  210

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDW++YM
Sbjct  211  NELRGPKQNVNDWFKYM  227



>ref|XP_006417151.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
 gb|ESQ35504.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
Length=561

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 168/197 (85%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+DL LI A++ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDLSLIEAFKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +W   L+K+AT F+G +NVVGMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCANNDGNGFFGDRFFDPTVWTAALSKMATTFDGVTNVVGMSLR  210

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDW++YM
Sbjct  211  NELRGPKQNVNDWFKYM  227



>gb|KCW59703.1| hypothetical protein EUGRSUZ_H02464 [Eucalyptus grandis]
Length=470

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVAQ L  NSRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  27   VVAQKLYANSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  86

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL L  N++LAS TV QSF+NLGLLES+AG+++NNPS+++LP++ AY++V+ SL  
Sbjct  87   RLTWPLELPINETLASFTVTQSFQNLGLLESLAGIKSNNPSLINLPVMEAYKSVITSLRN  146

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GMSLR
Sbjct  147  NQVMVILDNHITTPGWCCSEKDGNGFFGDTYFDPQVWMQGLHKMATMATGFSNVIGMSLR  206

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGP+QNV+ WY+YM
Sbjct  207  NELRGPRQNVDAWYKYM  223



>ref|XP_010495004.1| PREDICTED: uncharacterized protein LOC104772051 [Camelina sativa]
Length=550

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E G+RVKL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDEKGQRVKLTCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TND+LA+ +TVRQSF++LGL + I G Q NNPSI+D+ LI AY+ VV +L  
Sbjct  91   LTWPLELMTNDTLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDISLIEAYKTVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  151  NNVMVILDNHLTKPGWCCANNDGNGFFGDQFFDPTVWVAALKKMAGTFDGVSNVVGMSLR  210

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDW++YM
Sbjct  211  NELRGPKQNVNDWFKYM  227



>ref|XP_009385963.1| PREDICTED: uncharacterized protein LOC103973176 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=556

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 160/201 (80%), Gaps = 0/201 (0%)
 Frame = +3

Query  93   APPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMG  272
            A P  +A PLST+SRW+V+  GRRVKLACVNW  HLE  VAEGLSKQP+D ISK +  MG
Sbjct  25   ASPAPIALPLSTSSRWVVDGEGRRVKLACVNWAAHLEPAVAEGLSKQPLDAISKSVAAMG  84

Query  273  FNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            FNCVRLTWPL+L T+ S  S+TVRQS + LGL ES AG++ NNP ++DL L+ A+QAVV 
Sbjct  85   FNCVRLTWPLYLLTDSSFGSVTVRQSLERLGLAESAAGVRVNNPGLLDLTLVQAFQAVVS  144

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +LA   +M+ILDN ISKPGWCCS YD NGFFGD YFDP  W+ GL  +ATMFN +++VVG
Sbjct  145  NLASNSLMVILDNQISKPGWCCSKYDDNGFFGDKYFDPDEWLRGLEMMATMFNSSTSVVG  204

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            MSLRNELRGPKQN++ WYRYM
Sbjct  205  MSLRNELRGPKQNISLWYRYM  225



>ref|XP_010458755.1| PREDICTED: uncharacterized protein LOC104739968 isoform X1 [Camelina 
sativa]
Length=550

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E G+R+KL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDEKGQRIKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNITVRQSFQSLGLYDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  151  NNVMVILDNHLTKPGWCCANNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGMSLR  210

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDW++YM
Sbjct  211  NELRGPKQNVNDWFKYM  227



>ref|XP_007159684.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
 gb|ESW31678.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
Length=573

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            L T+SRWIV + GRRVKLACVNWV+HLEV V EGLSK+PVDVISK I  MGFNCVRLTWP
Sbjct  47   LHTDSRWIVGQDGRRVKLACVNWVSHLEVAVPEGLSKKPVDVISKGIKSMGFNCVRLTWP  106

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
              L TNDSLASL+VR SF+ LGLLE +AG+Q NNPSI+DLPLI A++A+V +L    VM+
Sbjct  107  TLLVTNDSLASLSVRSSFQKLGLLEPVAGVQTNNPSIIDLPLIQAFEAMVKNLGDNDVMV  166

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  659
            ILDNH+++PGWCC + DGNGFF D +F+P  W+ GLTK+AT+F G   VVGMSLRNELRG
Sbjct  167  ILDNHLTQPGWCCGNTDGNGFFTDKFFNPDQWISGLTKMATLFKGVKTVVGMSLRNELRG  226

Query  660  PKQNVNDWYRYM  695
             KQNVNDWY+YM
Sbjct  227  SKQNVNDWYKYM  238



>ref|XP_009385956.1| PREDICTED: uncharacterized protein LOC103973176 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 160/201 (80%), Gaps = 0/201 (0%)
 Frame = +3

Query  93   APPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMG  272
            A P  +A PLST+SRW+V+  GRRVKLACVNW  HLE  VAEGLSKQP+D ISK +  MG
Sbjct  25   ASPAPIALPLSTSSRWVVDGEGRRVKLACVNWAAHLEPAVAEGLSKQPLDAISKSVAAMG  84

Query  273  FNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            FNCVRLTWPL+L T+ S  S+TVRQS + LGL ES AG++ NNP ++DL L+ A+QAVV 
Sbjct  85   FNCVRLTWPLYLLTDSSFGSVTVRQSLERLGLAESAAGVRVNNPGLLDLTLVQAFQAVVS  144

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +LA   +M+ILDN ISKPGWCCS YD NGFFGD YFDP  W+ GL  +ATMFN +++VVG
Sbjct  145  NLASNSLMVILDNQISKPGWCCSKYDDNGFFGDKYFDPDEWLRGLEMMATMFNSSTSVVG  204

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            MSLRNELRGPKQN++ WYRYM
Sbjct  205  MSLRNELRGPKQNISLWYRYM  225



>ref|XP_010250982.1| PREDICTED: uncharacterized protein LOC104593037 isoform X2 [Nelumbo 
nucifera]
Length=531

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PL T+SRWIV+E+G+RVKL CVNW +HL+ ++AEGL+KQP+DVISK+IV MGFNCVR 
Sbjct  29   ALPLYTDSRWIVDETGKRVKLGCVNWASHLQPLLAEGLNKQPLDVISKQIVAMGFNCVRF  88

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWPL++ TND+L+S+TV+QSF++LGLLESI  ++ NNPS+++L ++ A+Q VV +L +  
Sbjct  89   TWPLWMATNDTLSSMTVQQSFESLGLLESIGAIRVNNPSMLNLTILQAFQTVVSNLGENG  148

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  650
            VM+ILDNHISKPGWCCS+ DGNG+FGDIYFDP LW+ GLT++AT+FNGTSNV+GMSLRNE
Sbjct  149  VMVILDNHISKPGWCCSNTDGNGYFGDIYFDPNLWIEGLTRMATLFNGTSNVIGMSLRNE  208

Query  651  LRGPKQNVNDWY  686
            LRGP Q+V+ WY
Sbjct  209  LRGPNQDVSIWY  220



>ref|XP_010691763.1| PREDICTED: uncharacterized protein LOC104905020 [Beta vulgaris 
subsp. vulgaris]
Length=530

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 164/199 (82%), Gaps = 1/199 (1%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            T  A PLST+SRWIV+ESG+RVKLACVNW +H+E++V EGL++QPVD ISKKI DMGFNC
Sbjct  19   TSYALPLSTDSRWIVDESGQRVKLACVNWPSHVELMVTEGLNEQPVDAISKKIRDMGFNC  78

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLL-ESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            VRLT+P++L TND+LAS++VRQ+F N+GL   +IA  QA NPSI+DLP I A+QAVV SL
Sbjct  79   VRLTYPIYLATNDTLASISVRQTFLNVGLPNRTIAKFQAYNPSIIDLPRIDAFQAVVTSL  138

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  638
             K KVM+ILDNH+SKP WCC   DGNGFFGD YF+P+LW+ GLT +AT F     VVGMS
Sbjct  139  GKNKVMVILDNHVSKPQWCCKQTDGNGFFGDKYFNPELWIKGLTNMATRFRDNPYVVGMS  198

Query  639  LRNELRGPKQNVNDWYRYM  695
            LRNELRGP QN NDWY+YM
Sbjct  199  LRNELRGPNQNANDWYKYM  217



>ref|XP_009152076.1| PREDICTED: uncharacterized protein LOC103875318 [Brassica rapa]
Length=559

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 166/199 (83%), Gaps = 4/199 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I  KIV MGFNCV
Sbjct  25   AFPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIGAKIVSMGFNCV  84

Query  285  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL+L T++S +  +TVRQS + LGLLE+I+G QANNP I+DLPLI A+Q VV SL 
Sbjct  85   RLTWPLYLATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLG  144

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGMS  638
            K+++M+ILDNHIS+PGWCC+  DGNGFFGD Y +P+LW+ GL ++ATMF N +SNVVGMS
Sbjct  145  KHRLMVILDNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKRMATMFANVSSNVVGMS  204

Query  639  LRNELRGPKQNVNDWYRYM  695
            LRNELRGPKQN+ DWY+YM
Sbjct  205  LRNELRGPKQNIKDWYKYM  223



>ref|XP_002876948.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53207.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLSTNSRWI++E G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKIV MGFNCVR
Sbjct  1    MAYPLSTNSRWIIDEKGQRVKLACVNWPSHLQPVVAEGLSKQGVDDLAKKIVAMGFNCVR  60

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I+G +  NPS++DLPLI AY+ VV  L  
Sbjct  61   LTWPLDLATNETLANNVTVRQSFQSLGLNDDISGFETKNPSMIDLPLIEAYKKVVAKLGN  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GL K+AT F G SNVVGMSLR
Sbjct  121  KNVMVILDNHVTKPGWCCGYNDGNGFFGDTFFDPATWISGLIKIATTFKGASNVVGMSLR  180

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV+DW++YM
Sbjct  181  NELRGPKQNVDDWFKYM  197



>emb|CDY13613.1| BnaA06g33100D [Brassica napus]
Length=559

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 166/199 (83%), Gaps = 4/199 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I  KIV MGFNCV
Sbjct  25   AFPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIGAKIVSMGFNCV  84

Query  285  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL+L T++S +  +TVRQS + LGLLE+I+G QANNP I+DLPLI A+Q VV SL 
Sbjct  85   RLTWPLYLATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLG  144

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGMS  638
            K+++M+ILDNHIS+PGWCC+  DGNGFFGD Y +P+LW+ GL ++ATMF N +SNVVGMS
Sbjct  145  KHRLMVILDNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKRMATMFANVSSNVVGMS  204

Query  639  LRNELRGPKQNVNDWYRYM  695
            LRNELRGPKQN+ DWY+YM
Sbjct  205  LRNELRGPKQNIKDWYKYM  223



>ref|XP_010249430.1| PREDICTED: uncharacterized protein LOC104591974 [Nelumbo nucifera]
Length=538

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 166/197 (84%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              A PL TNS+WIV+E+G+RVKLACVNW++HL+ ++AEGL++QP+D ISK IV MGFNCV
Sbjct  28   AAALPLYTNSQWIVDENGQRVKLACVNWISHLQPLLAEGLNRQPLDTISKTIVSMGFNCV  87

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            R TWPLF+ TN+SL SL VRQSF+NLGL ESI  +  NNPS+++L +I A++AVV +L  
Sbjct  88   RFTWPLFMATNESLYSLNVRQSFENLGLNESIGAILVNNPSMLNLTVIQAFKAVVDNLGD  147

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNHISKPGWCCS  DGNGFFGD YFDP+LW+ GLT++AT FNGT+NV+GMSLR
Sbjct  148  NNVMVILDNHISKPGWCCSRTDGNGFFGDTYFDPELWIKGLTQMATWFNGTTNVIGMSLR  207

Query  645  NELRGPKQNVNDWYRYM  695
            NELRG +QNV+ WY+YM
Sbjct  208  NELRGSRQNVSVWYKYM  224



>ref|XP_002889989.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66248.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=552

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+RVKL C NW +HL+ VVAEGLSKQP D ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRVKLMCANWPSHLQPVVAEGLSKQPADAVAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFDGVSNVVGMSLR  210

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDW++YM
Sbjct  211  NELRGPKQNVNDWFKYM  227



>ref|XP_006395579.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32865.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=507

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST SRWI++E G+RVKLAC NW  HL+ VVAEGLSKQPVD ++K IV MGFNCVR
Sbjct  26   MAYPLSTKSRWIIDEKGQRVKLACANWPAHLQPVVAEGLSKQPVDAVAKMIVAMGFNCVR  85

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL   ++G Q NNPS++DLPLI AY+ +V +L  
Sbjct  86   LTWPLDLATNETLATNVTVRQSFQSLGLNADMSGFQTNNPSMIDLPLIEAYKRLVATLGN  145

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
            + VM+ILDNH +KPGWCC + DGNGFFGD +FDP  W+ GLTK+AT+F   SNVVGMSLR
Sbjct  146  HNVMVILDNHSTKPGWCCGNDDGNGFFGDTFFDPATWIAGLTKMATIFKDVSNVVGMSLR  205

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV+DW++YM
Sbjct  206  NELRGPKQNVDDWFKYM  222



>emb|CDX83590.1| BnaC07g23300D [Brassica napus]
Length=557

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 162/198 (82%), Gaps = 3/198 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I  KIV MGFNCV
Sbjct  24   AFPLSTDSRWIVDDGNKGRRVKLTCVNWASHLETAVAEGLSKQPLDSIGAKIVSMGFNCV  83

Query  285  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL+L T++S +  +TVRQS + LGLLE+I+G QANNP I+DLPLI A+Q VV SL 
Sbjct  84   RLTWPLYLATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLG  143

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            K ++++ILDNHIS+PGWCC+  DGNGFFGD Y +P+LW+ GL  +ATMF   SNVVGMSL
Sbjct  144  KNRLLVILDNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKNMATMFANVSNVVGMSL  203

Query  642  RNELRGPKQNVNDWYRYM  695
            RNELRGPKQN+ DWY+YM
Sbjct  204  RNELRGPKQNIKDWYKYM  221



>ref|XP_010514260.1| PREDICTED: uncharacterized protein LOC104790246 [Camelina sativa]
Length=511

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST S WI++E G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKI++MGFNCVR
Sbjct  49   MAFPLSTKSHWIIDEKGQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAKKILEMGFNCVR  108

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF+ LGL + I+G Q  NPS++DLPLI AY+ VV  L  
Sbjct  109  LTWPLDLATNETLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGD  168

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+AT F GTSNVVGMSLR
Sbjct  169  KNVMVILDNHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGMSLR  228

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV+ W++YM
Sbjct  229  NELRGPKQNVDAWFKYM  245



>ref|XP_006395580.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32866.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=534

 Score =   290 bits (741),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST SRWI++E G+RVKLAC NW  HL+ VVAEGLSKQPVD ++K IV MGFNCVR
Sbjct  26   MAYPLSTKSRWIIDEKGQRVKLACANWPAHLQPVVAEGLSKQPVDAVAKMIVAMGFNCVR  85

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++LGL   ++G Q NNPS++DLPLI AY+ +V +L  
Sbjct  86   LTWPLDLATNETLATNVTVRQSFQSLGLNADMSGFQTNNPSMIDLPLIEAYKRLVATLGN  145

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
            + VM+ILDNH +KPGWCC + DGNGFFGD +FDP  W+ GLTK+AT+F   SNVVGMSLR
Sbjct  146  HNVMVILDNHSTKPGWCCGNDDGNGFFGDTFFDPATWIAGLTKMATIFKDVSNVVGMSLR  205

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV+DW++YM
Sbjct  206  NELRGPKQNVDDWFKYM  222



>ref|XP_010026597.1| PREDICTED: uncharacterized protein LOC104416968 [Eucalyptus grandis]
 gb|KCW59702.1| hypothetical protein EUGRSUZ_H02462 [Eucalyptus grandis]
Length=514

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVAQ L  +SRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  7    VVAQQLYADSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  66

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTW L L  N++LASLTV QSF+NLGL ES+AG+++NNPS+++LPL+ AY++V+ SL  
Sbjct  67   RLTWALELPMNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKSVMTSLRN  126

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GMSLR
Sbjct  127  NQVMVILDNHITTPGWCCSGEDGNGFFGDKYFDPQVWIQGLHKMATMATGFSNVIGMSLR  186

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGP+QNV+DWY+YM
Sbjct  187  NELRGPRQNVDDWYKYM  203



>ref|XP_010476303.1| PREDICTED: uncharacterized protein LOC104755594 [Camelina sativa]
Length=559

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E G+RVKL C NW +HL+ VVAEGLSKQPVD ++KKIVDMGFNCVR
Sbjct  43   MAYPLSTSSRWIVDEKGQRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVDMGFNCVR  102

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVR SF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  103  LTWPLDLMTNETLANNVTVRHSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  162

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC + DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  163  NNVMVILDNHLTKPGWCCDNNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGMSLR  222

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDW+ YM
Sbjct  223  NELRGPKQNVNDWFNYM  239



>ref|XP_010425288.1| PREDICTED: uncharacterized protein LOC104710406 [Camelina sativa]
Length=555

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST SRWI++  G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKI++MGFNCVR
Sbjct  48   MAFPLSTKSRWIIDVKGQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAKKILEMGFNCVR  107

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TND+LA+ +TVRQSF+ LGL + I+G Q  NPS++DLPLI AY+ VV  L  
Sbjct  108  LTWPLDLATNDTLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGD  167

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+AT F GTSNVVGMSLR
Sbjct  168  RNVMVILDNHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGMSLR  227

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV+ W++YM
Sbjct  228  NELRGPKQNVDAWFKYM  244



>ref|XP_010026596.1| PREDICTED: uncharacterized protein LOC104416965 [Eucalyptus grandis]
Length=515

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVAQ L  +SRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  7    VVAQQLYADSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  66

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTW L L  N++LASLTV QSF+NLGL ES+AG+++NNPS+++LPL+ AY++V+ SL  
Sbjct  67   RLTWALELPMNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKSVMTSLRN  126

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GMSLR
Sbjct  127  NQVMVILDNHITTPGWCCSGEDGNGFFGDKYFDPQVWMQGLHKMATMATGFSNVIGMSLR  186

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGP+QNV+DWY+YM
Sbjct  187  NELRGPRQNVDDWYKYM  203



>emb|CDY16066.1| BnaC08g40570D [Brassica napus]
Length=553

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 167/205 (81%), Gaps = 3/205 (1%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            +H  P   +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD ++KKIV
Sbjct  24   AHTVPN--MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIV  81

Query  264  DMGFNCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  440
            +MGFNCVRLTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+D  LI A +
Sbjct  82   EMGFNCVRLTWPLDLMTNETLANNVTVRQSFQSLGLTDDIVGFQTNNPSIIDFSLIEALK  141

Query  441  AVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS  620
             VV  L  + VM ILDNH++K GWCC++ DGNGFFGD +FDP +W   L+K+A  FNG S
Sbjct  142  MVVTKLGNHNVMAILDNHLTKSGWCCANNDGNGFFGDNFFDPTVWTAALSKMAATFNGVS  201

Query  621  NVVGMSLRNELRGPKQNVNDWYRYM  695
            NVVGMSLRNELRGPKQNVNDW++YM
Sbjct  202  NVVGMSLRNELRGPKQNVNDWFKYM  226



>gb|KFK43579.1| hypothetical protein AALP_AA1G144700 [Arabis alpina]
Length=646

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+R+KLAC NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRIKLACANWPSHLQPVVAEGLSKQPVDALAKKIVEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+DL LI A++ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSFGLNDDIVGFQTNNPSIIDLSLIEAFKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCCS+ DGNGFFGD +FDP +W   L+K+A  F+G SNV+GMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCSNNDGNGFFGDRFFDPTVWTAALSKMAATFDGVSNVIGMSLR  210

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNVNDW++YM
Sbjct  211  NELRGPKQNVNDWFKYM  227



>gb|KCW59699.1| hypothetical protein EUGRSUZ_H02457, partial [Eucalyptus grandis]
Length=528

 Score =   289 bits (739),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            S  A P   +  L T SRWIV++ G RVKLACVNW +HLE +VAEGL K+PVD ISK+I 
Sbjct  19   SQHAEPAKASWRLHTESRWIVDKHGHRVKLACVNWASHLEPMVAEGLDKKPVDWISKQIA  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLTWPLF+ TNDSL S++V QSF++LGL++ I G++ NNPS++D+ ++ A++A
Sbjct  79   SMGFNCVRLTWPLFMVTNDSLGSMSVAQSFRDLGLVDYIGGIRQNNPSLLDVSVLAAFRA  138

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL    VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++ATM     N
Sbjct  139  VVTSLGDNSVMVILDNHISKPGWCCSNRDGNGFFGDQYFDPNLWIKGLTRMATMIRRIGN  198

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGPK+N+ DW RYM
Sbjct  199  VVGMSLRNELRGPKENLRDWLRYM  222



>ref|XP_010026595.1| PREDICTED: uncharacterized protein LOC104416964 [Eucalyptus grandis]
Length=535

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            S  A P   +  L T SRWIV++ G RVKLACVNW +HLE +VAEGL K+PVD ISK+I 
Sbjct  19   SQHAEPAKASWRLHTESRWIVDKHGHRVKLACVNWASHLEPMVAEGLDKKPVDWISKQIA  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLTWPLF+ TNDSL S++V QSF++LGL++ I G++ NNPS++D+ ++ A++A
Sbjct  79   SMGFNCVRLTWPLFMVTNDSLGSMSVAQSFRDLGLVDYIGGIRQNNPSLLDVSVLAAFRA  138

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL    VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++ATM     N
Sbjct  139  VVTSLGDNSVMVILDNHISKPGWCCSNRDGNGFFGDQYFDPNLWIKGLTRMATMIRRIGN  198

