BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024O04

Length=668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW86671.1|  hypothetical protein EUGRSUZ_B032972                    417   3e-144   Eucalyptus grandis [rose gum]
gb|KJB50260.1|  hypothetical protein B456_008G160800                    421   1e-143   Gossypium raimondii
ref|XP_008351782.1|  PREDICTED: peroxisomal primary amine oxidase...    424   3e-143   
gb|KJB50259.1|  hypothetical protein B456_008G160800                    420   7e-142   Gossypium raimondii
ref|XP_008221920.1|  PREDICTED: copper amine oxidase 1-like             426   2e-141   Prunus mume [ume]
emb|CAN62304.1|  hypothetical protein VITISV_023689                     424   3e-141   Vitis vinifera
ref|XP_010646479.1|  PREDICTED: copper amine oxidase 1 isoform X2       423   3e-141   Vitis vinifera
ref|XP_010251088.1|  PREDICTED: copper amine oxidase 1-like isofo...    424   8e-141   Nelumbo nucifera [Indian lotus]
ref|XP_002273532.2|  PREDICTED: copper amine oxidase 1 isoform X1       424   9e-141   Vitis vinifera
ref|XP_007211293.1|  hypothetical protein PRUPE_ppa002116mg             422   1e-140   
ref|XP_007044780.1|  Copper amine oxidase family protein isoform 4      420   1e-140   
gb|AIS23647.1|  amine oxidase 4                                         424   2e-140   Malus domestica [apple tree]
gb|KDP31040.1|  hypothetical protein JCGZ_11416                         423   3e-140   Jatropha curcas
gb|KDO69507.1|  hypothetical protein CISIN_1g004084mg                   422   4e-140   Citrus sinensis [apfelsine]
ref|XP_007225246.1|  hypothetical protein PRUPE_ppa001698mg             422   6e-140   Prunus persica
ref|XP_010248627.1|  PREDICTED: copper amine oxidase 1-like             422   6e-140   Nelumbo nucifera [Indian lotus]
ref|XP_007044779.1|  Copper amine oxidase family protein isoform 3      421   9e-140   
gb|KJB50257.1|  hypothetical protein B456_008G160800                    422   9e-140   Gossypium raimondii
ref|XP_009345773.1|  PREDICTED: copper amine oxidase 1-like             422   9e-140   Pyrus x bretschneideri [bai li]
gb|KJB50255.1|  hypothetical protein B456_008G160800                    421   1e-139   Gossypium raimondii
ref|XP_008380537.1|  PREDICTED: copper amine oxidase 1-like             422   1e-139   
gb|KDP26650.1|  hypothetical protein JCGZ_17808                         418   1e-139   Jatropha curcas
ref|XP_008239321.1|  PREDICTED: copper amine oxidase 1-like             421   1e-139   Prunus mume [ume]
gb|KJB50256.1|  hypothetical protein B456_008G160800                    421   2e-139   Gossypium raimondii
gb|KDO69506.1|  hypothetical protein CISIN_1g004084mg                   421   3e-139   Citrus sinensis [apfelsine]
gb|AGZ20104.1|  copper methylamine oxidase-like protein                 420   3e-139   Camellia sinensis [black tea]
ref|XP_008367500.1|  PREDICTED: copper amine oxidase 1-like             421   3e-139   
ref|XP_006584632.1|  PREDICTED: peroxisomal copper-containing ami...    415   3e-139   
gb|KJB50258.1|  hypothetical protein B456_008G160800                    421   3e-139   Gossypium raimondii
ref|XP_009362949.1|  PREDICTED: copper amine oxidase 1-like             421   3e-139   Pyrus x bretschneideri [bai li]
ref|XP_008782506.1|  PREDICTED: peroxisomal primary amine oxidase       414   3e-139   Phoenix dactylifera
ref|XP_006476868.1|  PREDICTED: copper amine oxidase 1-like isofo...    418   4e-139   Citrus sinensis [apfelsine]
gb|KJB50254.1|  hypothetical protein B456_008G160800                    421   4e-139   Gossypium raimondii
ref|XP_007044778.1|  Copper amine oxidase family protein isoform 2      420   4e-139   
ref|XP_004309984.2|  PREDICTED: copper amine oxidase 1-like             420   5e-139   Fragaria vesca subsp. vesca
ref|XP_006476867.1|  PREDICTED: copper amine oxidase 1-like isofo...    420   5e-139   Citrus sinensis [apfelsine]
gb|AIS23648.1|  amine oxidase 5                                         420   6e-139   Malus domestica [apple tree]
gb|AIS23644.1|  amine oxidase 1                                         419   6e-139   Malus domestica [apple tree]
ref|XP_006357609.1|  PREDICTED: copper amine oxidase 1-like             419   8e-139   Solanum tuberosum [potatoes]
gb|KJB15626.1|  hypothetical protein B456_002G186900                    419   9e-139   Gossypium raimondii
ref|XP_008389733.1|  PREDICTED: copper amine oxidase 1-like isofo...    419   1e-138   
gb|KHG02854.1|  Copper methylamine oxidase                              419   1e-138   Gossypium arboreum [tree cotton]
ref|XP_007044777.1|  Copper amine oxidase family protein isoform 1      419   2e-138   
ref|XP_004239124.1|  PREDICTED: copper amine oxidase 1                  418   2e-138   Solanum lycopersicum
ref|XP_006411506.1|  hypothetical protein EUTSA_v100163160mg            405   2e-138   
ref|XP_010044582.1|  PREDICTED: peroxisomal primary amine oxidase...    419   2e-138   Eucalyptus grandis [rose gum]
ref|XP_002318664.1|  hypothetical protein POPTR_0012s08630g             417   3e-138   
ref|XP_010102489.1|  Putative primary amine oxidase 2                   416   3e-138   
gb|KJB19703.1|  hypothetical protein B456_003G116000                    414   4e-138   Gossypium raimondii
ref|XP_009600855.1|  PREDICTED: copper amine oxidase 1-like             417   4e-138   Nicotiana tomentosiformis
ref|XP_006439904.1|  hypothetical protein CICLE_v10018950mg             417   6e-138   Citrus clementina [clementine]
gb|KHG02564.1|  Primary amine oxidase                                   416   1e-137   Gossypium arboreum [tree cotton]
ref|XP_010100391.1|  Copper methylamine oxidase                         418   1e-137   
ref|XP_009802912.1|  PREDICTED: peroxisomal primary amine oxidase...    416   2e-137   Nicotiana sylvestris
gb|KJB19704.1|  hypothetical protein B456_003G116000                    415   2e-137   Gossypium raimondii
ref|XP_002511334.1|  copper amine oxidase, putative                     416   2e-137   Ricinus communis
gb|KDO82259.1|  hypothetical protein CISIN_1g004080mg                   414   2e-137   Citrus sinensis [apfelsine]
gb|KHN13432.1|  Copper methylamine oxidase                              414   2e-137   Glycine soja [wild soybean]
emb|CDP12746.1|  unnamed protein product                                415   3e-137   Coffea canephora [robusta coffee]
ref|XP_004289862.2|  PREDICTED: copper amine oxidase 1-like             414   3e-137   Fragaria vesca subsp. vesca
ref|XP_006584631.1|  PREDICTED: peroxisomal copper-containing ami...    415   4e-137   
ref|XP_002527922.1|  copper amine oxidase, putative                     416   5e-137   Ricinus communis
gb|KDO82258.1|  hypothetical protein CISIN_1g004080mg                   412   6e-137   Citrus sinensis [apfelsine]
ref|XP_006438284.1|  hypothetical protein CICLE_v10030749mg             412   8e-137   
ref|XP_003519633.1|  PREDICTED: copper amine oxidase 1-like             413   1e-136   Glycine max [soybeans]
gb|KHN00390.1|  Copper methylamine oxidase                              414   1e-136   Glycine soja [wild soybean]
gb|KEH20160.1|  copper amine oxidase, enzyme domain protein             407   1e-136   Medicago truncatula
gb|KJB19706.1|  hypothetical protein B456_003G116000                    414   1e-136   Gossypium raimondii
ref|XP_011071936.1|  PREDICTED: copper amine oxidase 1-like             414   1e-136   Sesamum indicum [beniseed]
gb|KJB19705.1|  hypothetical protein B456_003G116000                    414   2e-136   Gossypium raimondii
emb|CAN76391.1|  hypothetical protein VITISV_023592                     414   2e-136   Vitis vinifera
ref|XP_010532283.1|  PREDICTED: copper amine oxidase 1-like             414   2e-136   Tarenaya hassleriana [spider flower]
gb|KDO82257.1|  hypothetical protein CISIN_1g004080mg                   413   2e-136   Citrus sinensis [apfelsine]
gb|KEH20164.1|  copper amine oxidase, enzyme domain protein             408   2e-136   Medicago truncatula
ref|XP_006483934.1|  PREDICTED: copper amine oxidase 1-like             413   2e-136   Citrus sinensis [apfelsine]
ref|XP_006438285.1|  hypothetical protein CICLE_v10030749mg             413   2e-136   Citrus clementina [clementine]
ref|XP_002277961.1|  PREDICTED: copper amine oxidase 1-like             413   3e-136   Vitis vinifera
gb|KEH20162.1|  copper amine oxidase, enzyme domain protein             408   4e-136   Medicago truncatula
gb|KEH20161.1|  copper amine oxidase, enzyme domain protein             408   5e-136   Medicago truncatula
gb|KEH35029.1|  copper amine oxidase, enzyme domain protein             410   5e-136   Medicago truncatula
gb|KHG07734.1|  Primary amine oxidase                                   412   5e-136   Gossypium arboreum [tree cotton]
ref|XP_002322194.2|  hypothetical protein POPTR_0015s09450g             412   6e-136   
ref|XP_007138024.1|  hypothetical protein PHAVU_009G174800g             412   7e-136   Phaseolus vulgaris [French bean]
ref|XP_004301007.1|  PREDICTED: copper amine oxidase 1-like             412   8e-136   Fragaria vesca subsp. vesca
ref|XP_003551224.1|  PREDICTED: peroxisomal primary amine oxidase...    411   8e-136   Glycine max [soybeans]
ref|XP_003601195.1|  Primary amine oxidase                              411   8e-136   Medicago truncatula
ref|XP_007036330.1|  Copper amine oxidase family protein isoform 2      411   1e-135   
ref|XP_006845257.1|  hypothetical protein AMTR_s00005p00262140          411   1e-135   Amborella trichopoda
ref|XP_011101289.1|  PREDICTED: copper amine oxidase 1-like             410   2e-135   Sesamum indicum [beniseed]
ref|XP_008464520.1|  PREDICTED: copper amine oxidase 1 isoform X2       408   3e-135   Cucumis melo [Oriental melon]
ref|XP_004509661.1|  PREDICTED: copper methylamine oxidase-like i...    409   5e-135   Cicer arietinum [garbanzo]
ref|XP_007036329.1|  Copper amine oxidase family protein isoform 1      410   5e-135   
ref|XP_011045265.1|  PREDICTED: copper amine oxidase 1-like isofo...    407   6e-135   Populus euphratica
ref|XP_008464519.1|  PREDICTED: copper amine oxidase 1 isoform X1       409   8e-135   Cucumis melo [Oriental melon]
ref|XP_011045264.1|  PREDICTED: copper amine oxidase 1-like isofo...    408   1e-134   Populus euphratica
gb|KEH20158.1|  copper amine oxidase, enzyme domain protein             406   1e-134   Medicago truncatula
gb|KEH20163.1|  copper amine oxidase, enzyme domain protein             407   2e-134   Medicago truncatula
ref|XP_007153778.1|  hypothetical protein PHAVU_003G064200g             407   2e-134   Phaseolus vulgaris [French bean]
ref|XP_010027284.1|  PREDICTED: copper amine oxidase 1                  408   2e-134   Eucalyptus grandis [rose gum]
ref|XP_010907652.1|  PREDICTED: copper amine oxidase 1                  407   2e-134   Elaeis guineensis
ref|XP_004155025.1|  PREDICTED: copper methylamine oxidase-like         408   2e-134   
gb|KEH20157.1|  copper amine oxidase, enzyme domain protein             408   3e-134   Medicago truncatula
ref|XP_004138093.1|  PREDICTED: copper methylamine oxidase-like         408   3e-134   
gb|KEH20159.1|  copper amine oxidase, enzyme domain protein             407   3e-134   Medicago truncatula
ref|XP_011046219.1|  PREDICTED: copper amine oxidase 1-like             407   3e-134   Populus euphratica
ref|XP_002314600.1|  copper amine oxidase family protein                405   4e-134   Populus trichocarpa [western balsam poplar]
ref|XP_008389732.1|  PREDICTED: copper amine oxidase 1-like isofo...    407   5e-134   Malus domestica [apple tree]
emb|CBI14968.3|  unnamed protein product                                420   9e-134   Vitis vinifera
ref|XP_010506075.1|  PREDICTED: copper amine oxidase 1-like isofo...    406   1e-133   Camelina sativa [gold-of-pleasure]
ref|XP_004501882.1|  PREDICTED: copper methylamine oxidase-like         405   1e-133   Cicer arietinum [garbanzo]
ref|XP_011047814.1|  PREDICTED: copper amine oxidase 1-like isofo...    406   1e-133   Populus euphratica
ref|XP_011047815.1|  PREDICTED: copper amine oxidase 1-like isofo...    405   2e-133   Populus euphratica
emb|CDY14839.1|  BnaC04g48360D                                          405   2e-133   Brassica napus [oilseed rape]
emb|CDY47975.1|  BnaA04g24530D                                          405   2e-133   Brassica napus [oilseed rape]
ref|XP_007158407.1|  hypothetical protein PHAVU_002G150400g             405   2e-133   Phaseolus vulgaris [French bean]
ref|XP_009142070.1|  PREDICTED: LOW QUALITY PROTEIN: copper amine...    405   2e-133   Brassica rapa
ref|XP_002881856.1|  hypothetical protein ARALYDRAFT_903619             405   2e-133   Arabidopsis lyrata subsp. lyrata
ref|XP_009403621.1|  PREDICTED: copper amine oxidase 1-like             405   2e-133   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010682433.1|  PREDICTED: copper amine oxidase 1-like             405   3e-133   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010508564.1|  PREDICTED: copper amine oxidase 1-like             405   4e-133   Camelina sativa [gold-of-pleasure]
ref|XP_006581907.1|  PREDICTED: copper amine oxidase 1-like isofo...    403   4e-133   Glycine max [soybeans]
ref|XP_007158406.1|  hypothetical protein PHAVU_002G150400g             404   4e-133   Phaseolus vulgaris [French bean]
ref|XP_010533488.1|  PREDICTED: copper amine oxidase 1-like             405   5e-133   Tarenaya hassleriana [spider flower]
ref|XP_010517774.1|  PREDICTED: copper amine oxidase 1-like             404   6e-133   Camelina sativa [gold-of-pleasure]
ref|XP_009379966.1|  PREDICTED: copper amine oxidase 1-like             404   7e-133   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_181777.2|  copper amine oxidase family protein                   404   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003527002.1|  PREDICTED: copper amine oxidase 1-like isofo...    403   2e-132   Glycine max [soybeans]
ref|NP_001237782.1|  peroxisomal copper-containing amine oxidase        401   2e-132   
ref|XP_010678857.1|  PREDICTED: copper amine oxidase 1-like isofo...    400   2e-132   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006293724.1|  hypothetical protein CARUB_v10022684mg             402   2e-132   Capsella rubella
ref|XP_009133538.1|  PREDICTED: copper amine oxidase 1-like             402   3e-132   Brassica rapa
gb|KEH27747.1|  copper amine oxidase, enzyme domain protein             400   4e-132   Medicago truncatula
gb|EYU22171.1|  hypothetical protein MIMGU_mgv1a001639mg                402   6e-132   Erythranthe guttata [common monkey flower]
ref|XP_010678856.1|  PREDICTED: copper amine oxidase 1-like isofo...    400   7e-132   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW83296.1|  hypothetical protein EUGRSUZ_B00228                     414   8e-132   Eucalyptus grandis [rose gum]
gb|ACW82416.1|  putative copper amine oxidase                           394   9e-132   Olea europaea
gb|AES96091.2|  copper amine oxidase, enzyme domain protein             399   1e-131   Medicago truncatula
ref|XP_003613133.1|  Copper amine oxidase                               400   2e-131   
gb|KFK37100.1|  hypothetical protein AALP_AA4G213000                    400   2e-131   Arabis alpina [alpine rockcress]
ref|XP_006438286.1|  hypothetical protein CICLE_v10030749mg             400   2e-131   
ref|XP_004489782.1|  PREDICTED: copper methylamine oxidase-like         399   3e-131   Cicer arietinum [garbanzo]
emb|CDY22564.1|  BnaC03g23740D                                          406   1e-130   Brassica napus [oilseed rape]
ref|XP_003601196.1|  Primary amine oxidase                              394   3e-130   
ref|XP_006600619.1|  PREDICTED: copper amine oxidase 1-like isofo...    394   5e-130   Glycine max [soybeans]
emb|CDY35376.1|  BnaA03g19840D                                          404   6e-130   Brassica napus [oilseed rape]
ref|XP_006600618.1|  PREDICTED: copper amine oxidase 1-like isofo...    394   9e-130   Glycine max [soybeans]
ref|XP_006600617.1|  PREDICTED: copper amine oxidase 1-like isofo...    393   2e-129   Glycine max [soybeans]
ref|XP_003550715.1|  PREDICTED: copper amine oxidase 1-like isofo...    393   8e-129   Glycine max [soybeans]
ref|XP_009606421.1|  PREDICTED: copper amine oxidase 1-like             393   1e-128   Nicotiana tomentosiformis
tpg|DAA37329.1|  TPA: hypothetical protein ZEAMMB73_085776              382   2e-128   
gb|EPS66989.1|  hypothetical protein M569_07787                         384   1e-127   Genlisea aurea
ref|XP_009778427.1|  PREDICTED: copper amine oxidase 1-like             390   2e-127   Nicotiana sylvestris
ref|XP_007155469.1|  hypothetical protein PHAVU_003G204000g             401   3e-127   Phaseolus vulgaris [French bean]
ref|XP_009404245.1|  PREDICTED: copper amine oxidase 1-like             389   3e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006351050.1|  PREDICTED: copper amine oxidase 1-like             389   4e-127   
ref|XP_004244763.1|  PREDICTED: copper amine oxidase 1-like             389   8e-127   Solanum lycopersicum
ref|XP_009618867.1|  PREDICTED: copper amine oxidase 1-like isofo...    385   3e-126   Nicotiana tomentosiformis
ref|XP_009618866.1|  PREDICTED: copper amine oxidase 1-like isofo...    385   3e-126   Nicotiana tomentosiformis
ref|XP_009618862.1|  PREDICTED: copper amine oxidase 1-like isofo...    384   2e-125   Nicotiana tomentosiformis
dbj|BAF49520.1|  N-methylputrescine oxidase                             383   7e-125   Nicotiana tabacum [American tobacco]
gb|EMS61925.1|  Copper methylamine oxidase                              382   1e-124   Triticum urartu
ref|XP_002448036.1|  hypothetical protein SORBIDRAFT_06g020020          383   1e-124   Sorghum bicolor [broomcorn]
emb|CAH67316.1|  OSIGBa0106G07.12                                       380   1e-124   Oryza sativa [red rice]
emb|CAE05498.2|  OSJNBa0022H21.18                                       380   2e-124   Oryza sativa Japonica Group [Japonica rice]
gb|EMT09520.1|  Copper methylamine oxidase                              383   2e-124   
ref|XP_008668433.1|  PREDICTED: uncharacterized protein LOC100383...    381   6e-124   
ref|XP_009773282.1|  PREDICTED: copper amine oxidase 1-like             380   9e-124   Nicotiana sylvestris
ref|XP_004975956.1|  PREDICTED: copper amine oxidase 1-like             380   1e-123   Setaria italica
gb|EAY94528.1|  hypothetical protein OsI_16305                          380   1e-123   Oryza sativa Indica Group [Indian rice]
gb|KHN18421.1|  Copper methylamine oxidase                              378   2e-123   Glycine soja [wild soybean]
gb|EAZ31082.1|  hypothetical protein OsJ_15179                          381   3e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652410.1|  PREDICTED: copper amine oxidase 1-like             377   3e-123   
gb|EMS63127.1|  Primary amine oxidase                                   378   4e-123   Triticum urartu
ref|XP_010322539.1|  PREDICTED: copper amine oxidase 1-like             375   7e-122   Solanum lycopersicum
gb|AAD23730.1|  putative copper amine oxidase                           375   9e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006347431.1|  PREDICTED: copper amine oxidase 1-like             374   2e-121   Solanum tuberosum [potatoes]
ref|XP_003581353.1|  PREDICTED: copper amine oxidase 1-like             374   3e-121   Brachypodium distachyon [annual false brome]
ref|XP_001759255.1|  predicted protein                                  371   1e-120   
ref|XP_001757203.1|  predicted protein                                  366   8e-119   
gb|ABR16250.1|  unknown                                                 365   9e-118   Picea sitchensis
ref|XP_010251089.1|  PREDICTED: copper amine oxidase 1-like isofo...    361   2e-116   Nelumbo nucifera [Indian lotus]
gb|EEC76708.1|  hypothetical protein OsI_14715                          351   6e-113   Oryza sativa Indica Group [Indian rice]
emb|CAE02362.2|  OSJNBb0016B03.15                                       351   3e-112   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ29581.1|  hypothetical protein OsJ_13655                          351   4e-112   Oryza sativa Japonica Group [Japonica rice]
emb|CDP13212.1|  unnamed protein product                                338   1e-111   Coffea canephora [robusta coffee]
ref|XP_001774529.1|  predicted protein                                  330   4e-105   
ref|XP_002977869.1|  hypothetical protein SELMODRAFT_443642             328   2e-103   Selaginella moellendorffii
ref|XP_001753509.1|  predicted protein                                  319   4e-101   
ref|XP_002979456.1|  hypothetical protein SELMODRAFT_153358             314   3e-99    
ref|XP_002462763.1|  hypothetical protein SORBIDRAFT_02g031550          296   9e-93    
ref|XP_002984811.1|  hypothetical protein SELMODRAFT_121227             216   1e-61    
ref|XP_002985875.1|  hypothetical protein SELMODRAFT_123165             213   2e-60    
gb|EEC73513.1|  hypothetical protein OsI_07883                          194   8e-55    Oryza sativa Indica Group [Indian rice]
gb|EEE57286.1|  hypothetical protein OsJ_07344                          195   3e-54    Oryza sativa Japonica Group [Japonica rice]
gb|AES71447.2|  copper amine oxidase, enzyme domain protein             181   1e-49    Medicago truncatula
gb|AFK35388.1|  unknown                                                 142   2e-38    Lotus japonicus
dbj|BAJ87935.1|  predicted protein                                      133   1e-32    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001053078.1|  Os04g0476100                                       122   8e-29    
ref|WP_013678400.1|  tyramine oxidase                                   122   2e-28    Pseudonocardia dioxanivorans
ref|WP_006456034.1|  tyramine oxidase                                   122   4e-28    Synechococcus sp. PCC 7335
ref|WP_036480875.1|  tyramine oxidase                                   120   1e-27    
ref|WP_035986372.1|  tyramine oxidase                                   118   6e-27    Leptolyngbya sp. KIOST-1
emb|CEG30995.1|  Primary amine oxidase precursor                        118   8e-27    Bacillus simplex
ref|WP_034315126.1|  tyramine oxidase                                   118   8e-27    Bacillus simplex
ref|WP_007513287.1|  tyramine oxidase                                   118   9e-27    Frankia
ref|WP_037040542.1|  tyramine oxidase                                   117   2e-26    Pseudonocardia autotrophica
gb|AJP05492.1|  tyramine oxidase                                        117   2e-26    Streptomyces cyaneogriseus subsp. noncyanogenus
ref|WP_044379234.1|  tyramine oxidase                                   117   2e-26    Streptomyces cyaneogriseus
ref|WP_006520181.1|  Cu2+-containing amine oxidase                      117   2e-26    Leptolyngbya sp. PCC 7375
ref|WP_015595580.1|  tyramine oxidase                                   116   3e-26    Bacillus sp. 1NLA3E
ref|WP_035740546.1|  tyramine oxidase                                   116   3e-26    
ref|WP_041797277.1|  tyramine oxidase                                   116   4e-26    
emb|CCH89603.1|  Primary amine oxidase                                  116   4e-26    Modestobacter marinus
ref|WP_007920030.1|  tyramine oxidase                                   115   1e-25    Ktedonobacter racemifer
ref|WP_015186652.1|  Copper amine oxidase domain-containing protein     114   1e-25    Gloeocapsa sp. PCC 7428
ref|WP_017299862.1|  tyramine oxidase                                   114   2e-25    Nodosilinea nodulosa
ref|WP_041436864.1|  tyramine oxidase                                   114   3e-25    
gb|ABD03718.1|  putative copper methylamine oxidase                     114   3e-25    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_028065493.1|  tyramine oxidase                                   113   4e-25    Solirubrobacter soli
ref|WP_014740127.1|  tyramine oxidase                                   112   7e-25    Modestobacter marinus
ref|WP_037709039.1|  tyramine oxidase                                   112   7e-25    Streptomyces mirabilis
ref|WP_033187870.1|  tyramine oxidase                                   112   8e-25    Rhodococcus
ref|WP_028390396.1|  tyramine oxidase                                   112   9e-25    Bacillus cihuensis
ref|WP_037182195.1|  tyramine oxidase                                   112   1e-24    Rhodococcus fascians
ref|WP_008314860.1|  Cu2+-containing amine oxidase                      112   1e-24    Leptolyngbya sp. PCC 6406
ref|WP_026844103.1|  tyramine oxidase                                   111   2e-24    Geodermatophilaceae bacterium URHA0031
ref|WP_012873420.1|  tyramine oxidase                                   111   2e-24    Sphaerobacter thermophilus
ref|WP_037408872.1|  tyramine oxidase                                   111   2e-24    Solirubrobacter sp. URHD0082