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGPK+N+ DW RYM
Sbjct  199  VVGMSLRNELRGPKENLRDWLRYM  222



>ref|NP_189245.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 dbj|BAB02434.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77125.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=508

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLSTNSRWI++E G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKI+ MGFNCVR
Sbjct  1    MAYPLSTNSRWIIDEKGQRVKLACVNWPSHLQPVVAEGLSKQSVDDLAKKIMAMGFNCVR  60

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
             TWPL L TN++LA+ +TVRQSF++LGL + I+G +  NPS++DLPLI AY+ VV  L  
Sbjct  61   FTWPLDLATNETLANNVTVRQSFQSLGLNDDISGFETKNPSMIDLPLIEAYKKVVAKLGN  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+A  F G +NVVGMSLR
Sbjct  121  NNVMVILDNHVTKPGWCCGYNDGNGFFGDTFFDPTTWIAGLTKIAMTFKGATNVVGMSLR  180

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV+DW++YM
Sbjct  181  NELRGPKQNVDDWFKYM  197



>ref|XP_010026599.1| PREDICTED: uncharacterized protein LOC104416971 [Eucalyptus grandis]
Length=419

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 172/222 (77%), Gaps = 0/222 (0%)
 Frame = +3

Query  30   MENKYSFllclilcniiiSHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVV  209
            M  + S+L  + L  ++ S  A P      L T+SRWIV++ GRRVKLACVNW +HLE +
Sbjct  1    MRRRPSYLCFIALWALVASRHAEPAKAPWRLHTDSRWIVDKHGRRVKLACVNWASHLEPM  60

Query  210  VAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGL  389
            VAEGL K+PVD ISK+I  MGFNCVRLTWPLF+ TNDSL S++V QSF+NLGL++ I G+
Sbjct  61   VAEGLDKKPVDWISKQIASMGFNCVRLTWPLFMVTNDSLGSMSVAQSFRNLGLVDYIGGI  120

Query  390  QANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPK  569
            + NN S++D+ ++ A++AVV SL    VM+ILDNHISKPGWCCS+ D NGFFGD YFDP 
Sbjct  121  RQNNLSLLDVSVLAAFRAVVKSLGDNNVMVILDNHISKPGWCCSNRDSNGFFGDPYFDPN  180

Query  570  LWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYM  695
            LW+ GLT++AT+F+   NVVGMSLRNELRGPK+N+ DW RYM
Sbjct  181  LWIKGLTRMATLFHRVGNVVGMSLRNELRGPKENLRDWLRYM  222



>ref|XP_010026600.1| PREDICTED: uncharacterized protein LOC104416972 [Eucalyptus grandis]
Length=647

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVAQ L  NSRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  139  VVAQKLYANSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  198

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLTWPL L  N++LAS TV QSF+NLGLLES+AG+++NNPS+++LP++ AY++V+ SL  
Sbjct  199  RLTWPLELPINETLASFTVTQSFQNLGLLESLAGIKSNNPSLINLPVMEAYKSVITSLRN  258

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GMSLR
Sbjct  259  NQVMVILDNHITTPGWCCSEKDGNGFFGDTYFDPQVWMQGLHKMATMATGFSNVIGMSLR  318

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGP+QNV+ WY+YM
Sbjct  319  NELRGPRQNVDAWYKYM  335



>ref|XP_009152075.1| PREDICTED: uncharacterized protein LOC103875317 [Brassica rapa]
Length=538

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 161/197 (82%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A  LSTNSRWI++E G R KLACVNW  HL+  VAEGLSKQPVD +++KIV MGFNCVR
Sbjct  26   MAYLLSTNSRWIIDEKGERTKLACVNWPAHLQPAVAEGLSKQPVDAVAQKIVAMGFNCVR  85

Query  288  LTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN +LA S+TVR SF++LGL   I+G +  NPS++DLPLI AYQ+VV +L  
Sbjct  86   LTWPLDLATNVTLATSVTVRDSFQSLGLNTDISGFETKNPSMIDLPLIEAYQSVVTTLGN  145

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
            Y VM+ILDNH++KPGWCC + DGNGFFGDI+FDP  W+ GLT +AT F  TSNVVGMSLR
Sbjct  146  YNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSNVVGMSLR  205

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV+DW++YM
Sbjct  206  NELRGPKQNVDDWFKYM  222



>ref|XP_010502524.1| PREDICTED: uncharacterized protein LOC104779826 [Camelina sativa]
Length=534

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST SRWI++  G+RVKLACVNW +HL+ VVAEGLSKQ VD +++KI++MGFNCVR
Sbjct  27   MAFPLSTKSRWIIDVKGQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAEKILEMGFNCVR  86

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTWPL L TN++LA+ +TVRQSF+ LGL + I+G Q  NPS++DLPLI AY+ VV  L  
Sbjct  87   LTWPLDLATNETLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGD  146

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+AT F GTSNVVGMSLR
Sbjct  147  KNVMVILDNHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGMSLR  206

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQNV+ W++YM
Sbjct  207  NELRGPKQNVDAWFKYM  223



>dbj|BAK05121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 161/203 (79%), Gaps = 2/203 (1%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H AP   V   LST SRW+V+E G RVKLACVNW +HLE ++AEGL K+PV  I+  +  
Sbjct  28   HHAPAAAVT--LSTASRWVVDEDGDRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAA  85

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWP FL TN S +SLTV QSF+ L L ES+AG++ANNP++VDL LI A++AV
Sbjct  86   MGFNCVRLTWPTFLVTNASYSSLTVEQSFQRLNLTESLAGIRANNPAVVDLKLIDAFKAV  145

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL +  VM+ILDNH+SKPGWCC + DGNGFFGD YF+P +WV GLTK+ATMF G  +V
Sbjct  146  VSSLGENNVMVILDNHVSKPGWCCDNADGNGFFGDGYFEPDVWVDGLTKMATMFAGVPHV  205

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRGP+QN NDWY+YM
Sbjct  206  VGMSLRNELRGPRQNSNDWYKYM  228



>emb|CDY19395.1| BnaC05g09040D [Brassica napus]
Length=527

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  1    MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  60

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTW L L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+D+ LI A++ VV +L  
Sbjct  61   LTWALDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGN  120

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP  W   L+K+A  F+G SNVVGMSLR
Sbjct  121  NDVMVILDNHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGMSLR  180

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQN +DW++YM
Sbjct  181  NELRGPKQNADDWFKYM  197



>gb|ACU18247.1| unknown [Glycine max]
Length=195

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  198  LEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLES  377
            LE VVAEGLSK+PVDVIS  I  MGFNCVRLTWP+ L TNDSLASLTVR SF+NL LLES
Sbjct  21   LEAVVAEGLSKKPVDVISNGIKSMGFNCVRLTWPIVLVTNDSLASLTVRSSFQNLALLES  80

Query  378  IAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIY  557
            IAG+Q NNPSI+DLPLI A+QAVV SL    VM+ILDNHI++PGWCCS+ DGNGFFGD +
Sbjct  81   IAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKF  140

Query  558  FDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYM  695
            FDP  W++GLTK+A++FNG +NVVGMSLRNELRGPKQNVNDWY+YM
Sbjct  141  FDPNQWILGLTKMASLFNGVTNVVGMSLRNELRGPKQNVNDWYKYM  186



>ref|XP_006395581.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
 gb|ESQ32867.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
Length=557

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 164/199 (82%), Gaps = 4/199 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGFNCV
Sbjct  26   AFPLSTDSRWIVDDGIKGRRVKLTCVNWPSHLETAVAEGLSKQPIDSIAEKIVLMGFNCV  85

Query  285  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL+L T++S +  +TVRQS +  GL E+++G QANNPSI+DLPLI A+Q VV  L 
Sbjct  86   RLTWPLYLATDESFSGIMTVRQSLRKFGLFEAVSGFQANNPSILDLPLIKAFQEVVTCLG  145

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGMS  638
             +++M++LDNHIS+PGWCCS  DGNGFFGD + +P LW+ GL K+A+MF N +SNVVGMS
Sbjct  146  NHRLMVVLDNHISQPGWCCSDNDGNGFFGDRHLNPNLWIKGLMKLASMFANVSSNVVGMS  205

Query  639  LRNELRGPKQNVNDWYRYM  695
            LRNELRGPKQN+ DWY+YM
Sbjct  206  LRNELRGPKQNIKDWYKYM  224



>ref|NP_001130915.1| hydrolase, hydrolyzing O-glycosyl compound precursor [Zea mays]
 gb|ACF85192.1| unknown [Zea mays]
 gb|ACG23910.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
 gb|ACN27949.1| unknown [Zea mays]
 gb|ACN28477.1| unknown [Zea mays]
 gb|ACN34624.1| unknown [Zea mays]
 gb|ACN34788.1| unknown [Zea mays]
 tpg|DAA37297.1| TPA: hydrolase, hydrolyzing O-glycosyl compound [Zea mays]
Length=576

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 158/196 (81%), Gaps = 0/196 (0%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
             A  LST SRW+++ESG RVKLACVNW +HLE V+AEGL K+PV  I+  +  MGFNCVR
Sbjct  32   AAATLSTASRWVLDESGSRVKLACVNWPSHLEPVLAEGLGKRPVGAIAADVAAMGFNCVR  91

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
             TWP FL T+ S + LTV QSF+ L L ES+AG++ NNP +VDL LI A++AVV SL ++
Sbjct  92   FTWPTFLVTDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAVVSSLGEH  151

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             +M+ILDNH+SKPGWCCS+ DG+GFFGD YFDP +WV GLTK+ATMF G  NVVGMSLRN
Sbjct  152  NLMVILDNHLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNVVGMSLRN  211

Query  648  ELRGPKQNVNDWYRYM  695
            ELRGP+QNVNDWY+YM
Sbjct  212  ELRGPRQNVNDWYKYM  227



>gb|ACF79301.1| unknown [Zea mays]
Length=576

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 158/196 (81%), Gaps = 0/196 (0%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
             A  LST SRW+++ESG RVKLACVNW +HLE V+AEGL K+PV  I+  +  MGFNCVR
Sbjct  32   AAATLSTASRWVLDESGSRVKLACVNWPSHLEPVLAEGLGKRPVGAIAADVAAMGFNCVR  91

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
             TWP FL T+ S + LTV QSF+ L L ES+AG++ NNP +VDL LI A++AVV SL ++
Sbjct  92   FTWPTFLVTDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAVVSSLGEH  151

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             +M+ILDNH+SKPGWCCS+ DG+GFFGD YFDP +WV GLTK+ATMF G  NVVGMSLRN
Sbjct  152  NLMVILDNHLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNVVGMSLRN  211

Query  648  ELRGPKQNVNDWYRYM  695
            ELRGP+QNVNDWY+YM
Sbjct  212  ELRGPRQNVNDWYKYM  227



>ref|XP_006290844.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
 gb|EOA23742.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
Length=554

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 164/203 (81%), Gaps = 5/203 (2%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            T  A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGF
Sbjct  18   TTFALPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPMDSIAEKIVSMGF  77

Query  276  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL+L T++S +  +TVRQS    GL E+++G Q +NP+++DLPLI A+Q VV 
Sbjct  78   NCVRLTWPLYLATDESFSDIMTVRQSLLKFGLFEAVSGFQVHNPTVLDLPLIKAFQEVVA  137

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF--NGTSNV  626
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF  N +SNV
Sbjct  138  CLGKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFASNVSSNV  197

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRGPKQN+ DWY YM
Sbjct  198  VGMSLRNELRGPKQNIKDWYMYM  220



>ref|XP_010556350.1| PREDICTED: uncharacterized protein LOC104825676 [Tarenaya hassleriana]
Length=560

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 166/196 (85%), Gaps = 1/196 (1%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PLST+SRWIV+E+G+RVKLAC NW +HL+ VVAEGLSK+PV+ I++KIV MGFNCVRL
Sbjct  29   AYPLSTSSRWIVDETGQRVKLACANWPSHLQPVVAEGLSKKPVEEIAEKIVGMGFNCVRL  88

Query  291  TWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            TWPL L TN +LA ++TVRQSF++LGL + I G Q +NPSI+DLPLI A++ VV +L   
Sbjct  89   TWPLDLATNFTLAHNVTVRQSFQSLGLNDDIVGFQTHNPSIIDLPLIDAFKTVVEALGNK  148

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             VM++LDNHI+KPGWCCS+ DGNGFFGD +FDP +W+ GLT +A++FNG SNVVGMSLRN
Sbjct  149  GVMVVLDNHITKPGWCCSNDDGNGFFGDRFFDPAVWISGLTNMASIFNGVSNVVGMSLRN  208

Query  648  ELRGPKQNVNDWYRYM  695
            ELRG +QN NDW++YM
Sbjct  209  ELRGSRQNTNDWFKYM  224



>ref|XP_009148543.1| PREDICTED: uncharacterized protein LOC103871957 [Brassica rapa]
Length=574

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD +++KIV+MGFNCVR
Sbjct  48   MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDDVARKIVEMGFNCVR  107

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTW L L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+D+ LI A++ VV +L  
Sbjct  108  LTWALDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGN  167

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP  W   L+K+A  F+G SNVVGMSLR
Sbjct  168  NDVMVILDNHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGMSLR  227

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQN +DW++YM
Sbjct  228  NELRGPKQNADDWFKYM  244



>ref|XP_010528075.1| PREDICTED: uncharacterized protein LOC104805267 [Tarenaya hassleriana]
Length=575

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST+SRWIV  +GRRVKLAC+ W +HL+  VAEGLSK+P+D I++KI+ MGFNCVR TW
Sbjct  26   PLSTDSRWIVGLTGRRVKLACIVWPSHLDAAVAEGLSKRPMDAIAEKILSMGFNCVRFTW  85

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            PL+L T+DS AS+TVRQS + LGL E+I+G+QANNPSI+DLPLI A+Q +V  L K ++M
Sbjct  86   PLYLATDDSFASMTVRQSLRRLGLFEAISGVQANNPSIIDLPLIRAFQEMVSCLGKNRLM  145

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDN+ S+PGWCCS  DGNGFF D +F+P LW+  L K+A+MF   SNVVGMSLRN+LR
Sbjct  146  VILDNYTSQPGWCCSDNDGNGFFWDRHFNPDLWINSLKKMASMFANVSNVVGMSLRNDLR  205

Query  657  GPKQNVNDWYRYM  695
            GP+QN +DWY+YM
Sbjct  206  GPRQNTDDWYKYM  218



>ref|NP_189244.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AEE77124.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=551

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            T  A P ST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGF
Sbjct  17   TTFAFPPSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDAIAEKIVSMGF  76

Query  276  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL+L T++S ++ +TVRQS +   L E+++G Q +NP+I+DLPLI A+Q VV 
Sbjct  77   NCVRLTWPLYLATDESFSAFMTVRQSLRKFRLFEAVSGFQTHNPTILDLPLIKAFQEVVY  136

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVV  629
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF N +SNVV
Sbjct  137  CLEKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVV  196

Query  630  GMSLRNELRGPKQNVNDWYRYM  695
            GMSLRNELRGPKQN+ DWY+YM
Sbjct  197  GMSLRNELRGPKQNIKDWYKYM  218



>ref|XP_006648806.1| PREDICTED: uncharacterized protein LOC102721430 [Oryza brachyantha]
Length=340

 Score =   275 bits (704),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVA  LST+SRWIV+E+GRRVKLACVNW +HLE VVAEGL +QPVD ISKK+  +GFNCV
Sbjct  35   VVAVTLSTSSRWIVDEAGRRVKLACVNWPSHLEPVVAEGLGRQPVDAISKKVASLGFNCV  94

Query  285  RLTWPLFLFTNDSLASLTVRQ-SFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLT+P+ L TN SL+SLTVRQ S    GL E++AG+  NNP  +DL LI +++AVV SL 
Sbjct  95   RLTYPIALATNASLSSLTVRQGSLLAHGLAETVAGVGENNPGFLDLTLIESFRAVVDSLG  154

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  VM+ILDNH+S+PGWCC+  DGNGFFGD YFD  +WV GL  +A +F G  NVVGMSL
Sbjct  155  ENDVMVILDNHVSQPGWCCADDDGNGFFGDRYFDSDVWVQGLANMAALFAGVPNVVGMSL  214

Query  642  RNELRGPKQNVNDWYRYM  695
            RNELRGP+QN  DWYRYM
Sbjct  215  RNELRGPRQNHGDWYRYM  232



>emb|CDX98009.1| BnaA06g07600D [Brassica napus]
Length=557

 Score =   282 bits (721),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = +3

Query  108  VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD +++KI++MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDDVARKILEMGFNCVR  90

Query  288  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            LTW L L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+D+ LI A++ VV +L  
Sbjct  91   LTWALDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGN  150

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP  W   L+K+A  F+G SNVVGMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGMSLR  210

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQN +DW++YM
Sbjct  211  NELRGPKQNADDWFKYM  227



>dbj|BAB02432.1| unnamed protein product [Arabidopsis thaliana]
Length=561

 Score =   282 bits (721),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            T  A P ST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGF
Sbjct  25   TTFAFPPSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDAIAEKIVSMGF  84

Query  276  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL+L T++S ++ +TVRQS +   L E+++G Q +NP+I+DLPLI A+Q VV 
Sbjct  85   NCVRLTWPLYLATDESFSAFMTVRQSLRKFRLFEAVSGFQTHNPTILDLPLIKAFQEVVY  144

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVV  629
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF N +SNVV
Sbjct  145  CLEKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVV  204

Query  630  GMSLRNELRGPKQNVNDWYRYM  695
            GMSLRNELRGPKQN+ DWY+YM
Sbjct  205  GMSLRNELRGPKQNIKDWYKYM  226



>ref|XP_002284888.2| PREDICTED: uncharacterized protein LOC100258876 [Vitis vinifera]
Length=518

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 159/197 (81%), Gaps = 5/197 (3%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVA PL TNSRWIV+E G RVKLACVNW++H E  VAEGLS  PVD+ISK+I  +GFNCV
Sbjct  32   VVALPLHTNSRWIVDEDGARVKLACVNWLSHQEAAVAEGLSNHPVDLISKRIASLGFNCV  91

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLT PLFL  + SLASLTVRQSF+ LGLLES+AG QANNPS++DLPL +AYQAVV +LA 
Sbjct  92   RLTLPLFLAIDQSLASLTVRQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNLAD  151

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              +M+ILD+H S+P     S+ GNG FGD +F+P LWV GLT++ATMF+G  NVVGMSLR
Sbjct  152  NNMMVILDSHFSEP-----SFHGNGVFGDQHFNPDLWVKGLTRIATMFSGVPNVVGMSLR  206

Query  645  NELRGPKQNVNDWYRYM  695
            NELR P QNV DWYRYM
Sbjct  207  NELRCPNQNVKDWYRYM  223



>ref|XP_002446675.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
 gb|EES11003.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
Length=586

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            LST SRW+V+ESG RVKLACVNW +HLE ++AEGL K+PV  I+  +  MGFNCVR TWP
Sbjct  38   LSTASRWVVDESGSRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAAMGFNCVRFTWP  97

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
             FL TN S + LTV QSF  L L ES+AG++ NNP  VDL LI A++AVV SL ++ VM+
Sbjct  98   TFLVTNASYSGLTVAQSFLRLNLTESLAGIRVNNPGFVDLKLIDAFKAVVSSLGEHDVMV  157

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  659
            ILDNH+SKPGWCCS+ DGNGFFGD  FDP +WV GLTK+ATMF G  NVVGMSLRNELRG
Sbjct  158  ILDNHLSKPGWCCSNTDGNGFFGDALFDPDVWVDGLTKMATMFAGVPNVVGMSLRNELRG  217

Query  660  PKQNVNDWYRYM  695
            P+QN NDWY+YM
Sbjct  218  PRQNANDWYKYM  229



>ref|XP_004975985.1| PREDICTED: uncharacterized protein LOC101760765 [Setaria italica]
Length=566

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            LST SRW+V+E G RVKLACVNW +HLE ++AEGLSK+PV  I+  +  MGFNCVRLTWP
Sbjct  33   LSTASRWVVDEGGSRVKLACVNWPSHLEPMLAEGLSKRPVGAIAAAVAAMGFNCVRLTWP  92

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
             FL T+ S   LTV QSF+ L L ES+AG++ANNP  VDL LI A +AVV SL K+ VM+
Sbjct  93   TFLATDASYGELTVAQSFQRLNLTESLAGIRANNPDFVDLKLIDALKAVVSSLGKHDVMV  152

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  659
            ILDNH+SKPGWCCS+ DGNGFFGD YFDP +WV GL K+A MF G  NVVGMSLRNELRG
Sbjct  153  ILDNHLSKPGWCCSNTDGNGFFGDTYFDPDVWVAGLKKMAAMFAGVDNVVGMSLRNELRG  212

Query  660  PKQNVNDWYRYM  695
            P+QN NDWY+YM
Sbjct  213  PRQNANDWYKYM  224



>gb|KFK33555.1| hypothetical protein AALP_AA5G028800 [Arabis alpina]
Length=552

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 162/197 (82%), Gaps = 4/197 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            PLSTNSRWIV++S  GRRVKL C+NW +HLE  VAEGLSKQP+D I+ KI  MGFNCVRL
Sbjct  24   PLSTNSRWIVDDSNHGRRVKLTCINWPSHLETAVAEGLSKQPLDSIADKIFSMGFNCVRL  83

Query  291  TWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            TWPL+L T++S +  +TVRQS +   L E+++G Q NNPSI+DLPLI A+Q VV  L  +
Sbjct  84   TWPLYLATDESFSGVMTVRQSLRKFRLFEAVSGFQVNNPSILDLPLIKAFQEVVTCLGNH  143

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGMSLR  644
             +M+ILDNHIS+PGWCC++ DGNGFFGD + +P++W+ GL K+A+MF N +SNVVGMSLR
Sbjct  144  GLMVILDNHISQPGWCCNANDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVVGMSLR  203

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGPKQN+NDWY+YM
Sbjct  204  NELRGPKQNINDWYKYM  220



>ref|XP_002876947.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53206.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   279 bits (714),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 163/202 (81%), Gaps = 4/202 (2%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            T  A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQ +D I++KIV MGF
Sbjct  17   TTFAFPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQSLDSIAEKIVSMGF  76

Query  276  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL+L T++S +  +TVRQS +   LLE+++G Q +NP+I+DLPLI A+Q VV 
Sbjct  77   NCVRLTWPLYLATDESFSDIMTVRQSLRKFRLLEAVSGFQTHNPTILDLPLIKAFQEVVS  136

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVV  629
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF N +SNVV
Sbjct  137  CLGKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVV  196

Query  630  GMSLRNELRGPKQNVNDWYRYM  695
            GM LRNELRGPKQN+ DWY YM
Sbjct  197  GMCLRNELRGPKQNIKDWYTYM  218



>ref|XP_010535458.1| PREDICTED: uncharacterized protein LOC104810759 [Tarenaya hassleriana]
Length=394

 Score =   275 bits (702),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
             +A PLSTNSRWIVNE G+RVKLACVNW +HL+ VVAEGLS+QPV  I+ +IV M FNCV
Sbjct  26   TMAYPLSTNSRWIVNEGGQRVKLACVNWPSHLQPVVAEGLSQQPVTEIANRIVAMKFNCV  85

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L  ND+LA S+TVRQSF++LGL + I G+Q  NP+ +DLPLI A + VV  L 
Sbjct  86   RLTWPLELAINDTLANSVTVRQSFQSLGLNDDIDGIQRKNPNFIDLPLIEALKTVVNVLG  145

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  VM+ILDNH++ PGWCCS+ DGNGFFGD +FDP  W+ G  K+A +FNG SNV+GMSL
Sbjct  146  QKGVMVILDNHLTVPGWCCSAGDGNGFFGDRFFDPTAWINGWKKMAGIFNGVSNVIGMSL  205

Query  642  RNELRGPKQNVNDWYRYM  695
            RNELRG KQNVNDWY YM
Sbjct  206  RNELRGRKQNVNDWYTYM  223



>ref|XP_010556349.1| PREDICTED: uncharacterized protein LOC104825675 [Tarenaya hassleriana]
Length=555

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 162/196 (83%), Gaps = 1/196 (1%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PLST+SRWIV+E+ +RVKL+C NW +HL+ VVAEGLSK+PV+ I+ KIV MGFNCVRL
Sbjct  29   AYPLSTSSRWIVDETSQRVKLSCANWPSHLQPVVAEGLSKKPVEEIADKIVGMGFNCVRL  88

Query  291  TWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            TWPL L TN +LA ++TVRQSF++LGL +   G Q +NPSI+DLPLI A++ VV +L   
Sbjct  89   TWPLDLATNFTLAHNVTVRQSFQSLGLYDDFVGFQTHNPSIIDLPLIDAFKTVVETLGNE  148

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             VM++LDNH++KPGWCCS  DGNGFFGD +FDP +W+ GLT +A++FNG SNVVGMSLRN
Sbjct  149  GVMVVLDNHVTKPGWCCSDDDGNGFFGDRFFDPTVWISGLTNMASIFNGVSNVVGMSLRN  208

Query  648  ELRGPKQNVNDWYRYM  695
            ELRG +QN NDW++YM
Sbjct  209  ELRGSRQNTNDWFKYM  224



>ref|XP_010514258.1| PREDICTED: uncharacterized protein LOC104790245 [Camelina sativa]
Length=562

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 164/205 (80%), Gaps = 7/205 (3%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNE----SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  269
            T  A PLST+SRWIV++     GRRVK+ CVNW +HLE  VAEGLSKQP+D I++KIV M
Sbjct  20   TTFALPLSTDSRWIVDDDGSNKGRRVKVTCVNWPSHLETAVAEGLSKQPLDSIAEKIVSM  79

Query  270  GFNCVRLTWPLFLFTNDSLASLT-VRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            GFNCVRLTWPL+L T++S + +T VRQS   L L ++++G Q +NP+I+DLPLI A+Q V
Sbjct  80   GFNCVRLTWPLYLATDESFSDITTVRQSLLKLRLFQAVSGFQVHNPTILDLPLIKAFQEV  139

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF--NGTS  620
            V  L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF  N +S
Sbjct  140  VSCLGKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANNVSS  199

Query  621  NVVGMSLRNELRGPKQNVNDWYRYM  695
            NVVGMSLRNELRGPKQN+ DWY YM
Sbjct  200  NVVGMSLRNELRGPKQNIKDWYTYM  224



>ref|XP_002284895.1| PREDICTED: uncharacterized protein LOC100253729 [Vitis vinifera]
Length=512

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 157/197 (80%), Gaps = 5/197 (3%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVA PL TNSRWIV+E G RVKLACVNW +H E  VAEGLS  PVD+ISK+I  +GFNCV
Sbjct  26   VVALPLYTNSRWIVDEDGARVKLACVNWPSHQEAAVAEGLSNHPVDLISKRIASLGFNCV  85

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLT PLFL T+ SLASLTV QSF+ LGLLES+AG QANNPS++DLPL +AYQAVV +LA 
Sbjct  86   RLTLPLFLATDQSLASLTVIQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNLAD  145

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              +M+ILD+H S+P     S+  NG FGD +F+P LWV GLT++ATMF+G  NVVGMSLR
Sbjct  146  NNMMVILDSHFSEP-----SFHDNGVFGDQHFNPDLWVKGLTRIATMFSGVPNVVGMSLR  200

Query  645  NELRGPKQNVNDWYRYM  695
            NELR P QNV DWYRYM
Sbjct  201  NELRCPNQNVKDWYRYM  217



>ref|XP_010240029.1| PREDICTED: uncharacterized protein LOC100839976 [Brachypodium 
distachyon]
Length=562

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            LST SRWIV+E+G RVKLACVNW +HLE ++AEGLSK+PV  I+  +  MGFNCVRLTWP
Sbjct  32   LSTASRWIVDEAGDRVKLACVNWPSHLEPMLAEGLSKRPVGSIAGDVAAMGFNCVRLTWP  91

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
             F+ TN S  SLTV QSF+ L L E +AG++ANNP++VDL LI A++AVV SL +  +M+
Sbjct  92   TFMVTNASYTSLTVAQSFQRLNLTEPLAGIRANNPALVDLRLIDAFKAVVSSLGENNLMV  151

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  659
            ILDNH+S P WCCS+ DGNGFFGD YF P +WV GLTK+AT F    NVVGMSLRNELRG
Sbjct  152  ILDNHVSMPKWCCSNTDGNGFFGDAYFQPDVWVDGLTKMATTFAAVPNVVGMSLRNELRG  211

Query  660  PKQNVNDWYRYM  695
            P+QN NDWY+YM
Sbjct  212  PRQNANDWYKYM  223



>ref|XP_010502521.1| PREDICTED: uncharacterized protein LOC104779823 [Camelina sativa]
Length=558

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 161/201 (80%), Gaps = 6/201 (3%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE---SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            A PLST+SRWIV++    GRRVKL CVNW +HLE  VAEGLSKQP+D I++ IV MGFNC
Sbjct  23   ALPLSTDSRWIVDDGINKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIAEMIVSMGFNC  82

Query  282  VRLTWPLFLFTNDSLASLT-VRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            VRLTWPL+L T++S + +T VRQS   L L ++++G Q +NP+I+DLPLI A+Q VV  L
Sbjct  83   VRLTWPLYLATDESFSDITTVRQSLLKLRLFQAVSGFQVHNPTILDLPLIKAFQEVVSCL  142

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF--NGTSNVVG  632
             K+KVM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF  N +SNVVG
Sbjct  143  GKHKVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANNVSSNVVG  202

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            MSLRNELRGPKQN  DWY YM
Sbjct  203  MSLRNELRGPKQNTKDWYTYM  223



>ref|XP_002284881.1| PREDICTED: uncharacterized protein LOC100264047 [Vitis vinifera]
Length=509

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 156/197 (79%), Gaps = 5/197 (3%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVA PL T SRWIV+E G RVKLACVNW +H E  VAEGLS  PVD+ISK+I  +GFNCV
Sbjct  23   VVALPLHTTSRWIVDEDGARVKLACVNWPSHREAPVAEGLSNHPVDLISKRIASLGFNCV  82

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RL  PLFL T+ SLASLTVRQSF+ LGLLES+AG QANNPS++DLPL +AYQAVV ++A 
Sbjct  83   RLALPLFLATDQSLASLTVRQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNIAD  142

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              +MIILD+H SKP     S+  N  FGD YF+P LWV GLT++AT+F+G  NVVGMSLR
Sbjct  143  NNMMIILDSHFSKP-----SFHSNDIFGDQYFNPDLWVKGLTRMATVFSGVPNVVGMSLR  197

Query  645  NELRGPKQNVNDWYRYM  695
            NELR PKQNV DWYRYM
Sbjct  198  NELRCPKQNVKDWYRYM  214



>ref|NP_001047320.1| Os02g0596200 [Oryza sativa Japonica Group]
 dbj|BAD16839.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAD21617.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF09234.1| Os02g0596200 [Oryza sativa Japonica Group]
Length=449

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            L    V A  LST+SRWIV++   GRRVKLACVNW +HLE VV EGL  QPVD ISKK+ 
Sbjct  17   LHAAAVEAVTLSTSSRWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVA  76

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             +GFNCVRLT+P+ L TN SL+SLTVR+S    GL  ++AG++ANNP ++DL LI +++A
Sbjct  77   SLGFNCVRLTYPIALATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRA  136

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL +  VM+ILDNH+S+PGWCC+  DGNGFFGD +FDP  WV GL  +A +F G  N
Sbjct  137  VVDSLGESGVMVILDNHVSRPGWCCADDDGNGFFGDRHFDPDAWVRGLGAMAALFAGVPN  196

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGP+QN +DWYRYM
Sbjct  197  VVGMSLRNELRGPRQNADDWYRYM  220



>gb|AIZ06017.1| hypothetical protein [Zea nicaraguensis]
Length=555

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PLST SRWIV   GRRVKLAC NW +HLE   AEGL+++PV  I+ ++  MGFNCVRL
Sbjct  26   ALPLSTASRWIVGVDGRRVKLACANWASHLEPAAAEGLARRPVSDIAARVAAMGFNCVRL  85

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWP +L TN +LASL +R S + LG+LES+AG++ NNP+++DLPLI  ++ VV SLA+  
Sbjct  86   TWPTYLVTNATLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLIDVFREVVSSLARKG  145

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  650
            +M+ILDN ++ PGWCCS  DGNGFFGD+YFDP  W+ GL+ +ATMFN T  VVGMSLRNE
Sbjct  146  IMVILDNQMTTPGWCCSRTDGNGFFGDVYFDPNEWLKGLSAMATMFNNTKYVVGMSLRNE  205

Query  651  LRGPKQNVNDWYRYM  695
            LRGPKQNV+ WYRYM
Sbjct  206  LRGPKQNVSLWYRYM  220



>gb|EEE61202.1| hypothetical protein OsJ_15212 [Oryza sativa Japonica Group]
Length=571

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +V MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMVT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N S +SLTV QSF+ L L ES+A ++ NNPS+VDL LI A++AVV SL +  VM+ILDNH
Sbjct  96   NASYSSLTVAQSFQRLNLTESLAAIRVNNPSLVDLKLIDAFKAVVSSLGENGVMVILDNH  155

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  674
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV MSLRNELRGP+QN 
Sbjct  156  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQNS  215

Query  675  NDWYRYM  695
             DWY+YM
Sbjct  216  ADWYKYM  222



>gb|EAZ23667.1| hypothetical protein OsJ_07369 [Oryza sativa Japonica Group]
Length=583

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 156/200 (78%), Gaps = 2/200 (1%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
             V A  LST+SRWIV++   GRRVKLACVNW +HLE VV EGL  QPVD ISKK+  +GF
Sbjct  21   AVEAVTLSTSSRWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVASLGF  80

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVRLT+P+ L TN SL+SLTVR+S    GL  ++AG++ANNP ++DL LI +++AVV S
Sbjct  81   NCVRLTYPIALATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRAVVDS  140

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L +  VM+ILDNH+S+PGWCC+  DGNGFFGD +FDP  WV GL  +A +F G  NVVGM
Sbjct  141  LGESGVMVILDNHVSRPGWCCADDDGNGFFGDRHFDPDAWVRGLGAMAALFAGVPNVVGM  200

Query  636  SLRNELRGPKQNVNDWYRYM  695
            SLRNELRGP+QN +DWYRYM
Sbjct  201  SLRNELRGPRQNADDWYRYM  220



>gb|EMT10461.1| Endoglucanase E1 [Aegilops tauschii]
Length=498

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 154/203 (76%), Gaps = 12/203 (6%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H AP   V   LST SRW+V+E+G RVKLACVNW +HLE ++AEGL K+PV  I+  +  
Sbjct  28   HHAPAAAVT--LSTASRWVVDEAGDRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAA  85

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWP FL TN S +SLTV QSF+ L L ES+AG++ANNP++          AV
Sbjct  86   MGFNCVRLTWPTFLVTNASYSSLTVEQSFQRLNLTESLAGIRANNPAV----------AV  135

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL +  VM+ILDNH+SKPGWCC + DGNGFFGD YF+P +WV GLTK+ATMF G  +V
Sbjct  136  VSSLGENNVMVILDNHVSKPGWCCDNTDGNGFFGDGYFEPDVWVDGLTKMATMFAGVPHV  195

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRGP+QN NDWY+YM
Sbjct  196  VGMSLRNELRGPRQNSNDWYKYM  218



>ref|XP_002446674.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
 gb|EES11002.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
Length=556

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 152/195 (78%), Gaps = 0/195 (0%)
 Frame = +3

Query  111  AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  290
            A PLST SRWIV   GRRVKLAC  W +HLE   AEGL+++ V  I+ ++  MGFNCVRL
Sbjct  27   ALPLSTASRWIVGADGRRVKLACATWASHLEPAAAEGLARRGVSDIAARVAAMGFNCVRL  86

Query  291  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            TWP +L TN +LASL +R S + LG+LES+AG++ NNP+++DLPL+  ++ VV SLA   
Sbjct  87   TWPTYLATNVTLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLVDVFREVVSSLASKG  146

Query  471  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  650
            +M+ILDN ++ PGWCCS  DGNGFFGD+YFDP  W+ GL+ +ATMFN T NVVGMSLRNE
Sbjct  147  IMVILDNQMTTPGWCCSRIDGNGFFGDVYFDPDEWLKGLSAMATMFNNTKNVVGMSLRNE  206

Query  651  LRGPKQNVNDWYRYM  695
            LRGPKQNV+ WYRYM
Sbjct  207  LRGPKQNVSLWYRYM  221



>gb|EEC77495.1| hypothetical protein OsI_16343 [Oryza sativa Indica Group]
Length=571

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +V MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMVT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N S +SLTV QSF+ L L ES+A ++ NNPS+VDL LI A++AVV +L +  VM+ILD+H
Sbjct  96   NASYSSLTVAQSFQRLNLTESLAAIRVNNPSLVDLKLIDAFKAVVSTLGENGVMVILDDH  155

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  674
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV MSLRNELRGP+QN 
Sbjct  156  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQNS  215

Query  675  NDWYRYM  695
             DWY+YM
Sbjct  216  ADWYKYM  222



>gb|EAY86525.1| hypothetical protein OsI_07905 [Oryza sativa Indica Group]
Length=582

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +3

Query  90   LAPPTVVAQPLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            L    V A  LST+SRWIV++   GRRVKLACVNW +HLE VV EGL  QPVD ISKK+ 
Sbjct  17   LHAAAVEAVTLSTSSRWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVA  76

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             +GFNCVRLT+P+ L TN SL+SLTVR+S    GL  ++AG++ANNP ++DL LI +++A
Sbjct  77   SLGFNCVRLTYPIALATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRA  136

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL +  VM+ILDNH+S+PGWCC+  DGNGFFGD +F P  WV GL  +A +F G  N
Sbjct  137  VVDSLGESGVMVILDNHVSRPGWCCADDDGNGFFGDRHFVPDAWVRGLGAMAALFAGVPN  196

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGP+QN +DWYRYM
Sbjct  197  VVGMSLRNELRGPRQNADDWYRYM  220



>ref|NP_001132121.1| hypothetical protein precursor [Zea mays]
 gb|ACF80825.1| unknown [Zea mays]
 gb|AFW58604.1| hypothetical protein ZEAMMB73_652830 [Zea mays]
Length=555

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +3

Query  126  TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            T SRWIV   GRRVKLAC NW +HLE   AEGL+++PV  I+ ++  MGFNCVRLTWP +
Sbjct  31   TASRWIVGVDGRRVKLACANWASHLEPAAAEGLARRPVSDIAARVAAMGFNCVRLTWPTY  90

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            L TN +LASL +R S + LG+LES+AG++ NNP+++DLPLI  ++ VV SLA+  +M+IL
Sbjct  91   LVTNATLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLIDVFREVVSSLARKGIMVIL  150

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  665
            DN ++ PGWCCS  DGNGFFGD+YFDP  W+ GL+ +ATMFN T  VVGMSLRNELRGPK
Sbjct  151  DNQMTTPGWCCSRTDGNGFFGDVYFDPNEWLKGLSAMATMFNNTKYVVGMSLRNELRGPK  210

Query  666  QNVNDWYRYM  695
            QNV+ WYRYM
Sbjct  211  QNVSLWYRYM  220



>gb|AFW62836.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=396

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 151/204 (74%), Gaps = 1/204 (0%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G++ NNPS +DL LI + +A
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGVEVNNPSFLDLTLIESLKA  138

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  139  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  198

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGP+QN  DWY YM
Sbjct  199  VVGMSLRNELRGPRQNPQDWYTYM  222



>ref|XP_010248705.1| PREDICTED: uncharacterized protein LOC104591538 isoform X1 [Nelumbo 
nucifera]
Length=540

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 159/197 (81%), Gaps = 5/197 (3%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PL TNSRWIV+  G RVKLACVNW  HLE +V +GLS++ +D+ISK+I+ +GFNCV
Sbjct  27   VMALPLYTNSRWIVDGDGHRVKLACVNWGAHLEAMVPDGLSRRSLDMISKEIISLGFNCV  86

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            +LTWP F+  ++SLAS+TVRQSFKNLGLLESI G+Q NNPS++DLPL++AYQAVV +LA+
Sbjct  87   QLTWPQFMVNDESLASVTVRQSFKNLGLLESIVGIQVNNPSLLDLPLVSAYQAVVDNLAE  146

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              +M+ILDN ISKPGW  S+++     GD YFD  LW+ GLT+ AT+FN T NVVGMSL 
Sbjct  147  KNLMVILDNRISKPGWHHSNFN-----GDKYFDTDLWIRGLTRTATIFNHTINVVGMSLS  201

Query  645  NELRGPKQNVNDWYRYM  695
            NE  G KQNVN+WYRYM
Sbjct  202  NEFEGNKQNVNNWYRYM  218



>ref|XP_010248706.1| PREDICTED: uncharacterized protein LOC104591538 isoform X2 [Nelumbo 
nucifera]
Length=538

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 159/197 (81%), Gaps = 5/197 (3%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            V+A PL TNSRWIV+  G RVKLACVNW  HLE +V +GLS++ +D+ISK+I+ +GFNCV
Sbjct  27   VMALPLYTNSRWIVDGDGHRVKLACVNWGAHLEAMVPDGLSRRSLDMISKEIISLGFNCV  86

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            +LTWP F+  ++SLAS+TVRQSFKNLGLLESI G+Q NNPS++DLPL++AYQAVV +LA+
Sbjct  87   QLTWPQFMVNDESLASVTVRQSFKNLGLLESIVGIQVNNPSLLDLPLVSAYQAVVDNLAE  146

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              +M+ILDN ISKPGW  S+++     GD YFD  LW+ GLT+ AT+FN T NVVGMSL 
Sbjct  147  KNLMVILDNRISKPGWHHSNFN-----GDKYFDTDLWIRGLTRTATIFNHTINVVGMSLS  201

Query  645  NELRGPKQNVNDWYRYM  695
            NE  G KQNVN+WYRYM
Sbjct  202  NEFEGNKQNVNNWYRYM  218



>ref|XP_006400290.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
 gb|ESQ41743.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
Length=528

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 150/194 (77%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRWIVNESG RVKLAC NW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNESGHRVKLACANWPSHLQPVVAEGLSSQPMDSISKKIREMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV++PLI A+QAVV SL +  V
Sbjct  88   PLELMINDTLAYNVTVKQSFERYGLDHELQGIHNHNPSIVNIPLINAFQAVVHSLGRNDV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH + PGWCCS+ D + FFGD  FDP LW++GL K+AT+F   +NVVGMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNGDPDAFFGDPKFDPDLWMLGLKKMATIFMNVNNVVGMSLRNEL  207

Query  654  RGPKQNVNDWYRYM  695
            RG      DWY YM
Sbjct  208  RGHNHTAKDWYTYM  221



>ref|XP_003579979.1| PREDICTED: uncharacterized protein LOC100845861 [Brachypodium 
distachyon]
Length=558

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            ++ A PLST SRW+V   GRRVKLAC +W +HLE V AEGLS++ V  I+ ++  MGFNC
Sbjct  27   SLPALPLSTASRWVVGADGRRVKLACASWASHLEPVAAEGLSRRDVGGIAARVAAMGFNC  86