ref|WP_013421977.1|  tyramine oxidase                                   111   3e-24    Frankia inefficax
ref|WP_003350826.1|  tyramine oxidase                                   110   3e-24    Bacillus methanolicus
ref|WP_009075996.1|  tyramine oxidase                                   110   3e-24    Actinobacteria
ref|WP_036531589.1|  tyramine oxidase                                   110   3e-24    Neosynechococcus sphagnicola
ref|WP_028921142.1|  tyramine oxidase                                   110   4e-24    Pseudonocardia acaciae
ref|WP_035752309.1|  tyramine oxidase                                   110   5e-24    Frankia discariae
ref|WP_014677218.1|  tyramine oxidase                                   110   5e-24    Streptomyces hygroscopicus
ref|WP_015493445.1|  tyramine oxidase                                   110   7e-24    Streptomyces hygroscopicus
ref|WP_027416719.1|  tyramine oxidase                                   109   8e-24    Aneurinibacillus terranovensis
ref|WP_036002001.1|  tyramine oxidase                                   109   8e-24    [Leptolyngbya] sp. JSC-1
ref|WP_030340720.1|  tyramine oxidase                                   109   9e-24    Streptomyces sp. NRRL S-1022
ref|WP_020464622.1|  tyramine oxidase                                   108   1e-23    Frankia sp. EAN1pec
ref|WP_033288996.1|  tyramine oxidase                                   108   2e-23    Amycolatopsis jejuensis
ref|WP_034299883.1|  tyramine oxidase                                   105   3e-23    
gb|EFC82890.1|  Primary-amine oxidase                                   108   3e-23    Frankia sp. EUN1f
ref|WP_011430198.1|  tyramine oxidase                                   108   3e-23    
ref|WP_035952394.1|  tyramine oxidase                                   107   4e-23    
ref|WP_037709969.1|  tyramine oxidase                                   107   5e-23    Streptomyces mirabilis
ref|WP_032395037.1|  tyramine oxidase                                   107   5e-23    Rhodococcus
ref|WP_042206338.1|  tyramine oxidase                                   107   5e-23    Paenibacillus durus
ref|WP_016205391.1|  tyramine oxidase                                   107   6e-23    Bacillus nealsonii
ref|WP_020471082.1|  hypothetical protein                               106   1e-22    Zavarzinella formosa
ref|WP_036725089.1|  tyramine oxidase                                   106   1e-22    Paenibacillus forsythiae
ref|WP_034284434.1|  tyramine oxidase                                   105   2e-22    Bacillus sp. 72
gb|AHY48354.1|  Cu2+-containing amine oxidase                           105   2e-22    Rubrobacter radiotolerans
ref|WP_041339143.1|  tyramine oxidase                                   105   2e-22    Rubrobacter radiotolerans
ref|WP_018395580.1|  hypothetical protein                               104   4e-22    Bacillus sp. 37MA
ref|WP_028063099.1|  tyramine oxidase                                   104   4e-22    Solirubrobacter soli
ref|WP_034290510.1|  tyramine oxidase                                   104   5e-22    Bacillus sp. 72
ref|WP_034285194.1|  tyramine oxidase                                   104   5e-22    Bacillus sp. 72
ref|WP_015124381.1|  Cu2+-containing amine oxidase                      103   1e-21    Synechococcus sp. PCC 6312
ref|WP_012627324.1|  tyramine oxidase                                   102   2e-21    Cyanothece sp. PCC 7425
gb|AIA11506.1|  Copper amine oxidase, enzyme domain protein           99.0    4e-21    uncultured bacterium
ref|WP_018393282.1|  hypothetical protein                               101   6e-21    Bacillus sp. 37MA
ref|WP_039728302.1|  MULTISPECIES: tyramine oxidase                     100   1e-20    Lyngbya confervoides
ref|WP_009633550.1|  Cu2+-containing amine oxidase                    99.4    3e-20    Synechocystis sp. PCC 7509
ref|WP_008317043.1|  Cu2+-containing amine oxidase                    99.4    3e-20    Leptolyngbya sp. PCC 6406
gb|ETX01517.1|  hypothetical protein ETSY2_37110                      97.1    3e-20    Candidatus Entotheonella gemina
ref|WP_037411516.1|  tyramine oxidase                                 97.8    1e-19    Solirubrobacter sp. URHD0082
ref|WP_034266611.1|  tyramine oxidase                                 96.7    2e-19    Bacillus sp. Aph1
ref|WP_003886981.1|  tyramine oxidase                                 96.3    3e-19    Mycolicibacterium phlei
ref|WP_027094208.1|  tyramine oxidase                                 96.3    3e-19    Cohnella thermotolerans
ref|WP_028074137.1|  tyramine oxidase                                 95.9    5e-19    
ref|WP_044495547.1|  tyramine oxidase                                 95.9    5e-19    Nesterenkonia massiliensis
ref|WP_018330660.1|  hypothetical protein                             94.7    1e-18    Actinomycetospora chiangmaiensis
ref|WP_015306289.1|  Cu2+-containing amine oxidase                    94.4    2e-18    Mycobacterium sp. JS623
ref|WP_040585154.1|  tyramine oxidase                                 94.0    2e-18    
ref|WP_028930454.1|  tyramine oxidase                                 94.0    2e-18    Pseudonocardia asaccharolytica
gb|EFV13028.1|  hypothetical protein HMPREF9336_02132                 94.0    3e-18    Segniliparus rugosus ATCC BAA-974
ref|WP_011559399.1|  MULTISPECIES: tyramine oxidase                   94.0    3e-18    Mycobacteriaceae
ref|WP_006066801.1|  tyramine oxidase                                 94.0    3e-18    Natronorubrum bangense
ref|WP_029114804.1|  tyramine oxidase                                 92.8    5e-18    
ref|WP_003928563.1|  tyramine oxidase                                 92.8    5e-18    
ref|WP_015845121.1|  tyramine oxidase                                 92.8    6e-18    
ref|WP_036338983.1|  tyramine oxidase                                 92.4    7e-18    
ref|WP_014842902.1|  tyramine oxidase                                 92.0    9e-18    
dbj|BAD95322.1|  putative copper amine oxidase                        91.3    9e-18    
gb|EHB45308.1|  Copper amine oxidase domain-containing protein        92.0    9e-18    
ref|WP_036425228.1|  tyramine oxidase                                 92.0    1e-17    
ref|WP_011947803.1|  tyramine oxidase                                 91.7    1e-17    
ref|WP_015320499.1|  Cu2+-containing amine oxidase                    92.0    1e-17    
dbj|GAN31310.1|  histamine oxidase                                    91.7    1e-17    
ref|WP_042234339.1|  tyramine oxidase                                 91.7    1e-17    
ref|WP_040146980.1|  tyramine oxidase                                 91.7    1e-17    
ref|WP_015443894.1|  tyramine oxidase                                 91.7    1e-17    
ref|WP_027224502.1|  tyramine oxidase                                 91.7    1e-17    
ref|WP_014844950.1|  tyramine oxidase                                 91.7    1e-17    
ref|WP_027266050.1|  tyramine oxidase                                 91.3    2e-17    
ref|WP_029111263.1|  MULTISPECIES: tyramine oxidase                   91.3    2e-17    
ref|WP_042755246.1|  tyramine oxidase                                 90.9    2e-17    
ref|WP_040148117.1|  tyramine oxidase                                 90.9    2e-17    
ref|WP_019347095.1|  tyramine oxidase                                 90.9    3e-17    
ref|WP_036388186.1|  tyramine oxidase                                 90.9    3e-17    
ref|WP_003797568.1|  copper-containing amine oxidase                  86.3    3e-17    
ref|WP_027267970.1|  tyramine oxidase                                 90.5    3e-17    
ref|WP_036402958.1|  tyramine oxidase                                 90.5    3e-17    
ref|WP_027225442.1|  tyramine oxidase                                 90.5    3e-17    
ref|WP_003802987.1|  copper-containing amine oxidase                  87.4    4e-17    
ref|WP_036584415.1|  tyramine oxidase                                 90.1    4e-17    
ref|WP_011728405.1|  tyramine oxidase                                 90.1    4e-17    
ref|WP_024452988.1|  tyramine oxidase                                 90.1    4e-17    
ref|WP_014877416.1|  tyramine oxidase                                 90.1    5e-17    
ref|WP_006066345.1|  tyramine oxidase                                 89.7    6e-17    
ref|WP_027223028.1|  tyramine oxidase                                 89.4    7e-17    
ref|WP_026556533.1|  tyramine oxidase                                 89.4    7e-17    
ref|WP_026556508.1|  tyramine oxidase                                 89.4    7e-17    
ref|WP_043407669.1|  tyramine oxidase                                 89.4    8e-17    
ref|WP_010948595.1|  tyramine oxidase                                 89.0    9e-17    
ref|WP_028379539.1|  tyramine oxidase                                 89.0    9e-17    
ref|WP_023961376.1|  tyramine oxidase                                 89.0    1e-16    
ref|WP_014327020.1|  tyramine oxidase                                 89.0    1e-16    
ref|WP_027228688.1|  tyramine oxidase                                 89.0    1e-16    
ref|WP_011894974.1|  tyramine oxidase                                 89.0    1e-16    
ref|WP_013472108.1|  tyramine oxidase                                 88.6    1e-16    
ref|WP_015320488.1|  Cu2+-containing amine oxidase                    88.6    1e-16    
ref|XP_008373307.1|  PREDICTED: uncharacterized protein LOC103436643  86.7    2e-16    
ref|WP_024447063.1|  tyramine oxidase                                 88.2    2e-16    
ref|WP_027555623.1|  tyramine oxidase                                 88.2    2e-16    
ref|WP_029372023.1|  tyramine oxidase                                 87.8    2e-16    
ref|WP_036445353.1|  tyramine oxidase                                 87.8    2e-16    
ref|WP_005169442.1|  putative copper-containing amine oxidase         87.8    2e-16    
ref|WP_036436783.1|  tyramine oxidase                                 87.8    3e-16    
ref|WP_007237406.1|  tyramine oxidase                                 87.4    3e-16    
gb|ABM07053.1|  copper methylamine oxidase                            87.0    5e-16    
ref|WP_043806534.1|  tyramine oxidase                                 87.0    5e-16    
ref|WP_011779445.1|  tyramine oxidase                                 86.7    6e-16    
dbj|GAB38625.1|  putative copper-containing amine oxidase             86.7    6e-16    
ref|WP_039855116.1|  tyramine oxidase                                 86.7    6e-16    
ref|WP_003893887.1|  primary amine oxidase                            86.7    7e-16    
ref|WP_036373417.1|  tyramine oxidase                                 86.7    7e-16    
ref|WP_011320170.1|  tyramine oxidase                                 86.3    9e-16    
ref|WP_033335673.1|  MULTISPECIES: tyramine oxidase                   86.3    9e-16    
ref|WP_010997581.1|  tyramine oxidase                                 85.9    1e-15    
ref|WP_015140710.1|  Cu2+-containing amine oxidase                    85.9    1e-15    
ref|WP_036439296.1|  tyramine oxidase                                 85.5    2e-15    
ref|WP_030135462.1|  tyramine oxidase                                 85.1    2e-15    
ref|WP_036460719.1|  tyramine oxidase                                 84.7    2e-15    
ref|WP_035743334.1|  tyramine oxidase                                 84.7    3e-15    
ref|WP_024819190.1|  tyramine oxidase                                 84.7    3e-15    
ref|WP_043457655.1|  tyramine oxidase                                 84.7    3e-15    
gb|EHN12772.1|  Monoamine oxidase                                     84.3    3e-15    
ref|WP_040597665.1|  tyramine oxidase                                 84.3    3e-15    
ref|WP_002777798.1|  tyramine oxidase                                 84.3    4e-15    
ref|WP_024445852.1|  tyramine oxidase                                 84.3    4e-15    
ref|WP_019512690.1|  MULTISPECIES: tyramine oxidase                   84.0    4e-15    
ref|WP_015750044.1|  tyramine oxidase                                 83.6    6e-15    
ref|WP_039398115.1|  tyramine oxidase                                 83.6    7e-15    
ref|WP_007296131.1|  MULTISPECIES: tyramine oxidase                   83.2    8e-15    
ref|WP_015410443.1|  amine oxidase (copper-containing)                83.2    9e-15    
ref|WP_020107838.1|  tyramine oxidase                                 83.2    1e-14    