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            VRLTWP +L TN +L+SL +R S + LGL ES+AG++ NNP ++DLPLI  ++ VV +LA
Sbjct  87   VRLTWPTYLATNTTLSSLPLRWSLERLGLRESVAGVRVNNPDLLDLPLIDVFREVVSALA  146

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
               +M+ILDN ++ PGWCCS  DGNGFFGD YFDP+ W+ GL+ +ATMF  T NVVGMSL
Sbjct  147  SSNIMVILDNQMTTPGWCCSRSDGNGFFGDKYFDPEEWLKGLSAMATMFRYTKNVVGMSL  206

Query  642  RNELRGPKQNVNDWYRYM  695
            RNELRGP QNV+ WYRYM
Sbjct  207  RNELRGPYQNVSLWYRYM  224



>ref|XP_008678767.1| PREDICTED: uncharacterized protein LOC100501654 isoform X1 [Zea 
mays]
Length=564

 Score =   261 bits (667),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 151/204 (74%), Gaps = 1/204 (0%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G++ NNPS +DL LI + +A
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGVEVNNPSFLDLTLIESLKA  138

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  139  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  198

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGP+QN  DWY YM
Sbjct  199  VVGMSLRNELRGPRQNPQDWYTYM  222



>dbj|BAK00694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=561

 Score =   258 bits (660),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 146/193 (76%), Gaps = 0/193 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRW+V   GRRVKL C NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLTW
Sbjct  33   PLSTASRWVVGADGRRVKLVCANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTW  92

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P +L TN +L+SL +R S + LGL ES AG++ NNP ++DLPLI  ++ VV +LA   +M
Sbjct  93   PTYLATNSTLSSLPLRWSLERLGLRESAAGVRVNNPDLLDLPLIDVFREVVSALASNSIM  152

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDN ++ PGWCCS  DGNGFFGD YFDP+ W+ GL+ +ATMF    NVVGMSLRNELR
Sbjct  153  VILDNQMTTPGWCCSRTDGNGFFGDKYFDPEEWLKGLSAMATMFRHAKNVVGMSLRNELR  212

Query  657  GPKQNVNDWYRYM  695
            GP QNV+ WYRYM
Sbjct  213  GPYQNVSLWYRYM  225



>ref|XP_002452393.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
 gb|EES05369.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
Length=570

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 150/203 (74%), Gaps = 2/203 (1%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  266
            H  P   V   LST+SRWIV+ +G RVKLACVNW +HL+ VV EGL +QPV  I+  IV 
Sbjct  23   HGEPAAAVT--LSTSSRWIVDPAGHRVKLACVNWPSHLDPVVTEGLGRQPVGAITGMIVS  80

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLT+P+ L TN SL++LTVRQS    GL E++ G++ NNPS +DL LI + +AV
Sbjct  81   MGFNCVRLTYPIALATNASLSALTVRQSLLAHGLSETVGGVEVNNPSFLDLTLIDSLKAV  140

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V +L +  VM+ILDNHIS PGWCCS+ DGNGFFGD  FDP +WV GL  +AT F    NV
Sbjct  141  VNALGEKNVMVILDNHISTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATTFADVPNV  200

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRGP+QN  DWY YM
Sbjct  201  VGMSLRNELRGPRQNSEDWYTYM  223



>ref|XP_002871770.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48029.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=527

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 150/194 (77%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T SRWIVN+ G RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  28   PLFTKSRWIVNKKGHRVKLACANWPSHLKPVVAEGLSSQPMDSISKKIKDMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV++PLI A+QAVV SL ++ V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNIPLINAFQAVVYSLGRHDV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NVVGMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNNDPDAFFGDPKFNPDLWMLGLKKMATIFMNVNNVVGMSLRNEL  207

Query  654  RGPKQNVNDWYRYM  695
            RG      DWY+YM
Sbjct  208  RGYNHTAKDWYKYM  221



>ref|XP_010492706.1| PREDICTED: uncharacterized protein LOC104770057 [Camelina sativa]
Length=528

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 149/194 (77%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T SRWIVN+ G RVKLAC NW +HLE VVAEGLS QP+D I+KKI DMGFNCVRLTW
Sbjct  28   PLYTKSRWIVNKKGHRVKLACTNWPSHLEPVVAEGLSSQPMDCITKKIKDMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSI+++PLI  +QAVV SL ++ V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIINIPLINVFQAVVHSLGRHDV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NVVGMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFLNVNNVVGMSLRNEL  207

Query  654  RGPKQNVNDWYRYM  695
            RG      DWY+YM
Sbjct  208  RGYNHTSKDWYKYM  221



>ref|XP_006289374.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
 gb|EOA22272.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
Length=527

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 150/194 (77%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRWIVN  G+RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  28   PLSTKSRWIVNNKGQRVKLACTNWPSHLKPVVAEGLSSQPIDYISKKIKDMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+ A+NPSIV++PLI  +QAVV SL ++ +
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYAHNPSIVNIPLINVFQAVVYSLGRHDL  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH + PGWCCS+ D + FF D  F+P LW++GL K+AT+F   +NVVGMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFNDPKFNPDLWMLGLKKMATIFLNVNNVVGMSLRNEL  207

Query  654  RGPKQNVNDWYRYM  695
            RG      DWY+YM
Sbjct  208  RGYNHTAKDWYKYM  221



>ref|XP_010420476.1| PREDICTED: uncharacterized protein LOC104706046 [Camelina sativa]
Length=527

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 149/194 (77%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T SRWIVN+ G RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  28   PLYTKSRWIVNKKGHRVKLACTNWPSHLKPVVAEGLSSQPMDFISKKIKDMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSI+++PLI  +QAVV SL ++ V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIINIPLINVFQAVVHSLGRHDV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NVVGMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFLNVNNVVGMSLRNEL  207

Query  654  RGPKQNVNDWYRYM  695
            RG      DWY+YM
Sbjct  208  RGYNHTAKDWYKYM  221



>ref|XP_010492589.1| PREDICTED: uncharacterized protein LOC104769956 isoform X2 [Camelina 
sativa]
Length=487

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F G +NVVGMSL
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKGATNVVGMSL  200

Query  642  RNELRGPKQNVNDWYRYM  695
            RNE RG +   + W+R+M
Sbjct  201  RNEPRGTRDYPDLWFRHM  218



>ref|XP_004955049.1| PREDICTED: uncharacterized protein LOC101776534 [Setaria italica]
Length=556

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 147/197 (75%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              A  LST+SRWIV+++G RVKLACVNW +HLE VV EGL +QPV  I+  +V +GFNCV
Sbjct  25   AAALTLSTSSRWIVDQAGHRVKLACVNWPSHLEPVVTEGLGRQPVGAIAGMVVSLGFNCV  84

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  464
            RLT+P+ L TN SL+SLTVRQS    GL E+  G++ NNP  +DL L+ + +AVV +L +
Sbjct  85   RLTYPIALATNASLSSLTVRQSLLAHGLAETAGGVEVNNPGFLDLTLMESLKAVVNTLGE  144

Query  465  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  644
              VM+ILDNH+SKPGWCC   DGNGFFGD  FDP +WV GL  +AT+F    +V+GMSLR
Sbjct  145  KDVMVILDNHVSKPGWCCGDDDGNGFFGDRDFDPDVWVDGLASMATIFADVPSVIGMSLR  204

Query  645  NELRGPKQNVNDWYRYM  695
            NELRGP+QN  DWY YM
Sbjct  205  NELRGPRQNTEDWYTYM  221



>ref|XP_010492588.1| PREDICTED: uncharacterized protein LOC104769956 isoform X1 [Camelina 
sativa]
Length=523

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F G +NVVGMSL
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKGATNVVGMSL  200

Query  642  RNELRGPKQNVNDWYRYM  695
            RNE RG +   + W+R+M
Sbjct  201  RNEPRGTRDYPDLWFRHM  218



>ref|XP_004975262.1| PREDICTED: uncharacterized protein LOC101779133 [Setaria italica]
Length=595

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 146/205 (71%), Gaps = 2/205 (1%)
 Frame = +3

Query  87   HLAPPTVVAQP--LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKI  260
            H A     A P  LST+SRW+V+E GRRVKLACVNW +HLE ++AEGL   P+  I+  +
Sbjct  39   HEAAGGAAALPKSLSTSSRWVVDERGRRVKLACVNWASHLEPMLAEGLGHLPLGAIAAGV  98

Query  261  VDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  440
              MGFNCVRLTWP FL T+ + +SLTV  S + L L  ++AG+ ANNP  + L L  A+ 
Sbjct  99   AAMGFNCVRLTWPTFLVTDAASSSLTVADSLRRLNLTAALAGVGANNPGFLGLSLADAFG  158

Query  441  AVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS  620
            AVV  L    VM+ILDNH+S+PGWCC + DGNGFFGD  FDP +WV GL ++A MF G  
Sbjct  159  AVVRGLGDSGVMVILDNHVSRPGWCCRAGDGNGFFGDADFDPDVWVEGLRRMAAMFAGEE  218

Query  621  NVVGMSLRNELRGPKQNVNDWYRYM  695
            NVVGMSLRNELRGP+QN  DWYRYM
Sbjct  219  NVVGMSLRNELRGPRQNTADWYRYM  243



>ref|XP_004975980.1| PREDICTED: uncharacterized protein LOC101758857 [Setaria italica]
Length=557

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 144/190 (76%), Gaps = 0/190 (0%)
 Frame = +3

Query  126  TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            T SRW+V   GRRVKLAC NW +HLE   AEGLS++ V+ I+ ++  MGFNCVRLTWP +
Sbjct  33   TASRWLVGADGRRVKLACANWASHLEPAAAEGLSRRGVEGIAGRVAAMGFNCVRLTWPTY  92

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            L TN +LASL  R S + LG+ ES+AG++ NNP+++DLPLI  ++ VV +L    +M+IL
Sbjct  93   LATNATLASLPFRWSLERLGMRESVAGVRVNNPALLDLPLIDVFREVVSALGSKSIMVIL  152

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  665
            DN ++ PGWCCS  DGNGFFGD YFDP  W+ GL  +AT+FN T NVVGMSLRNELRGP 
Sbjct  153  DNQMTTPGWCCSRTDGNGFFGDKYFDPDEWLKGLNAMATIFNDTKNVVGMSLRNELRGPN  212

Query  666  QNVNDWYRYM  695
            QN++ WYRYM
Sbjct  213  QNISLWYRYM  222



>ref|XP_009107523.1| PREDICTED: uncharacterized protein LOC103833179 [Brassica rapa]
Length=527

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 149/194 (77%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRWIVN+SG RVKLACVNW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNKSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV+ PLI  +QAVV SL +  V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLINVFQAVVYSLGRNDV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NV+GMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGMSLRNEL  207

Query  654  RGPKQNVNDWYRYM  695
            RG      DWY YM
Sbjct  208  RGYNHTAKDWYTYM  221



>ref|XP_010453833.1| PREDICTED: uncharacterized protein LOC104735704 [Camelina sativa]
Length=486

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  20   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  79

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  80   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVRGIQTHNPKILNLPLLNAFQEVVSNLG  139

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVGMSL
Sbjct  140  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGMSL  199

Query  642  RNELRGPKQNVNDWYRYM  695
            RNE RG +   + W+R+M
Sbjct  200  RNEPRGTRDYPDLWFRHM  217



>ref|XP_010437048.1| PREDICTED: uncharacterized protein LOC104720845 isoform X2 [Camelina 
sativa]
 ref|XP_010437061.1| PREDICTED: uncharacterized protein LOC104720858 isoform X2 [Camelina 
sativa]
Length=487

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   ITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVG+SL
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGVSL  200

Query  642  RNELRGPKQNVNDWYRYM  695
            RNE RG +   + W+R+M
Sbjct  201  RNEPRGARDYPDLWFRHM  218



>ref|XP_009126336.1| PREDICTED: uncharacterized protein LOC103851244 [Brassica rapa]
Length=246

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 147/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLALKITVKQSFESLKLFDDALGIQTHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE 
Sbjct  145  MVILDNHLTYPGWCCSYNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEP  204

Query  654  RGPKQNVNDWYRYM  695
            RG +   + W+R+M
Sbjct  205  RGTRDYPDLWFRFM  218



>ref|XP_010437042.1| PREDICTED: uncharacterized protein LOC104720845 isoform X1 [Camelina 
sativa]
 ref|XP_010437060.1| PREDICTED: uncharacterized protein LOC104720858 isoform X1 [Camelina 
sativa]
Length=523

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   ITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVG+SL
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGVSL  200

Query  642  RNELRGPKQNVNDWYRYM  695
            RNE RG +   + W+R+M
Sbjct  201  RNEPRGARDYPDLWFRHM  218



>ref|XP_010549752.1| PREDICTED: uncharacterized protein LOC104820833 [Tarenaya hassleriana]
Length=531

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 149/199 (75%), Gaps = 1/199 (1%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            +V +  LST SRWIV+E G RVKLAC NW +HL+ VVAEGL KQP+D IS++I  MGFNC
Sbjct  25   SVFSDGLSTRSRWIVDERGHRVKLACANWPSHLQPVVAEGLHKQPMDSISERIRFMGFNC  84

Query  282  VRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  458
            VR TWPL L TND+LA  +TV QSF+   L + + G++ +NPSI+ LPL  A++AVV S+
Sbjct  85   VRFTWPLELMTNDTLAFHVTVTQSFQRYRLFQELDGIRRHNPSILHLPLFNAFEAVVSSM  144

Query  459  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  638
             +Y VM+ILDNH + PGWCC ++D + FFGD  FDP LW++GL K+A  F    NV+GMS
Sbjct  145  GRYGVMVILDNHKTVPGWCCGNHDPDAFFGDPEFDPNLWILGLKKMAASFRNVKNVIGMS  204

Query  639  LRNELRGPKQNVNDWYRYM  695
            LRNELRGPK+  + WY+YM
Sbjct  205  LRNELRGPKEYPHVWYKYM  223



>ref|XP_008793758.1| PREDICTED: uncharacterized protein LOC103709981 [Phoenix dactylifera]
Length=549

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+ +GRRVKLACVNW  HLE   AEGL KQP+D IS+++V +GFNCVRLTWPL+L T
Sbjct  36   RWIVDGNGRRVKLACVNWAAHLEAAAAEGLGKQPLDTISRRVVALGFNCVRLTWPLYLLT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N SL SL +R S   LGLLES A +  NNP+++DLPL+ A+QAVV +LA   +M+ILDN 
Sbjct  96   NASLGSLPLRASLAGLGLLESAAAVAVNNPALLDLPLLQAFQAVVSNLASNNIMVILDNQ  155

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  674
            ISKPGWCCS +D NGFFGD YFDP  W+ GLT +ATMFN ++NVVGMSLRNELRGPKQN+
Sbjct  156  ISKPGWCCSKFDENGFFGDKYFDPDEWLRGLTMMATMFNSSANVVGMSLRNELRGPKQNI  215

Query  675  NDWYRYM  695
            + WYRYM
Sbjct  216  SLWYRYM  222



>ref|XP_006652422.1| PREDICTED: uncharacterized protein LOC102702088, partial [Oryza 
brachyantha]
Length=529

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 146/194 (75%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST SRW+V  + GRRVKLAC NW +HLE   AEGLS++ V  I+ ++  MGFNCVRLT
Sbjct  2    PLSTASRWVVGGADGRRVKLACANWASHLEPAAAEGLSRRGVGDIAARVAAMGFNCVRLT  61

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            WP +L TN +LA+L +R S + LG+ ES AG++ NNP ++DLPLI  ++ VV +L +  +
Sbjct  62   WPTYLATNATLANLPLRWSLELLGMRESAAGVRVNNPQLLDLPLIDVFKEVVSALGRNNI  121

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDN ++ PGWCCS  DGNGFFGD YFDP  W+ GL+ +ATMF  T NVVGMSLRNEL
Sbjct  122  MVILDNQMTTPGWCCSQRDGNGFFGDTYFDPDEWLSGLSTMATMFRNTKNVVGMSLRNEL  181

Query  654  RGPKQNVNDWYRYM  695
            RG KQNV  W+RYM
Sbjct  182  RGDKQNVTLWFRYM  195



>ref|NP_197252.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
 emb|CAC01894.1| putative protein [Arabidopsis thaliana]
 gb|AED92434.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 145/194 (75%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PL T SRWIVN  G RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  27   PLFTKSRWIVNNKGHRVKLACANWPSHLKPVVAEGLSSQPMDSISKKIKDMGFNCVRLTW  86

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NP IV+ PLI  +QAVV SL ++ V
Sbjct  87   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPYIVNTPLINVFQAVVYSLGRHDV  146

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F    NVVGMSLRNEL
Sbjct  147  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMNVKNVVGMSLRNEL  206

Query  654  RGPKQNVNDWYRYM  695
            RG      DWY+YM
Sbjct  207  RGYNHTSKDWYKYM  220



>gb|EAY94563.1| hypothetical protein OsI_16341 [Oryza sativa Indica Group]
Length=552

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 144/190 (76%), Gaps = 0/190 (0%)
 Frame = +3

Query  126  TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            T SRW+V   GRRVKLAC NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLT P +
Sbjct  31   TASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTCPTY  90

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            L TN +LASL +R S +  G+ ES+AG++ NNP ++DLPLI  +Q VV +LA+  +M+IL
Sbjct  91   LATNATLASLPLRWSLERFGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVIL  150

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  665
            DN ++ PGWCCS+ DGNGFFGD YFDP+ W+ GL  +ATMF  T NVVGMSLRNELRGP 
Sbjct  151  DNQMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGMSLRNELRGPY  210

Query  666  QNVNDWYRYM  695
             NV+ WYRYM
Sbjct  211  ANVSLWYRYM  220



>emb|CAH67676.1| H0510A06.1 [Oryza sativa Indica Group]
 emb|CAH66881.1| OSIGBa0158F13.12 [Oryza sativa Indica Group]
Length=553

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  126  TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            T SRW+V   GRRVKLAC NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLTWP +
Sbjct  34   TASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTY  93

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            L TN +LASL +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LA+  +M+IL
Sbjct  94   LATNATLASLPLRWSLERLGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVIL  153

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  665
            DN ++ PGWCCS+ DGNGFFGD YFDP+ W+ GL  +ATMF  T NVVGMSLRNELRGP 
Sbjct  154  DNQMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGMSLRNELRGPY  213

Query  666  QNVNDWY  686
            +NV+ WY
Sbjct  214  ENVSLWY  220



>gb|KHN43979.1| Endoglucanase E1 [Glycine soja]
Length=471

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +3

Query  207  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  386
            +VAEGL ++P+D I+K+I  MGFNCVRLTWP++L TNDSLA+LTVRQSF NLGL ++I+ 
Sbjct  1    MVAEGLGERPLDGIAKEIKSMGFNCVRLTWPIYLITNDSLATLTVRQSFNNLGLPQAISA  60

Query  387  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  566
            +Q NNPS++DLPLI AYQ VV  L    +M+ILDNH+SKP WCCS+ DGNGFFGD YFDP
Sbjct  61   VQVNNPSLIDLPLIKAYQDVVKGLGDKGLMVILDNHVSKPQWCCSNDDGNGFFGDQYFDP  120

Query  567  KLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYM  695
             LW+ GLTK+AT+F G +NVV MSLRNELRGP+QN NDW++YM
Sbjct  121  DLWIKGLTKMATLFKGVTNVVAMSLRNELRGPRQNANDWFKYM  163



>ref|NP_001053105.1| Os04g0480900 [Oryza sativa Japonica Group]
 emb|CAD41088.2| OSJNBb0011N17.5 [Oryza sativa Japonica Group]
 dbj|BAF15019.1| Os04g0480900 [Oryza sativa Japonica Group]
 dbj|BAG98948.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61201.1| hypothetical protein OsJ_15210 [Oryza sativa Japonica Group]
Length=554

 Score =   250 bits (639),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 147/193 (76%), Gaps = 1/193 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRW+V   GRRVKLAC NW +HLE V AEGLS++ +  I+ ++  MG NCVRLTW
Sbjct  29   PLSTASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTW  88

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P +L TN +LA+L +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LAK  +M
Sbjct  89   PTYLATNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIM  148

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDN ++ PGWCCS  DGNGFFGD YF P+ W+ GL+ +ATMF  T NVVGMSLRNELR
Sbjct  149  VILDNQMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGMSLRNELR  208

Query  657  GPKQNVNDWYRYM  695
            G K NV+ W+RYM
Sbjct  209  GSK-NVSLWFRYM  220



>gb|EEC77494.1| hypothetical protein OsI_16340 [Oryza sativa Indica Group]
Length=554

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 147/193 (76%), Gaps = 1/193 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRW+V   GRRVKLAC NW +HLE V AEGLS++ +  I+ ++  MG NCVRLTW
Sbjct  29   PLSTASRWLVGADGRRVKLACANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTW  88

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P +L TN +LA+L +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LAK  +M
Sbjct  89   PTYLATNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIM  148

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDN ++ PGWCCS  DGNGFFGD YF P+ W+ GL+ +ATMF  T NVVGMSLRNELR
Sbjct  149  VILDNQMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGMSLRNELR  208

Query  657  GPKQNVNDWYRYM  695
            G K NV+ W+RYM
Sbjct  209  GSK-NVSLWFRYM  220



>ref|XP_009121460.1| PREDICTED: uncharacterized protein LOC103846306 [Brassica rapa]
Length=524

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 152/201 (76%), Gaps = 1/201 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P  + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGL+KQP+D ISKKIV MGF
Sbjct  19   PKLITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLNKQPLDSISKKIVSMGF  78

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA ++TV+QSF+ L LL+ + G+Q +NP I++LP+  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLARNVTVKQSFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVS  138

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPVIWTKGLSKMASLFRNVTNVVG  198