ref|WP_035836386.1|  tyramine oxidase                                 82.8    1e-14    
ref|WP_005238602.1|  tyramine oxidase                                 82.8    1e-14    
sp|Q07123.1|AMO2_ARTS1  RecName: Full=Copper methylamine oxidase;...  82.8    1e-14    
sp|Q07121.1|AMO1_ARTS1  RecName: Full=Primary amine oxidase; AltN...  82.8    1e-14    
ref|WP_008973262.1|  tyramine oxidase                                 82.4    1e-14    
ref|WP_029366519.1|  tyramine oxidase                                 82.4    1e-14    
ref|WP_007318832.1|  tyramine oxidase                                 82.4    2e-14    
ref|WP_032386166.1|  tyramine oxidase                                 82.0    2e-14    
ref|WP_035366593.1|  tyramine oxidase                                 82.0    2e-14    
tpg|DAA38993.1|  TPA: hypothetical protein ZEAMMB73_259422            82.0    2e-14    
dbj|GAB31994.1|  tyramine oxidase                                     82.0    2e-14    
ref|WP_005191609.1|  tyramine oxidase                                 82.0    2e-14    
ref|WP_040543045.1|  tyramine oxidase                                 82.0    2e-14    
gb|EJZ07229.1|  tyramine oxidase                                      82.0    2e-14    
ref|WP_035876567.1|  tyramine oxidase                                 81.6    3e-14    
ref|WP_007694497.1|  tyramine oxidase                                 81.6    3e-14    
tpg|DAA54053.1|  TPA: hypothetical protein ZEAMMB73_166749            81.6    3e-14    
ref|WP_043986614.1|  tyramine oxidase                                 81.6    3e-14    
gb|AFW81556.1|  hypothetical protein ZEAMMB73_911260                  81.6    3e-14    
ref|WP_012714637.1|  tyramine oxidase                                 81.6    3e-14    
ref|WP_043393180.1|  tyramine oxidase                                 81.6    3e-14    
ref|WP_032389031.1|  tyramine oxidase                                 81.6    3e-14    
ref|WP_019087952.1|  tyramine oxidase                                 81.6    3e-14    
ref|WP_010612233.1|  tyramine oxidase                                 81.6    3e-14    
ref|WP_044828662.1|  tyramine oxidase                                 81.3    4e-14    
ref|WP_032381224.1|  tyramine oxidase                                 81.3    4e-14    
gb|AFW68697.1|  hypothetical protein ZEAMMB73_853376                  81.6    4e-14    
ref|WP_043076768.1|  tyramine oxidase                                 81.3    4e-14    
ref|WP_032399566.1|  tyramine oxidase                                 81.3    4e-14    
ref|WP_007301176.1|  tyramine oxidase                                 81.3    4e-14    
ref|WP_032390633.1|  tyramine oxidase                                 81.3    4e-14    
ref|WP_032373726.1|  tyramine oxidase                                 81.3    4e-14    
ref|WP_032369800.1|  tyramine oxidase                                 81.3    4e-14    
ref|WP_032406493.1|  tyramine oxidase                                 81.3    4e-14    
ref|WP_032365170.1|  tyramine oxidase                                 81.3    4e-14    
ref|WP_032393832.1|  tyramine oxidase                                 80.9    5e-14    
ref|WP_005259938.1|  tyramine oxidase                                 80.9    5e-14    
ref|WP_005571846.1|  tyramine oxidase                                 80.9    5e-14    
ref|WP_008199128.1|  tyramine oxidase                                 80.9    5e-14    
ref|WP_036437637.1|  tyramine oxidase                                 80.5    7e-14    
ref|WP_002784723.1|  Copper amine oxidase                             80.5    7e-14    
ref|WP_036425730.1|  tyramine oxidase                                 80.5    7e-14    
ref|WP_043427296.1|  tyramine oxidase                                 80.1    8e-14    
ref|WP_015889407.1|  tyramine oxidase                                 80.5    8e-14    
ref|WP_044440289.1|  tyramine oxidase                                 80.1    9e-14    
ref|WP_002751868.1|  tyramine oxidase                                 80.1    9e-14    
ref|WP_004517446.1|  tyramine oxidase                                 80.1    1e-13    
ref|WP_030096283.1|  tyramine oxidase                                 80.1    1e-13    
ref|WP_027498410.1|  tyramine oxidase                                 79.7    1e-13    
ref|WP_016887993.1|  tyramine oxidase                                 79.7    1e-13    
ref|WP_005078059.1|  tyramine oxidase                                 79.7    1e-13    
ref|WP_020943896.1|  tyramine oxidase                                 79.7    1e-13    
ref|WP_003626308.1|  tyramine oxidase                                 79.7    1e-13    
ref|WP_016883509.1|  tyramine oxidase                                 79.3    1e-13    
ref|WP_009478859.1|  tyramine oxidase                                 79.3    1e-13    
ref|WP_011597752.1|  tyramine oxidase                                 79.3    1e-13    
ref|WP_029080543.1|  tyramine oxidase                                 79.3    2e-13    
ref|WP_027134242.1|  tyramine oxidase                                 79.3    2e-13    
ref|XP_005538693.1|  copper-containing amine oxidase                  79.0    2e-13    
ref|WP_032401820.1|  tyramine oxidase                                 79.3    2e-13    
ref|XP_005539081.1|  copper-containing amine oxidase                  79.0    2e-13    
gb|AFW60931.1|  hypothetical protein ZEAMMB73_430606                  75.1    2e-13    
ref|WP_037243707.1|  tyramine oxidase                                 79.0    2e-13    
ref|WP_040631916.1|  tyramine oxidase                                 79.0    2e-13    
ref|WP_015211381.1|  Cu2+-containing amine oxidase                    79.0    2e-13    
gb|AII05461.1|  tyramine oxidase                                      79.0    2e-13    
gb|EIU36968.1|  primary amine oxidase                                 79.0    2e-13    
ref|WP_027502287.1|  tyramine oxidase                                 79.0    2e-13    
ref|WP_032667800.1|  MULTISPECIES: tyramine oxidase                   79.0    2e-13    
gb|EIT90308.1|  primary amine oxidase                                 79.0    2e-13    
ref|WP_017206871.1|  tyramine oxidase                                 79.0    2e-13    
ref|WP_005085810.1|  MULTISPECIES: tyramine oxidase                   79.0    2e-13    
ref|XP_005703912.1|  primary-amine oxidase                            79.0    3e-13    
ref|WP_016730365.1|  tyramine oxidase                                 79.0    3e-13    
ref|WP_005071338.1|  tyramine oxidase                                 78.6    3e-13    
ref|WP_041927743.1|  tyramine oxidase                                 78.6    3e-13    
gb|AGM30841.1|  primary amine oxidase                                 78.6    3e-13    
ref|WP_005062361.1|  tyramine oxidase                                 78.6    3e-13    
ref|WP_044413120.1|  tyramine oxidase                                 78.6    3e-13    
ref|WP_014513326.1|  tyramine oxidase                                 78.6    3e-13    
ref|WP_016890445.1|  tyramine oxidase                                 78.6    3e-13    
gb|EIU09568.1|  primary amine oxidase                                 78.6    3e-13    
ref|XP_005536208.1|  copper-containing amine oxidase                  78.6    3e-13    
gb|EIU63940.1|  primary amine oxidase                                 78.6    3e-13    
ref|WP_011777249.1|  tyramine oxidase                                 78.2    4e-13    
gb|KJC53756.1|  tyramine oxidase                                      78.2    4e-13    
ref|WP_037186852.1|  tyramine oxidase                                 78.2    4e-13    
gb|AFW70760.1|  hypothetical protein ZEAMMB73_537196                  74.7    5e-13    
ref|WP_024517386.1|  tyramine oxidase                                 77.8    6e-13    
ref|WP_014359033.1|  tyramine oxidase                                 77.4    6e-13    
ref|WP_027581038.1|  tyramine oxidase                                 77.4    7e-13    
ref|WP_006372687.1|  tyramine oxidase                                 77.4    8e-13    
ref|WP_035658970.1|  tyramine oxidase                                 77.4    8e-13    
ref|WP_032380327.1|  tyramine oxidase                                 77.4    8e-13    
ref|WP_020172256.1|  tyramine oxidase                                 77.4    8e-13    
emb|CCE02694.1|  Histamine oxidase (Copper amine oxidase)             77.4    8e-13    
ref|WP_007435468.1|  tyramine oxidase                                 77.0    8e-13    
gb|EJZ30335.1|  tyramine oxidase                                      77.0    9e-13    
ref|WP_009990204.1|  tyramine oxidase                                 77.0    9e-13    
gb|KJC37663.1|  tyramine oxidase                                      77.0    1e-12    
ref|XP_010463052.1|  PREDICTED: primary amine oxidase-like            74.3    1e-12    
ref|WP_027331473.1|  tyramine oxidase                                 76.6    1e-12    
ref|WP_036335313.1|  tyramine oxidase                                 76.6    1e-12    
ref|WP_044523924.1|  tyramine oxidase                                 76.6    1e-12    
ref|WP_024341794.1|  tyramine oxidase                                 76.6    1e-12    
gb|ETZ91318.1|  primary amine oxidase                                 76.3    2e-12    
ref|WP_012935344.1|  tyramine oxidase                                 76.3    2e-12    
ref|WP_029644043.1|  tyramine oxidase                                 76.3    2e-12    
ref|WP_005556120.1|  tyramine oxidase                                 76.3    2e-12    
ref|WP_015217010.1|  Copper amine oxidase domain-containing protein   76.3    2e-12    
ref|WP_008713557.1|  Amine oxidase (Copper-containing)                76.3    2e-12    
ref|WP_044523999.1|  tyramine oxidase                                 75.9    2e-12    
ref|WP_014746858.1|  tyramine oxidase                                 75.9    2e-12    
ref|XP_010649890.1|  PREDICTED: primary amine oxidase isoform X2      75.9    2e-12    
ref|XP_002278327.1|  PREDICTED: primary amine oxidase isoform X1      75.9    2e-12    
ref|WP_037171914.1|  tyramine oxidase                                 75.5    3e-12    
ref|WP_029118473.1|  tyramine oxidase                                 75.5    3e-12    
ref|WP_007573172.1|  Monoamine oxidase                                75.5    3e-12    
ref|WP_038957242.1|  tyramine oxidase                                 75.5    3e-12    
ref|WP_030729837.1|  hypothetical protein                             75.5    3e-12    
ref|WP_015687025.1|  tyramine oxidase                                 75.5    3e-12    
ref|WP_028158892.1|  tyramine oxidase                                 75.5    3e-12    
ref|WP_043409861.1|  tyramine oxidase                                 75.5    3e-12    
ref|WP_038839896.1|  tyramine oxidase                                 75.1    4e-12    
ref|WP_036039528.1|  tyramine oxidase                                 75.1    4e-12    
emb|CAN68223.1|  hypothetical protein VITISV_040530                   75.5    4e-12    
ref|WP_035999308.1|  tyramine oxidase                                 75.1    4e-12    
ref|WP_006611730.1|  tyramine oxidase                                 75.1    4e-12    
ref|WP_006090340.1|  tyramine oxidase                                 75.1    4e-12    
ref|WP_014877840.1|  tyramine oxidase                                 75.1    4e-12    
gb|EIU04217.1|  primary amine oxidase                                 74.7    4e-12    
ref|WP_011729366.1|  tyramine oxidase                                 75.1    4e-12    
ref|WP_028147545.1|  tyramine oxidase                                 75.1    5e-12    
ref|WP_039714126.1|  tyramine oxidase                                 75.1    5e-12    
emb|CCD93969.1|  Histamine oxidase (Copper amine oxidase)             74.7    5e-12    
ref|WP_035640937.1|  tyramine oxidase                                 74.7    5e-12    
ref|WP_041751252.1|  tyramine oxidase                                 74.7    5e-12    
ref|WP_036338604.1|  tyramine oxidase                                 74.7    5e-12    
gb|ABQ33365.1|  Histamine oxidase                                     74.7    5e-12    
emb|CAL80135.1|  Histamine oxidase (EC 1.4.3.6) (Copper amine oxi...  74.7    5e-12    
ref|WP_029108895.1|  tyramine oxidase                                 74.7    5e-12    
ref|WP_041757856.1|  tyramine oxidase                                 74.7    5e-12    



>gb|KCW86671.1| hypothetical protein EUGRSUZ_B032972, partial [Eucalyptus grandis]
 gb|KCW86672.1| hypothetical protein EUGRSUZ_B032972, partial [Eucalyptus grandis]
Length=312

 Score =   417 bits (1073),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/222 (90%), Positives = 211/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP K VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  26   RAAGATPEVRDSMRFVEVVLLEPGKQVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARL+VYNK+SNETS WIVELSEVHAVTRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  86   QARLIVYNKRSNETSIWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPPMDAEEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK+FPPFREAMKKRGI D+DLVMVD WC GY+SEADAP+RRLAKPLIFCRTESDCPMEN
Sbjct  146  VVKEFPPFREAMKKRGIEDLDLVMVDPWCAGYHSEADAPNRRLAKPLIFCRTESDCPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  206  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  247



>gb|KJB50260.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=446

 Score =   421 bits (1082),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  175  QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  234

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAP+RRLAKPLIFCRTESDCP+EN
Sbjct  235  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPTRRLAKPLIFCRTESDCPIEN  294

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  295  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  335



>ref|XP_008351782.1| PREDICTED: peroxisomal primary amine oxidase-like [Malus domestica]
Length=570

 Score =   424 bits (1090),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 203/222 (91%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  110  RAAGATPEVRDGMRFVEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPR  169

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  170  RARLVVYNKKSNETSTWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAVEYAECEA  229

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGY+SEAD PS+RLAKPLIFCRTESDCPMEN
Sbjct  230  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADXPSQRLAKPLIFCRTESDCPMEN  289

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+YILVDMQNMVVI+FEDRKLVPLPPADPLRNYTP
Sbjct  290  GYARPVEGIYILVDMQNMVVIKFEDRKLVPLPPADPLRNYTP  331



>gb|KJB50259.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=552

 Score =   420 bits (1080),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  175  QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  234

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAP+RRLAKPLIFCRTESDCP+EN
Sbjct  235  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPTRRLAKPLIFCRTESDCPIEN  294

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  295  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  335



>ref|XP_008221920.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=777

 Score =   426 bits (1095),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 204/222 (92%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV+LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  103  RAAGATPEVRDSMRFVEVALVEPDKHVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPR  162

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  163  QARLVVYNKKSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAMEYAECEA  222

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  223  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEADAPSRRLAKPLIFCRTESDCPMEN  282

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  283  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPPADPLRNYTP  324



>emb|CAN62304.1| hypothetical protein VITISV_023689 [Vitis vinifera]
Length=706

 Score =   424 bits (1089),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 204/222 (92%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  26   RAAGATPEVRDSMRFVEVVLVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVV DVQP MDA EYAECEA
Sbjct  86   QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVADVQPPMDAVEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  146  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  206  GYARPVEGIYVLVDMQNMVVVEFEDRKLVPLPPADPLRNYTP  247



>ref|XP_010646479.1| PREDICTED: copper amine oxidase 1 isoform X2 [Vitis vinifera]
Length=700

 Score =   423 bits (1088),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 204/222 (92%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  26   RAAGATPEVRDSMRFVEVVLVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVV DVQP MDA EYAECEA
Sbjct  86   QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVADVQPPMDAVEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  146  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  206  GYARPVEGIYVLVDMQNMVVVEFEDRKLVPLPPADPLRNYTP  247



>ref|XP_010251088.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nelumbo nucifera]
Length=766

 Score =   424 bits (1090),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 202/222 (91%), Positives = 214/222 (96%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDKNVVALADAYFFPPFQPSLLP++K GPVIPSKLPPR
Sbjct  93   RAAGATPEVRDSMRFIEVVLLEPDKNVVALADAYFFPPFQPSLLPKSKGGPVIPSKLPPR  152

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS W+VELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  153  RARLVVYNKRSNETSIWVVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  212

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPFREAMKKRGI DMDLVMVDAWCVGY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  213  VVKEYPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADAPSRRLAKPLIFCRTESDCPMEN  272

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y++VDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  273  GYARPVEGIYVVVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  314



>ref|XP_002273532.2| PREDICTED: copper amine oxidase 1 isoform X1 [Vitis vinifera]
 emb|CBI23365.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   424 bits (1091),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 204/222 (92%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  100  RAAGATPEVRDSMRFVEVVLVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  159

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVV DVQP MDA EYAECEA
Sbjct  160  QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVADVQPPMDAVEYAECEA  219

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  220  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPMEN  279

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  280  GYARPVEGIYVLVDMQNMVVVEFEDRKLVPLPPADPLRNYTP  321



>ref|XP_007211293.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
 gb|EMJ12492.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
Length=714

 Score =   422 bits (1085),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 200/222 (90%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VV LADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  105  RAAGATPEVRDSMRFVEVVLLEPDKHVVGLADAYFFPPFQPSLLPRTKGGPIIPTKLPPR  164

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS W+VELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  165  RARLVVYNKKSNETSTWVVELSEVHAATRGGHHRGKVISSQVVPDVQPPMDAVEYAECEA  224

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGY+S+ADAPS+RLAKPLIFCRTESDCPMEN
Sbjct  225  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYHSDADAPSQRLAKPLIFCRTESDCPMEN  284

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  285  GYARPVEGIYVLVDMQNMVVVEFEDRKLVPLPPADPLRNYTP  326



>ref|XP_007044780.1| Copper amine oxidase family protein isoform 4 [Theobroma cacao]
 gb|EOY00612.1| Copper amine oxidase family protein isoform 4 [Theobroma cacao]
Length=646

 Score =   420 bits (1079),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  112  RAAGATPEVRDSMRFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPLIPSKLPPR  171

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS W VELSEVHA TRGGHHRGKVISSKVVP+VQP MDA EYAECEA
Sbjct  172  QARLVVYNKRSNETSIWTVELSEVHAATRGGHHRGKVISSKVVPNVQPPMDAMEYAECEA  231