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            MSLRNE RG +   N W++YM
Sbjct  199  MSLRNEPRGTRDYPNLWFKYM  219



>emb|CDX69429.1| BnaA10g17780D [Brassica napus]
Length=524

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 152/201 (76%), Gaps = 1/201 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P  + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGL+KQP+D ISKKIV MGF
Sbjct  19   PKLITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLNKQPLDSISKKIVSMGF  78

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA ++TV+QSF+ L LL+ + G+Q +NP I++LP+  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLARNVTVKQSFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVS  138

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPVIWTKGLSKMASLFRNVTNVVG  198

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            MSLRNE RG +   N W++YM
Sbjct  199  MSLRNEPRGTRDYPNLWFKYM  219



>emb|CAD41089.2| OSJNBb0011N17.6 [Oryza sativa Japonica Group]
 gb|EAZ31113.1| hypothetical protein OsJ_15211 [Oryza sativa Japonica Group]
Length=550

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  126  TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            T SRW+V   GRRVKLAC NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLTWP +
Sbjct  31   TASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTY  90

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            L TN +LASL +R S +  G+ ES+AG++ NNP ++DLPLI  +Q VV +LA+  +M+IL
Sbjct  91   LATNATLASLPLRWSLERFGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVIL  150

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  665
            DN ++ PGWCCS+ DGNGFFGD YFDP+ W+ GL  +ATMF  T NVVGMSLRNELRGP 
Sbjct  151  DNQMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGMSLRNELRGPY  210

Query  666  QNVNDWY  686
            +NV+ WY
Sbjct  211  ENVSLWY  217



>gb|EYU23408.1| hypothetical protein MIMGU_mgv1a020519mg [Erythranthe guttata]
Length=538

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 144/194 (74%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTNSRWIV++ +G+RVKL C NWV+HL+ +VAEGL K+P+  I+KKI + GFNCVR T
Sbjct  28   PLSTNSRWIVDQATGKRVKLTCANWVSHLQPMVAEGLEKKPLSYIAKKISETGFNCVRFT  87

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            WP F+FT     +LTV +S     L  + +G+  NNP  +++ +   ++AVV  L K KV
Sbjct  88   WPTFMFTRPDYYNLTVSESLDKFKLTAAKSGIAKNNPGFLNMKVAEVHKAVVNELGKNKV  147

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNHIS+PGWCC+  DGNGFFGD  FDP  W+ GLT VAT + G S V+GMS+RNEL
Sbjct  148  MVVLDNHISQPGWCCADNDGNGFFGDALFDPTEWLKGLTAVATAYKGNSAVIGMSMRNEL  207

Query  654  RGPKQNVNDWYRYM  695
            RG +QNVNDWY+YM
Sbjct  208  RGGRQNVNDWYKYM  221



>ref|XP_009121461.1| PREDICTED: uncharacterized protein LOC103846308 [Brassica rapa]
Length=489

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 150/201 (75%), Gaps = 1/201 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    + PLST SRWIV+E G+RVKLACVNW  HL+  VAEG+SKQP+D ISKKIV MGF
Sbjct  19   PKLTTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGVSKQPLDSISKKIVSMGF  78

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA ++TV+QSF+ L L + + G+Q +NP I++LP+  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLARNVTVKQSFERLNLFDDVLGIQTHNPKILNLPIFNAFQEVVS  138

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPAVWAKGLSKMASLFRNVTNVVG  198

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            MSLRNE RG +   N W++YM
Sbjct  199  MSLRNEPRGTRDYPNLWFKYM  219



>emb|CAH66880.1| OSIGBa0158F13.11 [Oryza sativa Indica Group]
Length=554

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 146/193 (76%), Gaps = 1/193 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRW+V   GRRVKL C NW +HLE V AEGLS++ +  I+ ++  MG NCVRLTW
Sbjct  29   PLSTASRWVVGADGRRVKLTCANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTW  88

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P +L TN +LA+L +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LAK  +M
Sbjct  89   PTYLATNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIM  148

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDN ++ PGWCCS  DGNGFFGD YF P+ W+ GL+ +ATMF  T NVVGMSLRNELR
Sbjct  149  VILDNQMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGMSLRNELR  208

Query  657  GPKQNVNDWYRYM  695
            G K NV+ W+RYM
Sbjct  209  GSK-NVSLWFRYM  220



>emb|CDX94333.1| BnaC01g18510D [Brassica napus]
Length=335

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 149/201 (74%), Gaps = 1/201 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    + PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGF
Sbjct  18   PILSTSFPLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGF  77

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV 
Sbjct  78   NCVRLTWPLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVS  137

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  +M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+G
Sbjct  138  NLGQNGLMVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIG  197

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            MSLRNE RG +   + W+R+M
Sbjct  198  MSLRNEPRGTRDYPDLWFRFM  218



>ref|XP_006400209.1| hypothetical protein EUTSA_v10015466mg [Eutrema salsugineum]
 gb|ESQ41662.1| hypothetical protein EUTSA_v10015466mg [Eutrema salsugineum]
Length=488

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 149/201 (74%), Gaps = 1/201 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGF
Sbjct  19   PKLTTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGF  78

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA ++TV+QSF+ L L E + G+Q +NP I++L +  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLAHNVTVKQSFEGLKLFEDVLGIQTHNPKILNLSIFRAFQEVVS  138

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  VM+ILDNH++ PGWCCS  D + FFG   FDP +W  GL+K+A +F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFGYPNFDPLVWAKGLSKMAFLFRNATNVVG  198

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            MSLRNE RG +   + W+R+M
Sbjct  199  MSLRNEPRGTRDYPDLWFRFM  219



>gb|KFK25904.1| hypothetical protein AALP_AA8G177600 [Arabis alpina]
Length=523

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 149/198 (75%), Gaps = 1/198 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWI++E G+RVKLACVNW  HL   VAEGLSKQP+D ISKKIV M FNCV
Sbjct  21   TTSYPLSTKSRWILDEKGQRVKLACVNWPAHLLPAVAEGLSKQPLDSISKKIVSMRFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA ++TV+QSF++L L E +AG+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALNVTVKQSFESLKLFEDVAGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  +M+ILDNH++ PGWCCS  D + FFG   FDP  W  GL K+AT+F   +NVVGMSL
Sbjct  141  QNGLMVILDNHLTTPGWCCSDNDLDAFFGYPNFDPAEWATGLKKMATLFRNATNVVGMSL  200

Query  642  RNELRGPKQNVNDWYRYM  695
            RNE RG +   + W+R+M
Sbjct  201  RNEPRGTRDYPDLWFRFM  218



>ref|XP_010420372.1| PREDICTED: uncharacterized protein LOC104705962 [Camelina sativa]
Length=484

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 149/198 (75%), Gaps = 1/198 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQ +D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQTLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TN++LA  +TV+QSF++  L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNNTLALKVTVKQSFESFKLFEDVRGIQTHNPKIINLPLLNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVG+SL
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGVSL  200

Query  642  RNELRGPKQNVNDWYRYM  695
            RNE RG +   + W+R+M
Sbjct  201  RNEPRGTRDYPDLWFRHM  218



>ref|NP_197172.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 emb|CAC01834.1| putative protein [Arabidopsis thaliana]
 gb|AED92327.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=488

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  285  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP ++ LPL  A+Q VV +L 
Sbjct  81   RLTWPLDLVTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKLLHLPLFNAFQEVVSNLG  140

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
            +  VM+ILDNH++ PGWCC   D + FFG  +FDP +W  GL K+AT+F   ++V+GMSL
Sbjct  141  ENGVMVILDNHLTTPGWCCGDNDLDAFFGYPHFDPLVWAKGLRKMATLFRNFTHVIGMSL  200

Query  642  RNELRGPKQNVNDWYRYM  695
            RNE RG +   + W+R+M
Sbjct  201  RNEPRGARDYPDLWFRHM  218



>emb|CDY16914.1| BnaC09g40410D [Brassica napus]
Length=524

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 147/194 (76%), Gaps = 4/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRWIVN+SG RVKLACVNW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNKSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV+ PLI    AVV SL +  V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLI---NAVVYSLGRNDV  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NV+GMSLRNEL
Sbjct  145  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGMSLRNEL  204

Query  654  RGPKQNVNDWYRYM  695
            RG      DWY YM
Sbjct  205  RGYNHTAKDWYTYM  218



>emb|CDY38435.1| BnaA10g17230D [Brassica napus]
Length=524

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 147/194 (76%), Gaps = 4/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRWIVN+SG RVKLACVNW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNKSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTW  87

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV+ PLI    AVV SL +  V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLI---NAVVYSLGRNDV  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NV+GMSLRNEL
Sbjct  145  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGMSLRNEL  204

Query  654  RGPKQNVNDWYRYM  695
            RG      DWY YM
Sbjct  205  RGYNHTAKDWYTYM  218



>ref|XP_002871731.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47990.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 146/193 (76%), Gaps = 1/193 (1%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            LST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTWP
Sbjct  26   LSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCVRLTWP  85

Query  300  LFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            L L TND+LA ++TV+QSF++L L E + G+Q +NP I+ LPL  A+Q VV +L +  VM
Sbjct  86   LDLMTNDTLALNVTVKQSFESLKLFEDVLGIQTHNPKILHLPLFNAFQEVVSNLGQNGVM  145

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDNH++ PGWCC   D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE R
Sbjct  146  VILDNHLTTPGWCCGENDLDAFFGYPKFDPTVWAKGLGKMATLFRNFTNVIGMSLRNEPR  205

Query  657  GPKQNVNDWYRYM  695
            G +   + W+R+M
Sbjct  206  GARDYPDLWFRHM  218



>ref|XP_009142284.1| PREDICTED: uncharacterized protein LOC103866155 [Brassica rapa]
Length=487

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 147/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE 
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEP  204

Query  654  RGPKQNVNDWYRYM  695
            RG +   + W+R+M
Sbjct  205  RGTRDYPDLWFRFM  218



>ref|XP_009142293.1| PREDICTED: uncharacterized protein LOC103866164 [Brassica rapa]
Length=487

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 147/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE 
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEP  204

Query  654  RGPKQNVNDWYRYM  695
            RG +   + W+R+M
Sbjct  205  RGTRDYPDLWFRFM  218



>ref|XP_009126137.1| PREDICTED: uncharacterized protein LOC103851062 [Brassica rapa]
Length=487

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 148/201 (74%), Gaps = 1/201 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    + PLSTN+RWIV+E G+R KLACVNW  HL+  VAEGLSKQP+D ISKKIV MGF
Sbjct  18   PIISTSFPLSTNTRWIVDEKGQRAKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGF  77

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA  +TV+QSF++L L +   G+Q +NP I +LP+  A+Q VV 
Sbjct  78   NCVRLTWPLDLTTNDTLALKITVKQSFESLNLFDDALGIQTHNPKIFNLPIFNAFQEVVS  137

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  +M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+G
Sbjct  138  NLGQNGLMVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIG  197

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            MSLRNE RG +   + W+R+M
Sbjct  198  MSLRNEPRGTRDYPDLWFRFM  218



>gb|EYU23411.1| hypothetical protein MIMGU_mgv1a004205mg [Erythranthe guttata]
Length=539

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 140/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTNSRWI++ E+G+RVKL C NWV+HL+ +VAEGL K+P+  I+KK+ + GFNCVR T
Sbjct  26   PLSTNSRWIIDQETGKRVKLTCANWVSHLQPMVAEGLEKKPLSYIAKKVPETGFNCVRFT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            WP F+FT     +LTV +S     L  + +G+  NNP  + + +   + AVV  L K KV
Sbjct  86   WPTFMFTRPDYYNLTVSESLDKYNLTAAKSGIAENNPGFLSMKVAEVHMAVVNELGKNKV  145

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNH+S+PGWCC   DGNGFFGD  FDP  W+ GLT VA  + G S VVGMS+RNEL
Sbjct  146  MVVLDNHVSQPGWCCGDNDGNGFFGDANFDPAEWLQGLTAVARAYKGNSAVVGMSMRNEL  205

Query  654  RGPKQNVNDWYRYM  695
            RGP+QN +DWY+YM
Sbjct  206  RGPRQNTDDWYKYM  219



>emb|CDY38091.1| BnaC02g06820D [Brassica napus]
Length=523

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 149/201 (74%), Gaps = 1/201 (0%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P    + PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISK IV MGF
Sbjct  18   PTPSTSFPLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKNIVSMGF  77

Query  276  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            NCVRLTWPL L TND+LA  +TV+QSF++L L + + G+Q +NP I++LP+  A+Q VV 
Sbjct  78   NCVRLTWPLDLMTNDTLALKITVKQSFESLNLFDDVLGIQTHNPKILNLPIFNAFQEVVS  137

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  +M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+G
Sbjct  138  NLGQNGLMVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIG  197

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            MSLRNE RG +   + W+R+M
Sbjct  198  MSLRNEPRGTRDYPDLWFRFM  218



>gb|KCW59700.1| hypothetical protein EUGRSUZ_H02458, partial [Eucalyptus grandis]
Length=516

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 150/198 (76%), Gaps = 8/198 (4%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  284
            VVAQ L  +SRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  27   VVAQQLYADSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  86

Query  285  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ-AVVGSLA  461
            RLTW L L  N++LASLTV QSF+NLGL ES+AG+++NNPS+++LPL+ AY+   +   A
Sbjct  87   RLTWALELPMNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKDKRIAQFA  146

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  641
             Y   I   N +   G      DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GMSL
Sbjct  147  SYGYEIF--NMMRDDG-----EDGNGFFGDKYFDPQVWMQGLHKMATMATGFSNVIGMSL  199

Query  642  RNELRGPKQNVNDWYRYM  695
            RNELRGP+QNV+DWY+YM
Sbjct  200  RNELRGPRQNVDDWYKYM  217



>gb|EMT27118.1| hypothetical protein F775_19072 [Aegilops tauschii]
Length=571

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 149/209 (71%), Gaps = 11/209 (5%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            ++ A PLST SRW+V+  GRRVKL C N  +HLE V AEGLS++ V  I+ ++  MGFNC
Sbjct  27   SLPALPLSTASRWLVDADGRRVKLVCANGASHLEPVAAEGLSRRGVGDIAARVAAMGFNC  86

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAY--------  437
            VRLTWP +L TN +L+SL +R S + LGL ES AG++ NNP ++DLPLI  +        
Sbjct  87   VRLTWPTYLATNATLSSLPLRWSLERLGLRESAAGVRVNNPDLLDLPLIDVFRVSSWVWG  146

Query  438  ---QAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF  608
               + VV +LA   +M+ILDN ++ PGWCCS  DGNGFFGD YFDP+ W+ GL+ +A +F
Sbjct  147  SPEEEVVSALASNSIMVILDNQMTTPGWCCSRTDGNGFFGDKYFDPEEWLRGLSAMAAVF  206

Query  609  NGTSNVVGMSLRNELRGPKQNVNDWYRYM  695
              T NVVGMSLRNELRGP QNV+ WYRYM
Sbjct  207  RDTKNVVGMSLRNELRGPYQNVSLWYRYM  235



>emb|CDX89335.1| BnaA01g15580D [Brassica napus]
Length=523

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 147/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  297  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE 
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEP  204

Query  654  RGPKQNVNDWYRYM  695
            RG +   + W+R+M
Sbjct  205  RGTRDYPDLWFRFM  218



>ref|XP_010904544.1| PREDICTED: uncharacterized protein LOC105031943 [Elaeis guineensis]
Length=554

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+ +GRRVKLACVNW  HLE   AEGL KQP+D IS  +V +GFNCVRLTWPL+L T
Sbjct  41   RWIVDGNGRRVKLACVNWAAHLEAAAAEGLGKQPLDTISGGVVALGFNCVRLTWPLYLLT  100

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N SL SL +R S   LGLLES A +  NNP+++DL L+ A+QAVV +LA   +M+ILDN 
Sbjct  101  NVSLGSLPLRASLAGLGLLESAAAVAVNNPALLDLSLLQAFQAVVSNLASNNIMVILDNQ  160

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  674
            ISK GWCCS +D NGFFGD YFDP  W+ GLT +ATMFN T+NVVGMSLRNELRGPKQN+
Sbjct  161  ISKAGWCCSKFDDNGFFGDKYFDPDEWLQGLTMMATMFNSTTNVVGMSLRNELRGPKQNI  220

Query  675  NDWYRYM  695
            + WYRYM
Sbjct  221  SLWYRYM  227



>gb|KHN06535.1| Endoglucanase [Glycine soja]
Length=474

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWP+ L TNDSLASLTVR SF+NL LLESIAG+Q NNPSI+DLPLI A+QAV
Sbjct  1    MGFNCVRLTWPIVLVTNDSLASLTVRSSFQNLALLESIAGVQTNNPSIIDLPLIQAFQAV  60

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL    VM+ILDNHI++PGWCCS+ DGNGFFGD +FDP  W++GLTK+A++FNG +NV
Sbjct  61   VKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKFFDPNQWILGLTKMASLFNGVTNV  120

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRGPKQNVNDWY+YM
Sbjct  121  VGMSLRNELRGPKQNVNDWYKYM  143



>gb|EPS62091.1| hypothetical protein M569_12701, partial [Genlisea aurea]
Length=514

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 134/193 (69%), Gaps = 0/193 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST+SRWIV+ +GRRVKL CVNW++H E +VAEGL K+P+  I+K I   GFNCVR TW
Sbjct  17   PLSTSSRWIVDRAGRRVKLTCVNWISHNEPMVAEGLEKKPLAYIAKAIASAGFNCVRFTW  76

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
            P F+FT      LTV QS    GL  + AG+  NNP ++ + ++  + AVV  L +  +M
Sbjct  77   PTFMFTRPDYGKLTVGQSLDRYGLTAAKAGISKNNPQLMGMSVVEVHGAVVDELGRSGLM  136

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            ++LDNH+S P WCC S DGNGFFGD  FDP  W+ GLT VA  +     VVGMSLRNELR
Sbjct  137  VVLDNHVSHPQWCCGSDDGNGFFGDYNFDPDEWIRGLTAVARAYKSRPGVVGMSLRNELR  196

Query  657  GPKQNVNDWYRYM  695
            GPKQN  DWYRYM
Sbjct  197  GPKQNEADWYRYM  209



>emb|CAH67677.1| H0510A06.2 [Oryza sativa Indica Group]
 emb|CAH66882.1| OSIGBa0158F13.13 [Oryza sativa Indica Group]
Length=555

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 136/187 (73%), Gaps = 16/187 (9%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +V MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMVT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N S +SLTV QSF+ L L ES+A                A +AVV SL +  VM+ILDNH
Sbjct  96   NASYSSLTVAQSFQRLNLTESLA----------------AIRAVVSSLGENGVMVILDNH  139

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  674
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV MSLRNELRGP+QN 
Sbjct  140  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQNS  199

Query  675  NDWYRYM  695
             DWY+YM
Sbjct  200  ADWYKYM  206



>gb|KHN19917.1| hypothetical protein glysoja_032397 [Glycine soja]
Length=464

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWPLFL TNDS+ASLT+R SF+NLGL++S+ G+QA NPSI+DLPLI AYQAV
Sbjct  1    MGFNCVRLTWPLFLVTNDSIASLTLRNSFQNLGLIQSLNGVQAINPSIIDLPLIKAYQAV  60

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL +  VM+ILDNH+S+PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+F G +NV
Sbjct  61   VKSLGENDVMVILDNHVSQPGWCCSNLDGNGFFGDQYFDPDLWIMGLTKMATIFKGVTNV  120

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            V MSLRNELRGP+QNVN WYRYM
Sbjct  121  VAMSLRNELRGPRQNVNVWYRYM  143



>ref|XP_011080895.1| PREDICTED: uncharacterized protein LOC105164045 [Sesamum indicum]
Length=535

 Score =   239 bits (611),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 143/196 (73%), Gaps = 1/196 (1%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            ++ LSTNSRWIV++ SG+RVKLACVNWV+HL+ ++ EGL K+PV  I+++IV  GFNCVR
Sbjct  23   SRTLSTNSRWIVDQASGKRVKLACVNWVSHLQPMIVEGLEKKPVSCIARQIVATGFNCVR  82

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
             TW  F+FT    + LTV +S    GL ++ AG+  NNP  +++ ++  ++AVV  L K 
Sbjct  83   FTWATFMFTRTDYSKLTVSESLDKYGLKDAKAGIMKNNPQFLNMNVVEVHKAVVNELGKN  142

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
            KVM++LDNH+S+P WCCS  DGNGFFGD  FDP  W+ GL  VA  + G S V+GMSLRN
Sbjct  143  KVMVVLDNHVSQPKWCCSGADGNGFFGDAEFDPTEWLQGLAAVAGTYKGNSVVIGMSLRN  202

Query  648  ELRGPKQNVNDWYRYM  695
            ELRG +QN  DWY+YM
Sbjct  203  ELRGDRQNEADWYKYM  218



>gb|AFW62835.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=380

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 140/204 (69%), Gaps = 17/204 (8%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G++A                
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGVEA----------------  122

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  123  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  182

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGP+QN  DWY YM
Sbjct  183  VVGMSLRNELRGPRQNPQDWYTYM  206



>emb|CAD41090.2| OSJNBb0011N17.7 [Oryza sativa Japonica Group]
Length=555

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 135/187 (72%), Gaps = 16/187 (9%)
 Frame = +3

Query  135  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  314
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +  MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVDAMGFNCVRLTWATFMVT  95

Query  315  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  494
            N S +SLTV QSF+ L L ES+A                A +AVV SL +  VM+ILDNH
Sbjct  96   NASYSSLTVAQSFQRLNLTESLA----------------AIRAVVSSLGENGVMVILDNH  139

Query  495  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  674
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV MSLRNELRGP+QN 
Sbjct  140  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQNS  199