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  232  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSNADAPSRRLAKPLIFCRTESDCPMEN  291

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  292  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  332



>gb|AIS23647.1| amine oxidase 4 [Malus domestica]
Length=788

 Score =   424 bits (1090),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 203/222 (91%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  110  RAAGATPEVRDGMRFVEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPR  169

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  170  RARLVVYNKKSNETSTWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAVEYAECEA  229

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGY+SEAD+PS+RLAKPLIFCRTESDCPMEN
Sbjct  230  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADSPSQRLAKPLIFCRTESDCPMEN  289

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+YILVDMQNMVVI+FEDRKLVPLPPADPLRNYTP
Sbjct  290  GYARPVEGIYILVDMQNMVVIKFEDRKLVPLPPADPLRNYTP  331



>gb|KDP31040.1| hypothetical protein JCGZ_11416 [Jatropha curcas]
Length=787

 Score =   423 bits (1088),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/222 (91%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  109  RAAGATPEVRDSMRFIEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  168

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS WIVELSEVHAVTRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  169  RARLIVYNKKSNETSVWIVELSEVHAVTRGGHHRGKVISSRVVPDVQPPMDAVEYAECEA  228

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFP FREAMKKRGI DM+LVMVDAWCVGY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  229  IVKDFPLFREAMKKRGIEDMELVMVDAWCVGYHSDADAPSRRLAKPLIFCRTESDCPMEN  288

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNM VIEFEDRKLVPLPPADPLRNYTP
Sbjct  289  GYARPVEGIYVLVDMQNMKVIEFEDRKLVPLPPADPLRNYTP  330



>gb|KDO69507.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=735

 Score =   422 bits (1084),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 211/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  97   RAAGPTPEVRDSMRFVEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  156

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELS+VHAVTRGGHHRGKV+SS+VVPD+QP MDA EYA+CEA
Sbjct  157  RARLVVYNKKSNETSIWIVELSQVHAVTRGGHHRGKVVSSRVVPDIQPPMDAEEYAQCEA  216

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK FPPF+EAMKKRGI DMDLVMVDAWCVGYYS+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  217  AVKAFPPFKEAMKKRGIEDMDLVMVDAWCVGYYSDADAPSRRLAKPLIFCRTESDCPMEN  276

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  277  GYARPVEGIYVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  317



>ref|XP_007225246.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
 gb|EMJ26445.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
Length=777

 Score =   422 bits (1085),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 204/222 (92%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV+LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  103  RAAGATPEVRDSMRFVEVALVEPDKHVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPR  162

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNKKSNETS  IVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  163  QARLVVYNKKSNETSICIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  222

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  223  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEADAPSRRLAKPLIFCRTESDCPMEN  282

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  283  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPPADPLRNYTP  324



>ref|XP_010248627.1| PREDICTED: copper amine oxidase 1-like [Nelumbo nucifera]
Length=780

 Score =   422 bits (1086),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 200/222 (90%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L+EPDKNVVALADAYFFPPFQPSLLP+TK GPVIPSKLPPR
Sbjct  107  RAAGATPEVRDGMRFIEVVLLEPDKNVVALADAYFFPPFQPSLLPKTKGGPVIPSKLPPR  166

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS W+VELSEVHA TRGGHHRGKVISS+V+PDVQP MDA EYAECEA
Sbjct  167  RARLVVYNKKSNETSVWVVELSEVHAATRGGHHRGKVISSQVIPDVQPPMDAVEYAECEA  226

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPFREAMKKRGI DMDLVMVDAWC GY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  227  VVKDYPPFREAMKKRGIEDMDLVMVDAWCAGYHSEADAPSRRLAKPLIFCRTESDCPMEN  286

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y++VDMQNMVVI+FEDRKLVPLPPADPLRNYTP
Sbjct  287  GYARPVEGIYVVVDMQNMVVIKFEDRKLVPLPPADPLRNYTP  328



>ref|XP_007044779.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
 gb|EOY00611.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
Length=754

 Score =   421 bits (1083),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  112  RAAGATPEVRDSMRFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPLIPSKLPPR  171

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS W VELSEVHA TRGGHHRGKVISSKVVP+VQP MDA EYAECEA
Sbjct  172  QARLVVYNKRSNETSIWTVELSEVHAATRGGHHRGKVISSKVVPNVQPPMDAMEYAECEA  231

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  232  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSNADAPSRRLAKPLIFCRTESDCPMEN  291

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  292  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  332



>gb|KJB50257.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=775

 Score =   422 bits (1084),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  175  QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  234

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAP+RRLAKPLIFCRTESDCP+EN
Sbjct  235  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPTRRLAKPLIFCRTESDCPIEN  294

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  295  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  335



>ref|XP_009345773.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   422 bits (1085),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 202/222 (91%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  107  RAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPR  166

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  167  RARLVVYNKKSNETSTWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAVEYAECEA  226

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPFREAMKKRGI DMDLVMVDAWCVGY+SEADAP +RLAKPLIFCRTESDCPMEN
Sbjct  227  VVKDYPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADAPRQRLAKPLIFCRTESDCPMEN  286

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+YILVDMQNMVVI+FEDRKLVPLPPADPLRNYTP
Sbjct  287  GYARPVEGIYILVDMQNMVVIKFEDRKLVPLPPADPLRNYTP  328



>gb|KJB50255.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=757

 Score =   421 bits (1082),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  175  QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  234

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAP+RRLAKPLIFCRTESDCP+EN
Sbjct  235  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPTRRLAKPLIFCRTESDCPIEN  294

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  295  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  335



>ref|XP_008380537.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   422 bits (1084),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/222 (91%), Positives = 214/222 (96%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  110  RAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPR  169

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKV+SS+VVPDVQP MDA EYAECEA
Sbjct  170  RARLVVYNKKSNETSTWIVELSEVHAATRGGHHRGKVVSSEVVPDVQPPMDAVEYAECEA  229

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGY+SEAD+PS+RLAKPLIFCRTESDCPMEN
Sbjct  230  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADSPSQRLAKPLIFCRTESDCPMEN  289

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+YILVDMQNM+VI+FEDRKLVPLPPADPLRNYTP
Sbjct  290  GYARPVEGIYILVDMQNMMVIKFEDRKLVPLPPADPLRNYTP  331



>gb|KDP26650.1| hypothetical protein JCGZ_17808 [Jatropha curcas]
Length=669

 Score =   418 bits (1075),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDKNVVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  111  RAAGATPEVRDSMRFVEVVLLEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  170

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  171  KARLVVYNKKSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  230

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK FPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  231  VVKAFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPVEN  290

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNM VIEFEDRKLVPLPPADPLRNYT
Sbjct  291  GYARPVEGIHVLVDMQNMNVIEFEDRKLVPLPPADPLRNYT  331



>ref|XP_008239321.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=784

 Score =   421 bits (1083),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 200/222 (90%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VV LADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  105  RAAGATPEVRDSMRFVEVVLLEPDKHVVGLADAYFFPPFQPSLLPRTKGGPIIPTKLPPR  164

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS W+VELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  165  RARLVVYNKKSNETSTWVVELSEVHAATRGGHHRGKVISSQVVPDVQPPMDAVEYAECEA  224

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGY+S+ADAPS+RLAKPLIFCRTESDCPMEN
Sbjct  225  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYHSDADAPSQRLAKPLIFCRTESDCPMEN  284

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  285  GYARPVEGIYVLVDMQNMVVVEFEDRKLVPLPPADPLRNYTP  326



>gb|KJB50256.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=751

 Score =   421 bits (1081),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  175  QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  234

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAP+RRLAKPLIFCRTESDCP+EN
Sbjct  235  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPTRRLAKPLIFCRTESDCPIEN  294

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  295  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  335



>gb|KDO69506.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=775

 Score =   421 bits (1081),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 211/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  97   RAAGPTPEVRDSMRFVEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  156

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELS+VHAVTRGGHHRGKV+SS+VVPD+QP MDA EYA+CEA
Sbjct  157  RARLVVYNKKSNETSIWIVELSQVHAVTRGGHHRGKVVSSRVVPDIQPPMDAEEYAQCEA  216

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK FPPF+EAMKKRGI DMDLVMVDAWCVGYYS+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  217  AVKAFPPFKEAMKKRGIEDMDLVMVDAWCVGYYSDADAPSRRLAKPLIFCRTESDCPMEN  276

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  277  GYARPVEGIYVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  317



>gb|AGZ20104.1| copper methylamine oxidase-like protein [Camellia sinensis]
Length=751

 Score =   420 bits (1079),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/222 (91%), Positives = 211/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  77   RAAGATPEVRDGMRFIEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPLIPSKLPPR  136

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNKKSNETS WIVELSEVHAVTRGGHHRGKVISSKVVP+VQP MDA EYAECEA
Sbjct  137  QARLVVYNKKSNETSIWIVELSEVHAVTRGGHHRGKVISSKVVPNVQPPMDAVEYAECEA  196

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VKDFPPFREAMK+RGI DMDLVMVD WCVGY+ EADAP+RRLAKPLIFCRTESDCPMEN
Sbjct  197  TVKDFPPFREAMKRRGIEDMDLVMVDPWCVGYHKEADAPNRRLAKPLIFCRTESDCPMEN  256

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  257  GYARPVEGIFVLVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  298



>ref|XP_008367500.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   421 bits (1082),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 202/222 (91%), Positives = 211/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L EPDK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  110  RAAGATPEVRDXMRFVEVVLXEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPR  169

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  170  RARLVVYNKKSNETSTWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAVEYAECEA  229

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGY+SEAD PS+RLAKPLIFCRTESDCPMEN
Sbjct  230  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADXPSQRLAKPLIFCRTESDCPMEN  289

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+YILVDMQNMVVI+FEDRKLVPLPPADPLRNYTP
Sbjct  290  GYARPVEGIYILVDMQNMVVIKFEDRKLVPLPPADPLRNYTP  331



>ref|XP_006584632.1| PREDICTED: peroxisomal copper-containing amine oxidase isoform 
X2 [Glycine max]
Length=611

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  92   RAAGATPEVRDGMRFIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  151

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL EVHA TRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  152  KARLVVYNKKSNETSTWIVELREVHATTRGGHHRGKVISSTVVPDVQPPMDAVEYAECEA  211

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  212  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEADAPSRRLAKPLIFCRTESDCPMEN  271

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYT
Sbjct  272  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPPADPLRNYT  312



>gb|KJB50258.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=779

 Score =   421 bits (1081),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  175  QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  234

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAP+RRLAKPLIFCRTESDCP+EN
Sbjct  235  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPTRRLAKPLIFCRTESDCPIEN  294

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  295  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  335



>ref|XP_009362949.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   421 bits (1081),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/222 (91%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  107  RAAGATPEVRDGMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPR  166

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  167  RARLVVYNKKSNETSTWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAVEYAECEA  226

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPFREAMKKRGI DMDLVMVDAWCVGY+SEADAP +RLAKPLIFCRTESDCPMEN
Sbjct  227  VVKDYPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADAPRQRLAKPLIFCRTESDCPMEN  286

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+YILVDMQNMVVI+FEDRKLVPLPPADPLRNYTP
Sbjct  287  GYARPVEGIYILVDMQNMVVIKFEDRKLVPLPPADPLRNYTP  328



>ref|XP_008782506.1| PREDICTED: peroxisomal primary amine oxidase, partial [Phoenix 
dactylifera]
Length=571

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  97   RAAGATPEVRDSMRFVEVVLLEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  156

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  157  RARLVVYNKQSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAVEYAECEA  216

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK +PPF EAMKKRGI DMDLVMVDAWC GY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  217  VVKGYPPFIEAMKKRGIEDMDLVMVDAWCAGYHSEADAPSRRLAKPLIFCRTESDCPMEN  276

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG++ILVD+QN VVIEFEDRKLVPLPPADPLRNYTP
Sbjct  277  GYARPVEGIHILVDIQNNVVIEFEDRKLVPLPPADPLRNYTP  318



>ref|XP_006476868.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Citrus sinensis]
Length=704

 Score =   418 bits (1074),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 211/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  26   RAAGPTPEVRDSMRFVEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +AR+VVYNKKSNETS WIVELS+VHAVTRGGHHRGKV+SS+VVPD+QP MDA EYA+CEA
Sbjct  86   RARMVVYNKKSNETSIWIVELSQVHAVTRGGHHRGKVVSSRVVPDIQPPMDAEEYAQCEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK FPPF+EAMKKRGI DMDLVMVDAWCVGYYS+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  146  AVKAFPPFKEAMKKRGIEDMDLVMVDAWCVGYYSDADAPSRRLAKPLIFCRTESDCPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  206  GYARPVEGIYVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  246



>gb|KJB50254.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=789

 Score =   421 bits (1081),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  175  QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  234

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAP+RRLAKPLIFCRTESDCP+EN
Sbjct  235  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPTRRLAKPLIFCRTESDCPIEN  294

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  295  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  335



>ref|XP_007044778.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY00610.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=769

 Score =   420 bits (1079),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  112  RAAGATPEVRDSMRFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPLIPSKLPPR  171

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS W VELSEVHA TRGGHHRGKVISSKVVP+VQP MDA EYAECEA
Sbjct  172  QARLVVYNKRSNETSIWTVELSEVHAATRGGHHRGKVISSKVVPNVQPPMDAMEYAECEA  231

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  232  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSNADAPSRRLAKPLIFCRTESDCPMEN  291

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  292  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  332



>ref|XP_004309984.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   420 bits (1079),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 200/222 (90%), Positives = 211/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV+LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  106  RAAGATPEVRDSMRFVEVALVEPDKRVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPR  165

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNKKSNETS W+VELSEVHA TRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  166  QARLVVYNKKSNETSVWVVELSEVHAATRGGHHRGKVISSNVVPDVQPPMDAMEYAECEA  225

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPFR+AMKKRGI D+DLVMVD WC GY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  226  VVKDYPPFRDAMKKRGIEDLDLVMVDPWCTGYHSEADAPSRRLAKPLIFCRTESDCPMEN  285

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  286  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPPADPLRNYTP  327



>ref|XP_006476867.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Citrus sinensis]
Length=775

 Score =   420 bits (1079),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 211/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  97   RAAGPTPEVRDSMRFVEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  156

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +AR+VVYNKKSNETS WIVELS+VHAVTRGGHHRGKV+SS+VVPD+QP MDA EYA+CEA
Sbjct  157  RARMVVYNKKSNETSIWIVELSQVHAVTRGGHHRGKVVSSRVVPDIQPPMDAEEYAQCEA  216

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK FPPF+EAMKKRGI DMDLVMVDAWCVGYYS+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  217  AVKAFPPFKEAMKKRGIEDMDLVMVDAWCVGYYSDADAPSRRLAKPLIFCRTESDCPMEN  276

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  277  GYARPVEGIYVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  317



>gb|AIS23648.1| amine oxidase 5 [Malus domestica]
Length=788

 Score =   420 bits (1080),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 200/222 (90%), Positives = 214/222 (96%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  110  RAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPR  169

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSN+TS WIVELSEVHA TRGGHHRGKV+SS+VVPDVQP MDA EYAECEA
Sbjct  170  RARLVVYNKKSNKTSTWIVELSEVHAATRGGHHRGKVVSSEVVPDVQPPMDAVEYAECEA  229

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGY+SEAD+PS+RLAKPLIFCRTESDCPMEN
Sbjct  230  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADSPSQRLAKPLIFCRTESDCPMEN  289

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+YILVDMQNM+VI+FEDRKLVPLPPADPLRNYTP
Sbjct  290  GYARPVEGIYILVDMQNMMVIKFEDRKLVPLPPADPLRNYTP  331



>gb|AIS23644.1| amine oxidase 1 [Malus domestica]
Length=775

 Score =   419 bits (1078),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 201/222 (91%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV+LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  101  RAAGATPEVRDSMRFVEVALVEPDKRVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  161  QARLVVYNKKSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK+FPPFREAMKKRGI DMDLVMVD WC GY+S ADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  221  VVKNFPPFREAMKKRGIEDMDLVMVDPWCTGYHSGADAPSRRLAKPLIFCRTESDCPLEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+ +LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  281  GYARPVEGIRVLVDMQNMVVLEFEDRKLVPLPPADPLRNYTP  322



>ref|XP_006357609.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=776

 Score =   419 bits (1078),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 198/221 (90%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG+TPEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  101  RAAGSTPEVRDSMRFVEVVLVEPDKSVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +A+L+VYNKKSNETS WIVELS+VHAVTRGGHHRGKVISSKVVPD+QP MDA EYAECEA
Sbjct  161  KAKLIVYNKKSNETSIWIVELSQVHAVTRGGHHRGKVISSKVVPDIQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFR+AMKKRGI DMDLVMVDAWC GY+SEADAP+RRL KPLIFCRTESDCPMEN
Sbjct  221  VVKDFPPFRDAMKKRGIDDMDLVMVDAWCAGYFSEADAPNRRLGKPLIFCRTESDCPMEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG++I+VDMQNMVVIEFEDRK+VPLPPADPLRNYT
Sbjct  281  GYARPVEGIHIVVDMQNMVVIEFEDRKVVPLPPADPLRNYT  321



>gb|KJB15626.1| hypothetical protein B456_002G186900 [Gossypium raimondii]
Length=771

 Score =   419 bits (1077),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  97   RAAGATPEVRDSMRFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  156

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVVP+VQP MDA EYAECEA
Sbjct  157  KARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPNVQPPMDAMEYAECEA  216

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDL+MVD WC GY+S ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  217  VVKDFPPFREAMKKRGIEDMDLLMVDPWCAGYHSSADAPSRRLAKPLIFCRTESDCPMEN  276

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  277  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  317



>ref|XP_008389733.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Malus domestica]
Length=775

 Score =   419 bits (1077),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 201/222 (91%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV+LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  101  RAAGATPEVRDSMRFVEVALVEPDKRVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  161  QARLVVYNKKSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK+FPPFREAMKKRGI DMDLVMVD WC GY+S ADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  221  VVKNFPPFREAMKKRGIEDMDLVMVDPWCTGYHSGADAPSRRLAKPLIFCRTESDCPLEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+ +LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  281  GYARPVEGIRVLVDMQNMVVLEFEDRKLVPLPPADPLRNYTP  322



>gb|KHG02854.1| Copper methylamine oxidase [Gossypium arboreum]
Length=804

 Score =   419 bits (1078),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSL+PRTK GPVIPSKLPPR
Sbjct  114  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLIPRTKGGPVIPSKLPPR  173

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  174  QARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  233

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAP+RRLAKPLIFCRTESDCP+EN
Sbjct  234  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPTRRLAKPLIFCRTESDCPIEN  293

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  294  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  334



>ref|XP_007044777.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY00609.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   419 bits (1077),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  123  RAAGATPEVRDSMRFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPLIPSKLPPR  182

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS W VELSEVHA TRGGHHRGKVISSKVVP+VQP MDA EYAECEA
Sbjct  183  QARLVVYNKRSNETSIWTVELSEVHAATRGGHHRGKVISSKVVPNVQPPMDAMEYAECEA  242

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  243  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSNADAPSRRLAKPLIFCRTESDCPMEN  302

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  303  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  343



>ref|XP_004239124.1| PREDICTED: copper amine oxidase 1 [Solanum lycopersicum]
Length=776

 Score =   418 bits (1075),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG+TPEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  101  RAAGSTPEVRDSMRFVEVVLVEPDKSVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +A+L+VYNKKSNETS WIVELS+VHAVTRGGHHRGKVISSKVVPD+QP MDA EYAECEA
Sbjct  161  KAKLIVYNKKSNETSIWIVELSQVHAVTRGGHHRGKVISSKVVPDIQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFR+AMKKRGI DMDLVMVDAWC GY+S+ADAP+RRL KPLIFCRTESDCPMEN
Sbjct  221  VVKDFPPFRDAMKKRGIDDMDLVMVDAWCAGYFSDADAPNRRLGKPLIFCRTESDCPMEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG++I+VDMQNMVVIEFEDRK+VPLPPADPLRNYT
Sbjct  281  GYARPVEGIHIVVDMQNMVVIEFEDRKVVPLPPADPLRNYT  321



>ref|XP_006411506.1| hypothetical protein EUTSA_v100163160mg, partial [Eutrema salsugineum]
 gb|ESQ52959.1| hypothetical protein EUTSA_v100163160mg, partial [Eutrema salsugineum]
Length=392

 Score =   405 bits (1042),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRDSMRF EV+ VEP+K+VVALADAYFFPPFQPSLLPR K GPVIP KLPPR
Sbjct  101  RAAGANPEVRDSMRFIEVASVEPEKHVVALADAYFFPPFQPSLLPRNKAGPVIPMKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK SNETS WIVELSEVHAVTRGGHHRGKV+SS+V+PDVQP MDAAEYAECEA
Sbjct  161  RARLVVYNKTSNETSVWIVELSEVHAVTRGGHHRGKVVSSQVIPDVQPPMDAAEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  221  IVKDFPPFIEAMKRRGIEDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  281  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  322



>ref|XP_010044582.1| PREDICTED: peroxisomal primary amine oxidase-like [Eucalyptus 
grandis]
Length=796

 Score =   419 bits (1076),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/222 (90%), Positives = 211/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP K VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  113  RAAGATPEVRDSMRFVEVVLLEPGKQVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARL+VYNK+SNETS WIVELSEVHAVTRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  173  QARLIVYNKRSNETSIWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPPMDAEEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK+FPPFREAMKKRGI D+DLVMVD WC GY+SEADAP+RRLAKPLIFCRTESDCPMEN
Sbjct  233  VVKEFPPFREAMKKRGIEDLDLVMVDPWCAGYHSEADAPNRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  293  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  334



>ref|XP_002318664.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
 gb|EEE96884.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
Length=751

 Score =   417 bits (1072),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 198/222 (89%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDSMRF EV L EPDK+VVALADAYFFPPFQPSLLPR+K GP+IP+KLPPR
Sbjct  93   RAAGATPELRDSMRFVEVVLFEPDKHVVALADAYFFPPFQPSLLPRSKGGPIIPTKLPPR  152

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  153  RARLVVYNKRSNETSLWIVELSEVHAATRGGHHRGKVISSQVVPDVQPPMDAVEYAECEA  212

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDL+MVDAWCVGY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  213  VVKDFPPFREAMKKRGIEDMDLLMVDAWCVGYHSDADAPSRRLAKPLIFCRTESDCPMEN  272