Query  675  NDWYRYM  695
             DWY+YM
Sbjct  200  ADWYKYM  206



>ref|XP_010053198.1| PREDICTED: uncharacterized protein LOC104441706 [Eucalyptus grandis]
 gb|KCW77462.1| hypothetical protein EUGRSUZ_D01800 [Eucalyptus grandis]
Length=538

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 140/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV+  +GRR+KLACVNW +HLE ++AEGL K+P+ VI  +I  + FNCVRLT
Sbjct  29   PLSTNGRWIVDSATGRRMKLACVNWASHLEPMLAEGLDKKPLGVIVAEIRRLRFNCVRLT  88

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT        V ++  +LGL E+  G+  NNP ++++  + AY AVV  L K  V
Sbjct  89   WATYMFTQPGHGDQPVEETLDSLGLAEAKGGVARNNPLVLNMTHVEAYAAVVDELGKQGV  148

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNH+SKP WCC+  DGNGFFGD YFDP+ W+ GL  VA  FNG S VVGMS+RNEL
Sbjct  149  MVVLDNHVSKPKWCCAYDDGNGFFGDEYFDPEEWLRGLVAVAEHFNGKSQVVGMSVRNEL  208

Query  654  RGPKQNVNDWYRYM  695
            RGP+QN  DWY+Y+
Sbjct  209  RGPRQNDYDWYQYI  222



>ref|XP_008678768.1| PREDICTED: uncharacterized protein LOC100501654 isoform X2 [Zea 
mays]
 gb|AFW62834.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=548

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 140/204 (69%), Gaps = 17/204 (8%)
 Frame = +3

Query  84   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G++A                
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGVEA----------------  122

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  123  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  182

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGP+QN  DWY YM
Sbjct  183  VVGMSLRNELRGPRQNPQDWYTYM  206



>ref|XP_002272534.1| PREDICTED: uncharacterized protein LOC100257079 [Vitis vinifera]
Length=545

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 140/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RW+V++ SG+RVKLACVNW++HL+ +V EGL K+P+  I+  I  MGFNCVRLT
Sbjct  26   PLSTRGRWVVDDASGQRVKLACVNWISHLQAMVVEGLHKRPLREIAGGITAMGFNCVRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT  S  + +V +S   LGL E+  G+  NNP +++L L+ AY+AVV  L ++ V
Sbjct  86   WATYMFTRPSYGNRSVAESLGELGLSEAKEGVARNNPELLNLSLVEAYEAVVDELGRHGV  145

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNH+SKP WCC+  DGNGFFGD YF PK W+ GLTKVA  F   S VV MS+RNEL
Sbjct  146  MVVLDNHVSKPKWCCAEDDGNGFFGDKYFHPKEWLQGLTKVAHRFKDKSQVVAMSMRNEL  205

Query  654  RGPKQNVNDWYRYM  695
            RGP Q  + WY+ +
Sbjct  206  RGPNQTEHIWYKQI  219



>ref|XP_011080894.1| PREDICTED: uncharacterized protein LOC105164044 [Sesamum indicum]
Length=409

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 146/201 (73%), Gaps = 3/201 (1%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMG  272
            P    + PLST SRWI++E +G RVKL C+NW  HLE ++AEGL+KQP   I++ + +MG
Sbjct  14   PILCCSLPLSTRSRWIIDEATGARVKLICINWAAHLEPMLAEGLNKQPAGRIARLVAEMG  73

Query  273  FNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  452
            FNCVRLTW  ++FT    A+LTV QS   LGL++++ G+  NNP  +++ ++ A +AVV 
Sbjct  74   FNCVRLTWATYMFTR--FANLTVAQSLTRLGLVDAMEGIAVNNPGFLNVTVVDAQRAVVE  131

Query  453  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  632
            +L +  VM++LDNH+S+P WCC  +DGNGFFGD YFD K W+ GL+ VA ++  TS VVG
Sbjct  132  ALVRQGVMVVLDNHVSQPMWCCGEHDGNGFFGDKYFDAKEWLQGLSIVAKLYKDTSMVVG  191

Query  633  MSLRNELRGPKQNVNDWYRYM  695
            +S+RNELRGP QN + W+ YM
Sbjct  192  ISMRNELRGPLQNASVWHGYM  212



>ref|XP_006439449.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
 gb|ESR52689.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
Length=538

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWI+N S G+RVKLACVNW  HL+ ++AEGL K+P+  I   +V M FNCVRLT
Sbjct  22   PLSTNKRWIINASTGQRVKLACVNWPAHLQPMLAEGLDKKPLGEIVAAVVKMHFNCVRLT  81

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  F+FT  +   ++V Q+  +L L E+  G+  NNP I+++  I AY+AVVG L    +
Sbjct  82   WSTFMFTRPNYGHISVSQTLDSLDLKEAKQGISKNNPFILNMTHIQAYEAVVGELGAQGI  141

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNHISKP WCCS+ DGNGFFGD YFDP  W+ GL+ VA  F     VV +SLRNEL
Sbjct  142  MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNEL  201

Query  654  RGPKQNVNDWYRYM  695
            RGP+QN  DWY+Y+
Sbjct  202  RGPRQNEPDWYKYI  215



>emb|CBI34404.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   233 bits (593),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 140/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RW+V++ SG+RVKLACVNW++HL+ +V EGL K+P+  I+  I  MGFNCVRLT
Sbjct  42   PLSTRGRWVVDDASGQRVKLACVNWISHLQAMVVEGLHKRPLREIAGGITAMGFNCVRLT  101

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT  S  + +V +S   LGL E+  G+  NNP +++L L+ AY+AVV  L ++ V
Sbjct  102  WATYMFTRPSYGNRSVAESLGELGLSEAKEGVARNNPELLNLSLVEAYEAVVDELGRHGV  161

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNH+SKP WCC+  DGNGFFGD YF PK W+ GLTKVA  F   S VV MS+RNEL
Sbjct  162  MVVLDNHVSKPKWCCAEDDGNGFFGDKYFHPKEWLQGLTKVAHRFKDKSQVVAMSMRNEL  221

Query  654  RGPKQNVNDWYRYM  695
            RGP Q  + WY+ +
Sbjct  222  RGPNQTEHIWYKQI  235



>gb|ABR17494.1| unknown [Picea sitchensis]
Length=543

 Score =   232 bits (591),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 140/193 (73%), Gaps = 1/193 (1%)
 Frame = +3

Query  120  LSTNSRWIVNESG-RRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            L+  SRWIV+E+G  RVKLACVNWV+HL+ +V EGLS+QP+  I+  IV  GFNCVRLTW
Sbjct  26   LAVKSRWIVDETGGTRVKLACVNWVSHLQPMVTEGLSRQPLKYITSTIVSQGFNCVRLTW  85

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
              F+ TN +  +LTV+ S  +L L ++ A +  +NP  +DL L+ +Y+ VV  L +  +M
Sbjct  86   ATFMVTNPANRNLTVQDSLNSLNLSDAAAAMAVSNPEFLDLTLMDSYKRVVAGLGEAGLM  145

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDNHIS+P WCC   DGNGFFGD  FDP +W+ GL+ +AT F GT+ VVGMSLRNELR
Sbjct  146  VILDNHISRPQWCCGYNDGNGFFGDADFDPGVWIQGLSAMATAFKGTAAVVGMSLRNELR  205

Query  657  GPKQNVNDWYRYM  695
            G + N  DWY+YM
Sbjct  206  GSRANAADWYKYM  218



>ref|XP_010658499.1| PREDICTED: uncharacterized protein LOC100267356 isoform X2 [Vitis 
vinifera]
Length=502

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIV-NESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV N +G RVK+ACVNWV+HLE +V EG+  QPV+ I++ +  MGFNC+RLT
Sbjct  64   PLSTRGRWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLT  123

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +  F++T     + TV QS  +  L ++  G+  NNP +++L +I AY+AVV  L  + +
Sbjct  124  YATFMWTRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGL  183

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNH+SKP WCC+  DGNGFFGD+YFDPK W+ GLT V+T F     VV +S+RNE+
Sbjct  184  MLVLDNHVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVALSMRNEM  243

Query  654  RGPKQNVNDWYRYM  695
            RG + NV DWYRYM
Sbjct  244  RGARSNVPDWYRYM  257



>ref|XP_002272422.2| PREDICTED: uncharacterized protein LOC100245045 [Vitis vinifera]
Length=530

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV+ E+G RVKL C+NWV H E +V EGL  QP+  I+ K+  MGFNC+RLT
Sbjct  23   PLSTRGRWIVDSETGHRVKLTCLNWVAHTETMVTEGLHTQPIKDIAAKVTSMGFNCIRLT  82

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +  F++T    ++ TV QS  +  L ++  G+  NNP +++L L  AY+AVV  L    +
Sbjct  83   YATFMWTRSDYSNKTVAQSLDSFNLTQAREGIARNNPQLLNLSLQEAYEAVVDELGANGL  142

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNH+SKP WCC+  DGNGFFGD++FDPK W+ GLT+VA  F G   VV MS+RNE+
Sbjct  143  MLVLDNHVSKPMWCCAREDGNGFFGDMFFDPKEWIEGLTQVAKRFKGKPQVVAMSMRNEI  202

Query  654  RGPKQNVNDWYRYM  695
            RGP+QN+ DWY+ M
Sbjct  203  RGPRQNLPDWYKNM  216



>ref|XP_002272491.1| PREDICTED: uncharacterized protein LOC100262188 [Vitis vinifera]
Length=541

 Score =   229 bits (585),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV++ +GRRVKL CVNW++H E ++ EGL  QP+  I+ KI +MGFNCVRLT
Sbjct  30   PLSTKGRWIVDDVTGRRVKLKCVNWISHTESMITEGLHSQPIGDIADKISEMGFNCVRLT  89

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +P FL+T     + TV +S  +L   E+ A +   NP  + LPL  +Y+ VVG L +  +
Sbjct  90   YPTFLWTRVDYYNKTVAESLDSLNATEAKAMIAVQNPRFLSLPLRESYERVVGELGRRGL  149

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH+SKP WCC   DGNGFFGD +FDP+ W+ GL++VA  F   S+V+GMS+RNEL
Sbjct  150  MLILDNHVSKPMWCCEREDGNGFFGDKFFDPEEWIEGLSQVANRFKDESHVIGMSMRNEL  209

Query  654  RGPKQNVNDWYRYM  695
            RG + N  DWY+YM
Sbjct  210  RGQRSNQKDWYKYM  223



>ref|XP_002272454.2| PREDICTED: uncharacterized protein LOC100267356 isoform X1 [Vitis 
vinifera]
Length=575

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIV-NESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV N +G RVK+ACVNWV+HLE +V EG+  QPV+ I++ +  MGFNC+RLT
Sbjct  64   PLSTRGRWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLT  123

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +  F++T     + TV QS  +  L ++  G+  NNP +++L +I AY+AVV  L  + +
Sbjct  124  YATFMWTRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGL  183

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNH+SKP WCC+  DGNGFFGD+YFDPK W+ GLT V+T F     VV +S+RNE+
Sbjct  184  MLVLDNHVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVALSMRNEM  243

Query  654  RGPKQNVNDWYRYM  695
            RG + NV DWYRYM
Sbjct  244  RGARSNVPDWYRYM  257



>ref|XP_002272386.2| PREDICTED: uncharacterized protein LOC100250178 [Vitis vinifera]
Length=536

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV+ E+G RVKL C+NW  H++ +V EGL  QP+  I  K+  MGFNC+RLT
Sbjct  29   PLSTRGRWIVDSETGSRVKLTCLNWAAHIDTMVTEGLHTQPIKDIVAKVTLMGFNCIRLT  88

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +  F++T     + TV QS  ++ L ++  G+  NNP +++L L  AY+AVV ++    +
Sbjct  89   YATFMWTRPDYGNKTVAQSLDSMNLTQAREGIARNNPQLLNLSLQDAYEAVVDAIGANGL  148

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNH+SKP WCC+S DGNGFFGD++FDPK W+ GLT+VA+ F G   VV MS+RNEL
Sbjct  149  MLVLDNHVSKPMWCCASEDGNGFFGDMFFDPKEWIEGLTQVASRFKGKPQVVAMSMRNEL  208

Query  654  RGPKQNVNDWYRYM  695
            RGP+QN+ DWY  M
Sbjct  209  RGPRQNLPDWYTNM  222



>ref|XP_008467257.1| PREDICTED: uncharacterized protein LOC103504654 [Cucumis melo]
Length=539

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 141/194 (73%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWI++ + GRRVKL CVNW  H++ ++ EGL ++P+D I+  +  + FNCVRLT
Sbjct  28   PLSTNGRWIIDATTGRRVKLMCVNWAGHMQGMLVEGLHRRPLDDIAALVAKLRFNCVRLT  87

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LTV+QSF+N  + +++AG+  NNPSI++L L+ AY AVV SL  + +
Sbjct  88   YSIHMFTRH--ANLTVKQSFENFDMKDAMAGIAQNNPSILNLTLVEAYGAVVDSLVAHGI  145

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++ DNHIS+P WCC + DGNGFFGD YFDP+ W+ G++  A      + VV MSLRNEL
Sbjct  146  MVVSDNHISQPRWCCDNNDGNGFFGDRYFDPQEWLQGISLAAQSLKSKAQVVAMSLRNEL  205

Query  654  RGPKQNVNDWYRYM  695
            RGP QNV  W++YM
Sbjct  206  RGPNQNVEKWFQYM  219



>emb|CBI34405.3| unnamed protein product [Vitis vinifera]
Length=970

 Score =   230 bits (586),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIV-NESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV N +G RVK+ACVNWV+HLE +V EG+  QPV+ I++ +  MGFNC+RLT
Sbjct  26   PLSTRGRWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +  F++T     + TV QS  +  L ++  G+  NNP +++L +I AY+AVV  L  + +
Sbjct  86   YATFMWTRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGL  145

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++LDNH+SKP WCC+  DGNGFFGD+YFDPK W+ GLT V+T F     VV +S+RNE+
Sbjct  146  MLVLDNHVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVALSMRNEM  205

Query  654  RGPKQNVNDWYRYM  695
            RG + NV DWYRYM
Sbjct  206  RGARSNVPDWYRYM  219


 Score =   229 bits (585),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST  RWIV++ +GRRVKL CVNW++H E ++ EGL  QP+  I+ KI +MGFNCVRLT
Sbjct  459  PLSTKGRWIVDDVTGRRVKLKCVNWISHTESMITEGLHSQPIGDIADKISEMGFNCVRLT  518

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +P FL+T     + TV +S  +L   E+ A +   NP  + LPL  +Y+ VVG L +  +
Sbjct  519  YPTFLWTRVDYYNKTVAESLDSLNATEAKAMIAVQNPRFLSLPLRESYERVVGELGRRGL  578

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH+SKP WCC   DGNGFFGD +FDP+ W+ GL++VA  F   S+V+GMS+RNEL
Sbjct  579  MLILDNHVSKPMWCCEREDGNGFFGDKFFDPEEWIEGLSQVANRFKDESHVIGMSMRNEL  638

Query  654  RGPKQNVNDWYRYM  695
            RG + N  DWY+YM
Sbjct  639  RGQRSNQKDWYKYM  652



>ref|XP_009381699.1| PREDICTED: uncharacterized protein LOC103969775 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 128/163 (79%), Gaps = 0/163 (0%)
 Frame = +3

Query  207  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  386
            ++AEGLSKQP+  I+  I  MGFNCVRLT+P FL T++SLASLTVRQSF+  GL  +I  
Sbjct  1    MLAEGLSKQPLASITWNIHLMGFNCVRLTYPTFLLTDESLASLTVRQSFERAGLDATIPL  60

Query  387  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  566
            +  +NP+ VDL L+ AY+AVV  L    +M+ILDNHISKPGWCCS+ DGNGFFGD YFDP
Sbjct  61   IALHNPTFVDLNLLQAYKAVVAKLGATNIMVILDNHISKPGWCCSNSDGNGFFGDTYFDP  120

Query  567  KLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYM  695
             +W  GL K+ATMF GT NVVGMSLRNELRG +QNV+DW+ YM
Sbjct  121  NVWYQGLIKMATMFKGTPNVVGMSLRNELRGRRQNVDDWFTYM  163



>gb|EMS46776.1| hypothetical protein TRIUR3_23304 [Triticum urartu]
Length=290

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVRLTWP FL TN S +SLTV QSF+ L L ES+AG++ANNP++VDL LI A++A 
Sbjct  1    MGFNCVRLTWPTFLVTNASYSSLTVEQSFQRLNLTESLAGIRANNPTVVDLKLIDAFKA-  59

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
              SL +  VM+ILDNH+SKPGWCC + DGNGFFGD YF+P +WV GLTK+ATMF G  +V
Sbjct  60   -SSLGENNVMVILDNHVSKPGWCCDNADGNGFFGDGYFEPDVWVDGLTKMATMFAGVPHV  118

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRGP+QN NDWY+YM
Sbjct  119  VGMSLRNELRGPRQNSNDWYKYM  141



>gb|ACF85134.1| unknown [Zea mays]
Length=492

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  446
            MGFNCVR TWP FL T+ S + LTV QSF+ L L ES+AG++ NNP +VDL LI A++AV
Sbjct  1    MGFNCVRFTWPTFLVTDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAV  60

Query  447  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  626
            V SL ++ +M+ILDNH+SKPGWCCS+ DG+GFFGD YFDP +WV GLTK+ATMF G  NV
Sbjct  61   VSSLGEHNLMVILDNHLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNV  120

Query  627  VGMSLRNELRGPKQNVNDWYRYM  695
            VGMSLRNELRGP+QNVNDWY+YM
Sbjct  121  VGMSLRNELRGPRQNVNDWYKYM  143



>ref|XP_002893942.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70201.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=420

 Score =   218 bits (556),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 143/215 (67%), Gaps = 30/215 (14%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKL-ACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+SRWIV+E+G+R KL +C    T          +KQPVD ++KKIV+M FNCVRLT
Sbjct  4    PLSTSSRWIVDENGQRAKLMSCGGERTKQ--------AKQPVDAVAKKIVEMSFNCVRLT  55

Query  294  WPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  470
            WP  L TN++LA ++TVRQSF++ GL + I G + NNPSI+DL LI A+  V      ++
Sbjct  56   WPSDLMTNETLAYNVTVRQSFQSFGLNDDIVGFKTNNPSIIDLSLIEAFICVTEVNVTFR  115

Query  471  --------------------VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLT  590
                                VM+ILDNH++KPGWCC+  DGN F GD +FDP +W   L+
Sbjct  116  THNTRDLCLAFFLFCSKSNDVMVILDNHLTKPGWCCADNDGNDFSGDKFFDPTVWAAALS  175

Query  591  KVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYM  695
            K+   F+G SNVVGMSLRNEL GPKQNVNDW++YM
Sbjct  176  KMTATFDGVSNVVGMSLRNELTGPKQNVNDWFKYM  210



>gb|KGN50395.1| hypothetical protein Csa_5G171770 [Cucumis sativus]
Length=538

 Score =   221 bits (563),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 142/194 (73%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV+ + G+RVKL CVNW  H++ ++AEGL ++P+D I   +  + FNCVRLT
Sbjct  27   PLSTNGRWIVDATTGQRVKLMCVNWPGHMQGMLAEGLHRRPLDDIISLVAKLRFNCVRLT  86

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LTV+QSF+N  + +++AG+  NNPS+V+L L+ AY AVV SLA + V
Sbjct  87   YSIHMFTRH--ANLTVQQSFENFDMKDAMAGIAQNNPSLVNLTLVEAYGAVVDSLAAHGV  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++ DNHIS+P WCC++ DGNGFFGD YFDP+ W+ G++  A      + VV MS+RNE 
Sbjct  145  MVVSDNHISQPRWCCNNDDGNGFFGDRYFDPEEWLQGISLAAQSLKSKAEVVAMSMRNEP  204

Query  654  RGPKQNVNDWYRYM  695
            RGP QNV  W++YM
Sbjct  205  RGPNQNVEKWFQYM  218



>gb|KGN50394.1| hypothetical protein Csa_5G171760 [Cucumis sativus]
Length=538

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 142/194 (73%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV+ + G RVKL CVNW  H++ ++AEGL  +P+D I+  +V   FNCVRLT
Sbjct  27   PLSTNGRWIVDATTGNRVKLMCVNWAGHMQGMLAEGLHLRPLDDIAALVVKSRFNCVRLT  86

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LTV+QSF+N  + +++AG+  NNPSI+++ ++ AY AV+ SLA ++V
Sbjct  87   YSIHMFTRH--ANLTVQQSFENFDMKDALAGIAQNNPSILNMTVVQAYGAVIDSLAAHRV  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++ DNHIS+P WCC++ DGNGFFGD YFDP+ W+ G++  A      S VV MSLRNE 
Sbjct  145  MVVSDNHISQPRWCCNNDDGNGFFGDRYFDPQEWLQGISLAAQNLKSKSQVVAMSLRNEP  204

Query  654  RGPKQNVNDWYRYM  695
            RGP QNV  W++YM
Sbjct  205  RGPNQNVEMWFQYM  218



>gb|KHG22500.1| Endoglucanase E1 [Gossypium arboreum]
Length=524

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = +3

Query  87   HLAPPTVVAQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  263
            H+ P T +  PLSTNSRWIV+ ++ RRVKLACVNW +HLE V AEGLSK+ +D I+++IV
Sbjct  16   HVNPTTSL--PLSTNSRWIVDDQTHRRVKLACVNWPSHLEPVFAEGLSKRSMDSIAEQIV  73

Query  264  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
             MGFNCVRLTWPL+L TNDSL+SLTVR+SF+NLGL+E IAG+QANNPS++D+ LI A+QA
Sbjct  74   SMGFNCVRLTWPLYLATNDSLSSLTVRRSFQNLGLMEPIAGIQANNPSVIDVSLIQAFQA  133

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVI  581
            VV SL K  VM+ILDNH+SKPGWCC  YDG+G       +P L +I
Sbjct  134  VVSSLGKNNVMVILDNHLSKPGWCCGYYDGDGAEAVHAANPNLLII  179



>ref|XP_008459280.1| PREDICTED: uncharacterized protein LOC103498458 [Cucumis melo]
Length=719

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 141/200 (71%), Gaps = 3/200 (2%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P   + PLSTN RWI++ + GRRVKL CVNW  H++ ++ EGL ++P+D I+  +  + F
Sbjct  193  PEAYSLPLSTNGRWIIDATTGRRVKLMCVNWAGHMQGMLVEGLHRRPLDDIAALVAKLRF  252

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVRLT+ + +FT    A++TV+QSF+N  + +++ G+  NNPSI++L L+ AY AVV S
Sbjct  253  NCVRLTYSIHMFTRH--ANVTVKQSFENFDMKDALVGIAQNNPSILNLTLVEAYGAVVDS  310

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            LA + +M++ DNHIS+P WCC + DGNGFFGD YFDP+ W  G++  A      + VV M
Sbjct  311  LAAHGIMVVSDNHISQPRWCCDNDDGNGFFGDRYFDPQEWFQGISLAAQSLKSKAQVVAM  370

Query  636  SLRNELRGPKQNVNDWYRYM  695
            SLRNE RGP QNV  W++YM
Sbjct  371  SLRNEPRGPNQNVEKWFQYM  390



>emb|CDX83591.1| BnaC07g23310D [Brassica napus]
Length=460

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
            MGFNCVRLTWPL L TN +LA+ +TVR SF++LGL   I+G + NNPS++DLPLI AYQ+
Sbjct  1    MGFNCVRLTWPLDLATNVTLATNVTVRDSFQSLGLNTDISGFETNNPSMIDLPLIEAYQS  60

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L KY VM+ILDNH++KPGWCC + DGNGFFGDI+FDP  W+ GLT +AT F  TSN
Sbjct  61   VVTTLGKYNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSN  120

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGPKQNV+DW++YM
Sbjct  121  VVGMSLRNELRGPKQNVDDWFKYM  144



>gb|EYU23409.1| hypothetical protein MIMGU_mgv1a004243mg [Erythranthe guttata]
Length=538

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 129/193 (67%), Gaps = 1/193 (1%)
 Frame = +3

Query  120  LSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            LST+SRWIVN+ +G RVKL C NW  HL+ +V EGL K+PV  I+ +I  +GFNCVRLTW
Sbjct  30   LSTSSRWIVNQGTGNRVKLTCANWAGHLQAMVPEGLEKKPVSYIASQIAKLGFNCVRLTW  89

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
              F+FT    ++L V  +     L  + +G+  NNP  +++ +I   +AVVG L K  +M
Sbjct  90   ATFMFTRPEYSNLKVSAALDKYNLAAAKSGIGKNNPQFLEMSVIDVQKAVVGELGKNNLM  149

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            ++LDNH+S PGWCC   DGNGFFGD  FD   W+ GLT VA  + G   VV MSLRNELR
Sbjct  150  VVLDNHVSLPGWCCGDDDGNGFFGDANFDTNEWLQGLTAVARSYKGNPAVVAMSLRNELR  209

Query  657  GPKQNVNDWYRYM  695
            G +QN NDWY+ M
Sbjct  210  GNRQNTNDWYKNM  222



>ref|XP_004168760.1| PREDICTED: uncharacterized protein LOC101223816 [Cucumis sativus]
Length=535

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 138/194 (71%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV  + G+RVKL CVNW  H++ +VAEGL  +P+D I+  +V + FNCVRLT
Sbjct  26   PLSTNGRWIVEATTGQRVKLICVNWPGHMQAMVAEGLHLKPLDDIAAMVVKLRFNCVRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LTV+QSF+N  L E+I G+  NNP+I+++ ++ AY+AVV SL  + V
Sbjct  86   YSIHMFTR--YANLTVKQSFENFDLKEAIVGIAQNNPTILNMKVVEAYEAVVDSLGAHGV  143

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M++ DNHIS+P WCCS+ DGNGFFGD YF+ + W+ GL+           VV MSLRNE 
Sbjct  144  MVVSDNHISQPRWCCSNDDGNGFFGDRYFNSQEWLQGLSLATQSLKTKPQVVAMSLRNEP  203

Query  654  RGPKQNVNDWYRYM  695
            RGP QNV  W++YM
Sbjct  204  RGPNQNVEMWFQYM  217



>emb|CDY13614.1| BnaA06g33090D [Brassica napus]
Length=460

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
            MGFNCVRLTWPL L TN +LA S+TVR SF++LGL   I+G +  NPS++DLPLI AYQ+
Sbjct  1    MGFNCVRLTWPLDLATNVTLATSVTVRDSFQSLGLNTDISGFETKNPSMIDLPLIEAYQS  60

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV +L  Y VM+ILDNH++KPGWCC + DGNGFFGDI+FDP  W+ GLT +AT F  TSN
Sbjct  61   VVTTLGNYNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSN  120

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            VVGMSLRNELRGPKQNV+DW++YM
Sbjct  121  VVGMSLRNELRGPKQNVDDWFKYM  144



>ref|XP_008810943.1| PREDICTED: uncharacterized protein LOC103722247 [Phoenix dactylifera]
Length=554

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 138/197 (70%), Gaps = 2/197 (1%)
 Frame = +3

Query  105  VVAQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
            V A PLST+ RW+V+  SG+RVKL CVNW  H+  V+AEGL +QP+D I+  I  +GFNC
Sbjct  27   VHALPLSTSGRWVVDSASGQRVKLHCVNWAAHMPAVLAEGLDRQPLDGIAAGIAGLGFNC  86

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  461
            VRLTW   LFT +S  +LTV +S  +LGL ++  G++ NN  +V + +  A+ AVV ++ 
Sbjct  87   VRLTWATHLFTKESYENLTVSESLSSLGLGDAFDGVRRNNGWMVGITVREAFDAVVKAIG  146

Query  462  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS-NVVGMS  638
            +  +M++LDNH+S+P WCC   DGNGFFGD YFDP+ W+ GL  VAT +   +  VVGMS
Sbjct  147  EAGLMVVLDNHVSRPQWCCGDDDGNGFFGDTYFDPEEWLRGLEFVATRYRSDNPQVVGMS  206

Query  639  LRNELRGPKQNVNDWYR  689
            +RNELRGP Q+   WYR
Sbjct  207  MRNELRGPNQSEPAWYR  223



>ref|XP_009605826.1| PREDICTED: uncharacterized protein LOC104100317 [Nicotiana tomentosiformis]
Length=526

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 137/194 (71%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+SRWIV+E +G+RVKL C NW  HL+ ++ EGL +QPV  I++ I  MGFNCVRLT
Sbjct  22   PLSTSSRWIVDEETGQRVKLVCGNWAAHLQTMLPEGLDQQPVSQIARHISLMGFNCVRLT  81

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT  S  +LTV QSF N GL  +++GL  NNP ++ L ++ A +AV+  L ++ V
Sbjct  82   WATYMFTRHS--NLTVAQSFINNGLNNAMSGLGQNNPQLLGLTVVEAQKAVIEELGRHGV  139

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M +LDN + +P WCC S DGNGF+GD YF+PK W+ GL  VA  +     V+G+SLRNEL
Sbjct  140  MSVLDNQVGEPMWCCGSNDGNGFWGDKYFEPKEWLKGLDIVANRYKDIPMVIGISLRNEL  199

Query  654  RGPKQNVNDWYRYM  695
            RGP QN + WY Y+
Sbjct  200  RGPLQNQSVWYEYV  213



>ref|XP_009773950.1| PREDICTED: uncharacterized protein LOC104224082 [Nicotiana sylvestris]
Length=526

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 138/194 (71%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+SRWI++ E+G+RVKL C NW  HL+ ++ EGL +QPV  I++ I  MGFNCVRLT
Sbjct  22   PLSTSSRWIIDDETGQRVKLVCGNWAAHLQTMLPEGLDQQPVSHIARHISLMGFNCVRLT  81

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT  S  +LTV QSF N GL ++++GL  NNP ++ L ++ A +AV+  L ++ V
Sbjct  82   WATYMFTRHS--NLTVAQSFINNGLNDAMSGLGQNNPQLLGLTVVEAQKAVIEELGRHGV  139

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M +LDN + +P WCC S DGNGF+GD YF+PK W+ GL  VA  +     V+G+SLRNEL
Sbjct  140  MSVLDNQVGEPMWCCGSDDGNGFWGDKYFEPKEWLKGLDIVARTYKDIPLVIGISLRNEL  199

Query  654  RGPKQNVNDWYRYM  695
            RGP QN + WY Y+
Sbjct  200  RGPLQNQSVWYEYV  213



>emb|CDP12092.1| unnamed protein product [Coffea canephora]
Length=938

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+SRWI+++ +G RVKL CVNWV HLE +V EGL K+P+  I   +  MGFNCVRLT
Sbjct  407  PLSTSSRWILDDKTGSRVKLTCVNWVGHLEPLVVEGLQKKPLPYIVDNVALMGFNCVRLT  466

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  F+FT ++  +LTVR+S   L L  S+AG+  NNP ++D  ++   +AVV  L +  +
Sbjct  467  WATFMFTRENYGNLTVRESLNQLSLDGSVAGIAMNNPQLLDATVVEVQKAVVYELGRKNI  526

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+ILDNH+SKP WCC   DGNGFFGD +FDPK W+ GL  VA ++    NVV MS+RNEL
Sbjct  527  MVILDNHVSKPQWCCGGDDGNGFFGDEFFDPKEWLQGLAAVANLYKDAPNVVAMSMRNEL  586

Query  654  RGPKQNVNDWYRYM  695
            RGP+QN NDWY Y+
Sbjct  587  RGPRQNTNDWYEYI  600


 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 113/163 (69%), Gaps = 2/163 (1%)
 Frame = +3

Query  207  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  386
            ++ EGLSK P+D IS+ I  +GFNC+RLTW ++++T    A +TV Q  ++L L +++AG
Sbjct  1    MLPEGLSKSPLDDISRHISLLGFNCIRLTWAVYMYTRH--AHVTVAQHLQDLNLTDALAG  58

Query  387  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  566
            +Q +NP +  L L+ A +AV+ S+A + VM++LD  +SKP WCC+  DGNGF+GD YFDP
Sbjct  59   IQRHNPHLASLTLVDAQKAVIESVASHGVMVLLDCQVSKPMWCCNDNDGNGFWGDAYFDP  118

Query  567  KLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYM  695
              W+  L+ VA  +     V+ MSLRNELRGP+QN   WY ++
Sbjct  119  HEWLRALSTVAKRYKDMHMVMAMSLRNELRGPRQNETLWYHWV  161



>gb|EYU23410.1| hypothetical protein MIMGU_mgv1a004297mg [Erythranthe guttata]
Length=534

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 129/196 (66%), Gaps = 1/196 (1%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            A  LSTNSRWI+++ +G+RVKL C NW  H+E ++ EGL K+PV  I+ +I  +GFNCVR
Sbjct  22   AITLSTNSRWIIDQGTGKRVKLTCANWAAHMEPMLPEGLEKKPVSYIASQIAKLGFNCVR  81

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LTW  ++FT     +L V +S     L  + AG+  NN   +++ +I   +AVVG L K 
Sbjct  82   LTWATYMFTRPEYVNLKVSESLDRYSLAAAKAGIGKNNAQFLEMSVIDVQKAVVGELGKN  141

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             +M++LDN +S P WCCS  DGNGF+GD YF    W+ GLT VA  + G   VV MSLRN
Sbjct  142  NLMVVLDNTVSMPTWCCSDDDGNGFWGDKYFAVDEWLQGLTAVARAYKGNPAVVAMSLRN  201

Query  648  ELRGPKQNVNDWYRYM  695
            ELRG  QN+ DWYRYM
Sbjct  202  ELRGKGQNLLDWYRYM  217



>ref|XP_002509879.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51266.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=542

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 133/190 (70%), Gaps = 3/190 (2%)
 Frame = +3

Query  129  NSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  305
            N RWI++ +SG RVKLACVNW +HL+ ++AEGL K+P+  ++ K+    FNCVR T    
Sbjct  30   NKRWIIDAKSGERVKLACVNWASHLQPMLAEGLDKKPLSYLASKLARYHFNCVRFTCATH  89

Query  306  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  485
            +FT      LTV QSF +L L ++ AG+  +N  +++L ++ AY+AVV  L  + +M++L
Sbjct  90   MFTR--YGKLTVAQSFDSLNLTKAKAGIARHNSFLLNLTVVQAYEAVVNELGAHGLMVLL  147

Query  486  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  665
            DNH+S+P WCC   D NGFFGDI+F PK W+ GL  VA +F G S VV MS+RNELRGP 
Sbjct  148  DNHVSQPKWCCPQDDENGFFGDIHFHPKEWLRGLAIVAKIFQGKSQVVAMSMRNELRGPY  207

Query  666  QNVNDWYRYM  695
            QN +DWY+Y+
Sbjct  208  QNEHDWYKYI  217



>ref|XP_010325669.1| PREDICTED: uncharacterized protein LOC101257885 [Solanum lycopersicum]
Length=503

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 136/192 (71%), Gaps = 3/192 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+SRWI+++ +G+RVKLACVNW  HL+ ++ EGL +QP+  I K I  MGFNCVRLT
Sbjct  28   PLSTSSRWIIDDKNGQRVKLACVNWAAHLQTMIPEGLDQQPISKIVKHISLMGFNCVRLT  87

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  ++FT  S  +LTV QSF N GL +++  +   NP ++ L +  A +AVV  + ++ +
Sbjct  88   WATYMFTRYS--NLTVAQSFANNGLHDALTRIAQKNPQLLGLSVFEAQRAVVEEMGRHGI  145

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M ILDNH+S+P WCC ++DGNGF+GD  F PK W+ GL  VA  +  +  V+G+SLRNEL
Sbjct  146  MSILDNHLSRPMWCCGNHDGNGFWGDEDFQPKEWLKGLDIVAKKYKDSPMVMGISLRNEL  205

Query  654  RGPKQNVNDWYR  689
            RGP QN + WY+
Sbjct  206  RGPLQNQSVWYK  217



>gb|KDP25365.1| hypothetical protein JCGZ_20521 [Jatropha curcas]
Length=935

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 134/194 (69%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN +WIV+ ++G+RVKLACVNW  HLE +VAEG  +Q +  I ++IV   +NCVRLT
Sbjct  27   PLSTNGKWIVDSKTGQRVKLACVNWPAHLEPMVAEGFREQSLKRIVEQIVKQKYNCVRLT  86

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            W  F+FT    A++TV+QSF+ L L E+  G++ +N  +  + L+ A++AV+  L    V
Sbjct  87   WATFMFTR--YANITVKQSFQTLKLTETTGGIKKHNLFLYSMTLVQAFEAVIDELGNQGV  144

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M +LD  +SKP WCC   DGN FFGD  FD + W+ GLTKVA +     +VVG+S RNEL
Sbjct  145  MAVLDCQVSKPSWCCGERDGNAFFGDTSFDVQEWIQGLTKVAELVKSKPHVVGISTRNEL  204

Query  654  RGPKQNVNDWYRYM  695
            RGP  NV+DWY+Y+
Sbjct  205  RGPLSNVDDWYKYI  218



>ref|XP_001767510.1| predicted protein [Physcomitrella patens]
 gb|EDQ67645.1| predicted protein, partial [Physcomitrella patens]
Length=359

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 125/189 (66%), Gaps = 0/189 (0%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLST SRW+V+  G RVK +CVNW  HLE  + EGLS+     I+  I   GFNCVRLT+
Sbjct  1    PLSTFSRWVVDRFGVRVKFSCVNWAGHLEAGIPEGLSRNTARGIATLIRVNGFNCVRLTY  60

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
              +L+TNDS   LTV Q+F NL L  +   + A NP +  L L   ++ +V  L  + +M
Sbjct  61   STWLWTNDSYGELTVAQNFNNLNLTSTGLAIAALNPDLYLLTLRQVHRRMVNILTAHDLM  120

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +ILDNH+SKP WCCS  DGNGF+GD YFD + W++GLT VAT F+    VV MSLRN LR
Sbjct  121  VILDNHVSKPKWCCSDTDGNGFWGDEYFDVETWMLGLTTVATTFSSNPFVVAMSLRNALR  180

Query  657  GPKQNVNDW  683
            GP+QN  DW
Sbjct  181  GPRQNAIDW  189



>gb|KDP25366.1| hypothetical protein JCGZ_20522 [Jatropha curcas]
Length=554

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 134/200 (67%), Gaps = 3/200 (2%)
 Frame = +3

Query  99   PTVVAQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P     PLST  +WIV+ ++G RVKLACVNW +HLE ++AEGL+ +P+  I  +IV   +
Sbjct  17   PCCFCLPLSTKGKWIVDSKTGERVKLACVNWPSHLEPMLAEGLADKPLKQIVFQIVRGNY  76

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
            NCVR TW  F+FT    A+LTVR+SF  L L E++A ++  N  I++  L  A++ V+  
Sbjct  77   NCVRFTWATFMFTR--YANLTVRESFNTLNLTETVAEIRRQNGFILEKTLPQAFETVIDE  134

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L +  VM+ILD  +SKP WCC   DGN FFGD YFD + W+ GLT  A +  G  NV+G+
Sbjct  135  LGRQGVMVILDCQVSKPTWCCGEKDGNAFFGDEYFDVEEWLQGLTTAAELAKGKPNVIGI  194

Query  636  SLRNELRGPKQNVNDWYRYM  695
            S RNELRGP  NV++WY+Y+
Sbjct  195  STRNELRGPLSNVDNWYKYI  214



>ref|XP_002509878.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51265.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=521

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 132/196 (67%), Gaps = 5/196 (3%)
 Frame = +3

Query  111  AQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            + PLST  RWI++ ++G+RVKLACVNW +H+E ++AEGL +QP+  I   +    FNCVR
Sbjct  27   SMPLSTKGRWIIDTKTGQRVKLACVNWPSHMETMLAEGLHEQPLKRIVALLAKQKFNCVR  86

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+  +++T    ++ TV +SF  L   E+  G+  NNP ++   L  AY+ VV  LA  
Sbjct  87   LTYATYMWTR--YSNRTVSESFNFLP--EAKEGIAKNNPDLLSKTLPQAYETVVDELAAQ  142

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             VM +LDNH+SKP WCCS  DGN FFGD YFD K W+ GLT VAT F G   V+ +S RN
Sbjct  143  GVMTLLDNHVSKPTWCCSETDGNTFFGDTYFDVKEWIQGLTTVATRFRGKPKVMAISTRN  202

Query  648  ELRGPKQNVNDWYRYM  695
            ELRGP QN +DWY+Y+
Sbjct  203  ELRGPLQNQDDWYKYI  218



>ref|XP_003621386.1| Endoglucanase E1 [Medicago truncatula]
Length=416

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 130/193 (67%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN+RWI++E+G+RVKL CVNW +HL  +VAEGL  +P+  +  ++ ++GF+CVR TW
Sbjct  25   PLSTNNRWIIDETGKRVKLHCVNWSSHLNAMVAEGLEIKPLKDLIAQLKELGFDCVRYTW  84

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
               +FT    ++  V ++   L L  S  G+   NPS+ ++ ++ A+  V+    K  +M
Sbjct  85   ATHMFT--RYSNYKVGENLDKLNLTSSRLGIGNFNPSLENITVVEAFDFVIDEFGKQGMM  142

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +++DNH+S P WCC + DGNGFFGD Y DPK W+ GL+ VA    G S VV + LRNELR
Sbjct  143  VLVDNHVSDPKWCCHNKDGNGFFGDQYSDPKEWLQGLSNVANRVKGKSQVVAVGLRNELR  202

Query  657  GPKQNVNDWYRYM  695
            GP QN+++W +YM
Sbjct  203  GPGQNIDNWQKYM  215



>ref|XP_001769398.1| predicted protein [Physcomitrella patens]
 gb|EDQ65767.1| predicted protein, partial [Physcomitrella patens]
Length=359

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 126/192 (66%), Gaps = 0/192 (0%)
 Frame = +3

Query  120  LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  299
            LSTNSRW+V+  G RVKL+CVNWV HLE  + EGL+K     I+  +   GFNCVRLT  
Sbjct  1    LSTNSRWVVDRFGVRVKLSCVNWVGHLEPGIPEGLNKNTARGIAILVRATGFNCVRLTSS  60

Query  300  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  479
             +L+TNDS   LTV QSF NL +  S   L+A NP +  L L   +  V+  L    +M+
Sbjct  61   TWLWTNDSYGGLTVAQSFSNLNITSSSIALRAINPELYPLTLREVHHQVINILTAQGLMV  120

Query  480  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  659
            ILDNH+SKP WCC+S DGNGF+GD +FD + W++GLT VA+ F+    VV MSLRNELRG
Sbjct  121  ILDNHVSKPQWCCASNDGNGFWGDEFFDAETWLMGLTTVASEFSNNPFVVAMSLRNELRG  180

Query  660  PKQNVNDWYRYM  695
             +QN   W   M
Sbjct  181  SRQNSYLWRVLM  192



>gb|AES77604.2| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 130/193 (67%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN+RWI++E+G+RVKL CVNW +HL  +VAEGL  +P+  +  ++ ++GF+CVR TW
Sbjct  25   PLSTNNRWIIDETGKRVKLHCVNWSSHLNAMVAEGLEIKPLKDLIAQLKELGFDCVRYTW  84

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
               +FT    ++  V ++   L L  S  G+   NPS+ ++ ++ A+  V+    K  +M
Sbjct  85   ATHMFT--RYSNYKVGENLDKLNLTSSRLGIGNFNPSLENITVVEAFDFVIDEFGKQGMM  142

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            +++DNH+S P WCC + DGNGFFGD Y DPK W+ GL+ VA    G S VV + LRNELR
Sbjct  143  VLVDNHVSDPKWCCHNKDGNGFFGDQYSDPKEWLQGLSNVANRVKGKSQVVAVGLRNELR  202

Query  657  GPKQNVNDWYRYM  695
            GP QN+++W +YM
Sbjct  203  GPGQNIDNWQKYM  215



>ref|XP_004510834.1| PREDICTED: uncharacterized protein LOC101496378 [Cicer arietinum]
Length=540

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 131/196 (67%), Gaps = 3/196 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            A PLST SRWI+++S   RVKL C NW  HL+ ++ EGL ++P+  +  ++V   FNCVR
Sbjct  27   AYPLSTKSRWIIDDSTSERVKLVCGNWAGHLQPMIPEGLDRRPLKELVGELVQKKFNCVR  86

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+ ++++T        V ++F +L   E++ G+   NP ++ +  I A+ AVV  LA  
Sbjct  87   LTYAIYMWTRH--GHDIVNETFSDLDAPEAVDGIAKYNPFVLKMTHIEAFDAVVNELAAQ  144

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             V ++LDNH+S+P WCC+  DGNGFF D +FDP+ W+ GLT  A  FNG  +VV MSLRN
Sbjct  145  NVKVLLDNHVSEPKWCCNDDDGNGFFYDRHFDPQEWIHGLTLAAKHFNGHHHVVAMSLRN  204

Query  648  ELRGPKQNVNDWYRYM  695
            EL GP+QN+ DWY+YM
Sbjct  205  ELHGPRQNLKDWYKYM  220



>ref|XP_007135020.1| hypothetical protein PHAVU_010G095100g [Phaseolus vulgaris]
 gb|ESW07014.1| hypothetical protein PHAVU_010G095100g [Phaseolus vulgaris]
Length=512

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 130/196 (66%), Gaps = 3/196 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            A PLST +RWI++E +G+R KL C NW  HL+ ++ EGL K+P+  +  ++V   FNCVR
Sbjct  22   AYPLSTQNRWIIDEATGQRAKLVCANWAGHLKPMIPEGLDKRPLKELVGELVKHNFNCVR  81

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+ ++++T  S  +++   SF +L   E + G+  NNPS++ +  + A+ AVV  L   
Sbjct  82   LTYAIYMWTRYSHENVSA--SFASLDAPEVVQGISKNNPSVLSMTHVQAFHAVVHELGVQ  139

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             V ++LDNH+S+P WCC   D NGFF D +F+P+ WV GLT  A  F G   VV MSLRN
Sbjct  140  NVKVLLDNHVSEPMWCCDDDDENGFFHDRHFNPQEWVRGLTLAAKHFTGNHAVVAMSLRN  199

Query  648  ELRGPKQNVNDWYRYM  695
            EL GP+QN+ DWYRYM
Sbjct  200  ELHGPRQNLQDWYRYM  215



>gb|KGN45940.1| hypothetical protein Csa_6G028440 [Cucumis sativus]
Length=539

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 134/194 (69%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+ RWI++ +SG+RVKL CVNW +H + ++ EGL+ +P+  ++ + + + FNCVRLT
Sbjct  26   PLSTHGRWIIDSQSGKRVKLVCVNWPSHTQSMLIEGLNHRPLKELADEAIKLRFNCVRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +   +FT    A+ TV ++F  L L ++ AGL   NP +++  +  AY+AVV  L    +
Sbjct  86   YATHMFTR--YANRTVEENFDLLDLEQAKAGLAQYNPFVLNKTIAEAYEAVVDVLGASGL  143

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+I DNH+S+P WCCS  DGNGFFG+ YFDP+ W+ GL+ VA  FN  S VVGMSLRNEL
Sbjct  144  MVIADNHMSQPRWCCSLDDGNGFFGNRYFDPQEWLQGLSLVAQRFNNKSTVVGMSLRNEL  203

Query  654  RGPKQNVNDWYRYM  695
            RG  +N NDW  Y+
Sbjct  204  RGMMENANDWNNYV  217



>gb|KEH18775.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=538

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 130/196 (66%), Gaps = 3/196 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            A PLST+SRWI++++ G RVKL C NW  HL+ ++ EGL ++P+  +  ++V   FNCVR
Sbjct  26   AYPLSTHSRWIIDDTTGERVKLVCGNWAGHLQPMIPEGLDRRPLKELVGELVKNNFNCVR  85

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+ ++++T     +  V  +F +L + E + G+  NNPS++ +  I A+ AVV  L   
Sbjct  86   LTYAIYMWTR--YQNGIVNDTFNDLDVPEIVEGIANNNPSVLKMTHIEAFDAVVKELGDQ  143

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             V ++LDNH+S+P WCC   D NGFF D +FDP+ W+ GLT  A  F G   VV MSLRN
Sbjct  144  NVRVLLDNHVSEPKWCCHDDDENGFFHDRHFDPQEWIHGLTLAAKHFEGHHPVVAMSLRN  203

Query  648  ELRGPKQNVNDWYRYM  695
            EL GP+QN+ DWY+YM
Sbjct  204  ELHGPRQNLKDWYKYM  219



>ref|XP_007159232.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
 gb|ESW31226.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
Length=529

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 133/196 (68%), Gaps = 3/196 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            + PLS   RWI+++ +G RVKL C +WV H + ++AEGL K P++VI+  +   GFNCVR
Sbjct  21   SMPLSVQKRWIIDDATGERVKLHCTHWVVHAQPMLAEGLDKSPLNVIAANVAKAGFNCVR  80

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            L++  ++FT    A+ TVR +F +  + E +  +Q +NPS++++  + AY+AVV +L  +
Sbjct  81   LSYATYMFTRH--ANNTVRDTFHSYDVPEMVTAIQKHNPSVLNMTHLQAYEAVVDALGAH  138

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             VM+++DNH+S P WCC++ D NGFFGD +F+   W+ GL  VA  F G  NV  M LRN
Sbjct  139  GVMVLIDNHLSLPDWCCANDDQNGFFGDRHFNTSEWIQGLAIVAHHFKGKPNVFAMDLRN  198

Query  648  ELRGPKQNVNDWYRYM  695
            ELRG +QN N WY+Y+
Sbjct  199  ELRGSRQNWNVWYKYV  214



>gb|KEH28356.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=523

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 128/196 (65%), Gaps = 3/196 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            A PLST SRWI+++S G RVKL C NW  HL+ ++ EGL + P+  +  ++V   FNCVR
Sbjct  24   AYPLSTQSRWIIDDSTGERVKLVCGNWAGHLQPMIPEGLDRIPLKELVGELVKNRFNCVR  83

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+ ++++T    A   V  +F  L   E +AG+   NPSI+ +  I A+ AVV  L   
Sbjct  84   LTYAVYMWTRH--AHGIVNNTFNYLDAPEVVAGIAKYNPSILKMTHIEAFDAVVNELGAR  141

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             V ++LDNH+S+P WCC+  D NGFF D +FDP+ W+ GLT  A  F G   +V MSLRN
Sbjct  142  NVKVLLDNHVSEPKWCCNDDDDNGFFHDQHFDPQEWIHGLTLAAKHFYGHQPIVAMSLRN  201

Query  648  ELRGPKQNVNDWYRYM  695
            ELRGP+QN+ DWY+YM
Sbjct  202  ELRGPRQNLRDWYKYM  217



>ref|XP_002509877.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51264.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=547

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 128/194 (66%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV+ ++G+RVKL C NW +H+E ++AEGL K+P+D I  ++    FNCVR T
Sbjct  22   PLSTNGRWIVDAKTGQRVKLTCANWPSHVESMLAEGLDKKPLDYIIHQLSRNHFNCVRFT  81

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +   ++T    A+ TV ++F +L L ++ AG+   NPS + +  + A+ AVV       V
Sbjct  82   YATHMYTR--YANRTVSETFDSLNLTDAKAGIAKYNPSFLSMTHVQAFDAVVDQFGAQGV  139

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            +++LDN +S+P WCC   DGNGFFGD  FD + W+  L  VA  F G S V+G+S RNEL
Sbjct  140  LVVLDNQVSRPTWCCGYDDGNGFFGDKDFDAEEWLQALATVADRFKGKSQVIGISTRNEL  199

Query  654  RGPKQNVNDWYRYM  695
            RGP  N +DWY+YM
Sbjct  200  RGPSSNEDDWYKYM  213



>ref|XP_004170746.1| PREDICTED: endoglucanase E1-like [Cucumis sativus]
Length=539

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 133/194 (69%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLST+ RWI++ +SG+RVKL CVNW +H + ++ EGL+ +P+  ++ + + + FNCVRLT
Sbjct  26   PLSTHGRWIIDSQSGKRVKLVCVNWPSHTQSMLIEGLNHRPLKELADEAIKLRFNCVRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            +   +FT    A+ TV ++F  L L ++ AGL   N  +++  +  AY+AVV  L    +
Sbjct  86   YATHMFTR--YANRTVEENFDLLDLEQAKAGLAQYNAFVLNKTIAEAYEAVVDVLGASGL  143

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  653
            M+I DNH+S+P WCCS  DGNGFFG+ YFDP+ W+ GL+ VA  FN  S VVGMSLRNEL
Sbjct  144  MVIADNHMSQPRWCCSLDDGNGFFGNRYFDPQEWLQGLSLVAQRFNNKSTVVGMSLRNEL  203

Query  654  RGPKQNVNDWYRYM  695
            RG  +N NDW  Y+
Sbjct  204  RGMMENANDWNNYV  217



>ref|XP_003621392.1| Endoglucanase E1 [Medicago truncatula]
Length=534

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 127/193 (66%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN+RWIV+E+G+RVKL CVNW +H+  +VAEGL   P+  I  ++  +GF+CVR TW
Sbjct  25   PLSTNNRWIVDETGKRVKLHCVNWSSHMNAMVAEGLETIPLKDIITQLKGLGFDCVRYTW  84

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
               +FT    ++  V ++   L L  S  G++  NPS  ++ ++ A+  V+    +  +M
Sbjct  85   ATKMFT--RYSNYKVGENLDKLNLTSSRLGIRFYNPSFENITVVEAFDNVIDEFGRQGMM  142

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            ++ DNH+S P WCC + DGNGFFGD YF+P+ W+ GL+ V+    G S VV + LRNELR
Sbjct  143  VLADNHVSDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVSNRVKGKSQVVAIGLRNELR  202

Query  657  GPKQNVNDWYRYM  695
            GP QN++ W +YM
Sbjct  203  GPSQNISSWQKYM  215



>gb|AES77610.2| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=535

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 127/193 (66%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN+RWIV+E+G+RVKL CVNW +H+  +VAEGL   P+  I  ++  +GF+CVR TW
Sbjct  26   PLSTNNRWIVDETGKRVKLHCVNWSSHMNAMVAEGLETIPLKDIITQLKGLGFDCVRYTW  85

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
               +FT    ++  V ++   L L  S  G++  NPS  ++ ++ A+  V+    +  +M
Sbjct  86   ATKMFT--RYSNYKVGENLDKLNLTSSRLGIRFYNPSFENITVVEAFDNVIDEFGRQGMM  143

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            ++ DNH+S P WCC + DGNGFFGD YF+P+ W+ GL+ V+    G S VV + LRNELR
Sbjct  144  VLADNHVSDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVSNRVKGKSQVVAIGLRNELR  203

Query  657  GPKQNVNDWYRYM  695
            GP QN++ W +YM
Sbjct  204  GPSQNISSWQKYM  216



>ref|XP_003621369.1| Endoglucanase E1 [Medicago truncatula]
 gb|AES77587.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 124/193 (64%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN RW+V+ESG+RVKL C+NW +H+  +VAEGL   P+     ++  +GFNCVR TW
Sbjct  25   PLSTNKRWVVDESGKRVKLHCINWSSHMNAMVAEGLDTIPLKDCIAQLKGLGFNCVRYTW  84

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
               +FT    ++  V +    L L     G+   NPS+ ++ ++ A+  V+    K  +M
Sbjct  85   ATHMFT--RYSTNKVGEKLDKLNLTGPRLGIGNFNPSMENITVVEAFDFVIDEFGKQGMM  142

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            ++ DNH+S P WCC + DGNGFFGD YF+P+ W+ GL+ VA    G   VV + LRNELR
Sbjct  143  VLADNHVSDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVANRVKGKPQVVAIGLRNELR  202

Query  657  GPKQNVNDWYRYM  695
            GPKQN N+W++YM
Sbjct  203  GPKQNENNWHKYM  215



>gb|KFK38059.1| hypothetical protein AALP_AA3G064700 [Arabis alpina]
Length=449

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +3

Query  267  MGFNCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  443
            MGFNCVR TWPL L TND+LA ++TVRQSF+  GL + + G+  +NPSIVD+PL+ A+QA
Sbjct  1    MGFNCVRFTWPLELMTNDTLAFNVTVRQSFERYGLNQDLNGIHTHNPSIVDIPLVNAFQA  60

Query  444  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  623
            VV SL ++ VM+ILDNH + PGWCCS  D + FFGD  FDP  W++GL K+AT+F    N
Sbjct  61   VVYSLGRHSVMVILDNHKTVPGWCCSKNDPDAFFGDAKFDPDQWILGLRKMATIFRNVKN  120

Query  624  VVGMSLRNELRGPKQNVNDWYRYM  695
            V+GMSLRNELRG K++  DWY+YM
Sbjct  121  VIGMSLRNELRGNKEDPKDWYKYM  144



>emb|CDY16991.1| BnaC09g41180D [Brassica napus]
Length=495

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 126/200 (63%), Gaps = 29/200 (15%)
 Frame = +3

Query  96   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  275
            P  + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKI     
Sbjct  19   PKLITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKI-----  73

Query  276  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  455
                                    SF+ L LL+ + G+Q +NP I++LP+  A+Q VV +
Sbjct  74   ------------------------SFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVSN  109

Query  456  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  635
            L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVGM
Sbjct  110  LGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPIIWTKGLSKMASLFRNVTNVVGM  169

Query  636  SLRNELRGPKQNVNDWYRYM  695
            SLRNE RG +   N W++YM
Sbjct  170  SLRNEPRGTRDYPNLWFKYM  189



>ref|XP_010261410.1| PREDICTED: uncharacterized protein LOC104600255 [Nelumbo nucifera]
Length=418

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +3

Query  198  LEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLES  377
            ++ ++AEGL K+P+  I   +  +GFNCVRLTW  ++FT    A  TV +S  ++GL E+
Sbjct  1    MQPMLAEGLDKKPLRDIVGLVSSLGFNCVRLTWATYMFTRTRAAQRTVAESLDSMGLTEA  60

Query  378  IAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIY  557
             AG+  NNPS+++L ++ AY  V+  L    +M++LDNH+S P WCC S DGNGFFGD Y
Sbjct  61   KAGVARNNPSLLNLTVVQAYGTVINELGAAGLMVVLDNHVSLPKWCCGSNDGNGFFGDAY  120

Query  558  FDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYM  695
            F+P  WV GL +VA  F G   VVGMS+RNELRGP+QN  DW+RY+
Sbjct  121  FNPDEWVEGLGRVAKRFKGRPQVVGMSMRNELRGPRQNEQDWFRYI  166



>ref|XP_010916958.1| PREDICTED: uncharacterized protein LOC105041671 [Elaeis guineensis]
Length=485

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 118/164 (72%), Gaps = 0/164 (0%)
 Frame = +3

Query  198  LEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLES  377
            +  V+AEGL KQPVD I+ +I  +GFNCVRLTW  +LFTN+S  +LTV  S  +LGL ++
Sbjct  1    MPAVLAEGLDKQPVDGIAARIAGLGFNCVRLTWATYLFTNESYENLTVSDSLSSLGLGDA  60

Query  378  IAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIY  557
            +AG++ NN  +V + +  AY AVV ++ +  +M++LDNH+S+P WCC + DGNGFFGD+Y
Sbjct  61   LAGVRRNNGRMVGMTVREAYDAVVKAIGEAGLMVVLDNHVSRPQWCCGNADGNGFFGDLY  120

Query  558  FDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYR  689
            FDP+ W+ GL  VA  +     VVGMS+RNELRGP Q+   WYR
Sbjct  121  FDPEEWLRGLELVARRYRDIHQVVGMSMRNELRGPNQSEPAWYR  164



>gb|KGN57439.1| hypothetical protein Csa_3G186170 [Cucumis sativus]
Length=203

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 119/159 (75%), Gaps = 3/159 (2%)
 Frame = +3

Query  117  PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  293
            PLSTN RWIV  + G+RVKL CVNW  H++ +VAEGL  +P+D I+  +V + FNCVRLT
Sbjct  26   PLSTNGRWIVEATTGQRVKLICVNWPGHMQAMVAEGLHLKPLDDIAAMVVKLRFNCVRLT  85

Query  294  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  473
            + + +FT    A+LTV+QSF+N  L E+I G+  NNP+I+++ ++ AY+AVV SL  + V
Sbjct  86   YSIHMFTR--YANLTVKQSFENFDLKEAIVGIAQNNPTILNMKVVEAYEAVVDSLGAHGV  143

Query  474  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLT  590
            M++ DNHIS+P WCCS+ DGNGFFGD YF+ + W+ GL+
Sbjct  144  MVVSDNHISQPRWCCSNDDGNGFFGDRYFNSQEWLQGLS  182



>gb|AFK46453.1| unknown [Lotus japonicus]
Length=158

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  281
             V   PL+TNSRWIVN+ G RVKLACVNWV+HL+ VVAEGLSKQPVDVISK I  MGFNC
Sbjct  36   AVAGVPLNTNSRWIVNQDGLRVKLACVNWVSHLDAVVAEGLSKQPVDVISKGIKSMGFNC  95

Query  282  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  440
            VRLTWP+ L TNDSL+SLTVRQSF+NLGLL+S+AG+QANNPSI+DL LI A+Q
Sbjct  96   VRLTWPILLVTNDSLSSLTVRQSFQNLGLLDSVAGVQANNPSIIDLTLIQAFQ  148



>ref|XP_003621368.1| Endoglucanase [Medicago truncatula]
 gb|AES77586.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=457

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 125/193 (65%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  296
            PLSTN+RWIV+E+G+RVKL CVNW +H+  +VAEGL   P+  +  ++  +GF+CVR TW
Sbjct  26   PLSTNNRWIVDETGKRVKLHCVNWSSHMNAMVAEGLDAIPLKDVIAQLKGLGFDCVRYTW  85

Query  297  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  476
              ++FT    ++  V ++   L L  S  G+   NPS+  + ++ A+  VV    K  +M
Sbjct  86   ATYMFT--RYSNYKVGENLDKLNLTSSRLGIGNFNPSLESITVVEAFDFVVDEFGKQGMM  143

Query  477  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  656
            ++ DNH+S P WCC + DGNG FGD YF+ + W+ GL+ VA    G   +V + LRNELR
Sbjct  144  VLADNHVSDPKWCCDNNDGNGCFGDQYFNLEEWLQGLSNVANRVKGKPQIVAVGLRNELR  203

Query  657  GPKQNVNDWYRYM  695
            GP QN ++WY+YM
Sbjct  204  GPGQNNDNWYKYM  216



>ref|XP_003617143.1| Oligoribonuclease [Medicago truncatula]
Length=1551

 Score =   197 bits (500),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 128/196 (65%), Gaps = 3/196 (2%)
 Frame = +3

Query  111  AQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  287
            A PLST SRWI+++S G RVKL C NW  HL+ ++ EGL + P+  +  ++V   FNCVR
Sbjct  99   AYPLSTQSRWIIDDSTGERVKLVCGNWAGHLQPMIPEGLDRIPLKELVGELVKNRFNCVR  158

Query  288  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  467
            LT+ ++++T    A   V  +F  L   E +AG+   NPSI+ +  I A+ AVV  L   
Sbjct  159  LTYAVYMWTRH--AHGIVNNTFNYLDAPEVVAGIAKYNPSILKMTHIEAFDAVVNELGAR  216

Query  468  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  647
             V ++LDNH+S+P WCC+  D NGFF D +FDP+ W+ GLT  A  F G   +V MSLRN
Sbjct  217  NVKVLLDNHVSEPKWCCNDDDDNGFFHDQHFDPQEWIHGLTLAAKHFYGHQPIVAMSLRN  276

Query  648  ELRGPKQNVNDWYRYM  695
            ELRGP+QN+ DWY+YM
Sbjct  277  ELRGPRQNLRDWYKYM  292



>emb|CBI34407.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 114/163 (70%), Gaps = 0/163 (0%)
 Frame = +3

Query  207  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  386
            +V EGL  QP+  I+ K+  MGFNC+RLT+  F++T    ++ TV QS  +  L ++  G
Sbjct  1    MVTEGLHTQPIKDIAAKVTSMGFNCIRLTYATFMWTRSDYSNKTVAQSLDSFNLTQAREG  60

Query  387  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  566
            +  NNP +++L L  AY+AVV  L    +M++LDNH+SKP WCC+  DGNGFFGD++FDP
Sbjct  61   IARNNPQLLNLSLQEAYEAVVDELGANGLMLVLDNHVSKPMWCCAREDGNGFFGDMFFDP  120

Query  567  KLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYM  695
            K W+ GLT+VA  F G   VV MS+RNE+RGP+QN+ DWY+ M
Sbjct  121  KEWIEGLTQVAKRFKGKPQVVAMSMRNEIRGPRQNLPDWYKNM  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340