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNM VIEFEDRKLVPLPPADPLRNYTP
Sbjct  273  GYARPVEGIHVLVDMQNMRVIEFEDRKLVPLPPADPLRNYTP  314



>ref|XP_010102489.1| Putative primary amine oxidase 2 [Morus notabilis]
 gb|EXB93553.1| Putative primary amine oxidase 2 [Morus notabilis]
Length=708

 Score =   416 bits (1068),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 200/222 (90%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV LVEPDK VVALADAYFFPPFQPSLLPRTK  P IPSKLPPR
Sbjct  109  RAAGATPEVRDGMRFIEVVLVEPDKQVVALADAYFFPPFQPSLLPRTKGAPKIPSKLPPR  168

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNKKSNETS WIV+LSEVHA+TRGGHHRG+VIS+KVVPDVQP MDA EYAECEA
Sbjct  169  QARLVVYNKKSNETSLWIVKLSEVHALTRGGHHRGQVISTKVVPDVQPPMDAVEYAECEA  228

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPF EAMKKRGI DMDLVMVD WCVGY+SEAD+PSRRLAKPLIFCRTESDCPMEN
Sbjct  229  VVKDFPPFIEAMKKRGIEDMDLVMVDPWCVGYHSEADSPSRRLAKPLIFCRTESDCPMEN  288

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  289  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  330



>gb|KJB19703.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=660

 Score =   414 bits (1064),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 198/221 (90%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GPVIP+KLP R
Sbjct  113  RAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKNGPVIPTKLPLR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHAVTRGGHHRGKVISS++VPDVQP MDA EYAECEA
Sbjct  173  RARLVVYNKKSNETSIWIVELSEVHAVTRGGHHRGKVISSQIVPDVQPPMDAMEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+AD+PSRRLAKPLIFCRTESDCPMEN
Sbjct  233  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADSPSRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQ M VIEFEDRK VPLPPADPLRNYT
Sbjct  293  GYARPVEGIYVLVDMQKMKVIEFEDRKFVPLPPADPLRNYT  333



>ref|XP_009600855.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=779

 Score =   417 bits (1073),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = +1

Query  10   GATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQAR  189
            G+TPEVRDSMRF E  LVEPDK+V+ALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+AR
Sbjct  107  GSTPEVRDSMRFVEAVLVEPDKSVIALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRKAR  166

Query  190  LVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVK  369
            L+VYNKKSNETS WIVELSEVHAVTRGGHHRGKVISSKVVPD+QP MDAAEYAECEAVVK
Sbjct  167  LIVYNKKSNETSIWIVELSEVHAVTRGGHHRGKVISSKVVPDIQPPMDAAEYAECEAVVK  226

Query  370  DFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYA  549
            DFPPFR+AMKKRGI DM+LVMVDAWC GY+SEADAP+RRL KPLIFCRTESDCPMENGYA
Sbjct  227  DFPPFRDAMKKRGIDDMELVMVDAWCAGYFSEADAPNRRLGKPLIFCRTESDCPMENGYA  286

Query  550  RPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RPVEG++ILVDMQNMVVIEFEDRK+VPLPPADPLRNYTP
Sbjct  287  RPVEGIHILVDMQNMVVIEFEDRKVVPLPPADPLRNYTP  325



>ref|XP_006439904.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
 gb|ESR53144.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
Length=775

 Score =   417 bits (1072),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRDSMRF EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  97   RAAGPTPEVRDSMRFVEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  156

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELS+VHAVTRGGHHRGKV+SS+VVPD+QP MDA EYA+CEA
Sbjct  157  RARLVVYNKKSNETSIWIVELSQVHAVTRGGHHRGKVVSSRVVPDIQPPMDAEEYAQCEA  216

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK FPPF+EAMKKRGI DMDLVMVDAWCVG YS+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  217  AVKAFPPFKEAMKKRGIEDMDLVMVDAWCVGCYSDADAPSRRLAKPLIFCRTESDCPMEN  276

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  277  GYARPVEGIYVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  317



>gb|KHG02564.1| Primary amine oxidase [Gossypium arboreum]
Length=756

 Score =   416 bits (1068),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  96   RAAGATPEVRDSMRFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  155

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISSKVV +VQP MDA EYAECEA
Sbjct  156  KARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSKVVSNVQPPMDAMEYAECEA  215

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI D+DLVMVD WC GY++ ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  216  VVKDFPPFREAMKKRGIEDLDLVMVDPWCAGYHTNADAPSRRLAKPLIFCRTESDCPMEN  275

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  276  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  316



>ref|XP_010100391.1| Copper methylamine oxidase [Morus notabilis]
 gb|EXB82525.1| Copper methylamine oxidase [Morus notabilis]
Length=841

 Score =   418 bits (1074),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  121  RAAGATPEVRDSMRFVEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  180

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNK+SNETS W+VELS+VHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  181  QARLVVYNKRSNETSIWVVELSQVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  240

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPFREAMKKRGI DMDLVMVD WC GY+S+ADAP RRLAKPLIFCRTESDCPMEN
Sbjct  241  VVKDYPPFREAMKKRGIEDMDLVMVDPWCAGYHSDADAPIRRLAKPLIFCRTESDCPMEN  300

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNM V+EFEDRKLVPLPPADPLRNYTP
Sbjct  301  GYARPVEGIHVLVDMQNMEVLEFEDRKLVPLPPADPLRNYTP  342



>ref|XP_009802912.1| PREDICTED: peroxisomal primary amine oxidase-like [Nicotiana 
sylvestris]
Length=779

 Score =   416 bits (1069),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = +1

Query  10   GATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQAR  189
            G+TPEVRDSMRF E  LVEPDK+V+ALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+AR
Sbjct  107  GSTPEVRDSMRFVEAVLVEPDKSVIALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRKAR  166

Query  190  LVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVK  369
            L+VYNKKSNETS WIVELSEVHAVTRGGHHRGKVISS+VVPD+QP MDAAEYAECEAVVK
Sbjct  167  LIVYNKKSNETSIWIVELSEVHAVTRGGHHRGKVISSQVVPDIQPPMDAAEYAECEAVVK  226

Query  370  DFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYA  549
            DFPPFR+AMKKRGI DM+LVMVDAWC GY+SEADAP+RRL KPLIFCRTESDCPMENGYA
Sbjct  227  DFPPFRDAMKKRGIDDMELVMVDAWCAGYFSEADAPNRRLGKPLIFCRTESDCPMENGYA  286

Query  550  RPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RPVEG++ILVDMQNMVVIEFEDRK+VPLPPADPLRNYTP
Sbjct  287  RPVEGIHILVDMQNMVVIEFEDRKVVPLPPADPLRNYTP  325



>gb|KJB19704.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=743

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/221 (90%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GPVIP+KLP R
Sbjct  113  RAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKNGPVIPTKLPLR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHAVTRGGHHRGKVISS++VPDVQP MDA EYAECEA
Sbjct  173  RARLVVYNKKSNETSIWIVELSEVHAVTRGGHHRGKVISSQIVPDVQPPMDAMEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+AD+PSRRLAKPLIFCRTESDCPMEN
Sbjct  233  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADSPSRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQ M VIEFEDRK VPLPPADPLRNYT
Sbjct  293  GYARPVEGIYVLVDMQKMKVIEFEDRKFVPLPPADPLRNYT  333



>ref|XP_002511334.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF51936.1| copper amine oxidase, putative [Ricinus communis]
Length=797

 Score =   416 bits (1070),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 212/223 (95%), Gaps = 1/223 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKG-PVIPSKLPP  177
            RAAGATPEVRDSMRF EV L+EPDK VVALADAYFFPPFQPSLLPRTK G PVIP+KLPP
Sbjct  118  RAAGATPEVRDSMRFVEVVLLEPDKQVVALADAYFFPPFQPSLLPRTKGGGPVIPTKLPP  177

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            R+ARLVVYNK+SNETS WIVELSEVHAVTRGGHHRGKVISS+V+PDVQP MDA EYAECE
Sbjct  178  RRARLVVYNKRSNETSVWIVELSEVHAVTRGGHHRGKVISSQVIPDVQPPMDAVEYAECE  237

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            AVVKDFPPFREAMKKRGI DM+LVMVDAWCVGY+S ADAPS+RLAKPLIFCRTESDCPME
Sbjct  238  AVVKDFPPFREAMKKRGIDDMELVMVDAWCVGYHSAADAPSKRLAKPLIFCRTESDCPME  297

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            NGYARPVEG+Y+LVDMQNM VIEFEDRKLVPLPPADPLRNYTP
Sbjct  298  NGYARPVEGIYVLVDMQNMKVIEFEDRKLVPLPPADPLRNYTP  340



>gb|KDO82259.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=716

 Score =   414 bits (1063),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV  VEPDK VVALADAYFFPPFQPSL+PRTK GP+IP+KLPPR
Sbjct  101  RAAGATPEVRDSMRFVEVVRVEPDKQVVALADAYFFPPFQPSLIPRTKGGPIIPTKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS W+VELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  161  RARLVVYNKRSNETSIWVVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  221  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPIEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLV LPPADPLRNYT
Sbjct  281  GYARPVEGIHVLVDMQNMVVIEFEDRKLVHLPPADPLRNYT  321



>gb|KHN13432.1| Copper methylamine oxidase [Glycine soja]
Length=738

 Score =   414 bits (1065),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  92   RAAGATPEVRDGMRFIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  151

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL EVHA TRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  152  KARLVVYNKKSNETSTWIVELREVHATTRGGHHRGKVISSTVVPDVQPPMDAVEYAECEA  211

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  212  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEADAPSRRLAKPLIFCRTESDCPMEN  271

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYT
Sbjct  272  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPPADPLRNYT  312



>emb|CDP12746.1| unnamed protein product [Coffea canephora]
Length=773

 Score =   415 bits (1067),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 197/222 (89%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK GP IPSKLPPR
Sbjct  95   RAAGATPEVRDGMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGGPAIPSKLPPR  154

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSN+TS WIV+L+EVHA TRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  155  RARLVVYNKKSNDTSLWIVQLTEVHATTRGGHHRGKVISSAVVPDVQPPMDAVEYAECEA  214

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPF EAMKKRGI DMDLVMVDAWCVGY+SEADAP RRLAKPLIFCRTESDCPMEN
Sbjct  215  VVKDYPPFVEAMKKRGIDDMDLVMVDAWCVGYHSEADAPGRRLAKPLIFCRTESDCPMEN  274

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  275  GYARPVEGIHVLVDMQNMVVVEFEDRKLVPLPPADPLRNYTP  316



>ref|XP_004289862.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   414 bits (1065),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRFAEV L+EPDK+VVALADAYFFPPFQPSLLPRTK G +IPSKLPPR
Sbjct  70   RAAGATPEVRDGMRFAEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGHMIPSKLPPR  129

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK SNETS WIVELSEVHA TRGGHHRG VISS+V+ DVQPSMDA EYAECEA
Sbjct  130  RARLVVYNKMSNETSTWIVELSEVHAATRGGHHRGNVISSQVIHDVQPSMDAVEYAECEA  189

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGY+SEADAPS+RLAKPLIFCRTESDCPMEN
Sbjct  190  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADAPSKRLAKPLIFCRTESDCPMEN  249

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+YILVDMQNM VIEFEDRKLVPLPPADPLRNYT
Sbjct  250  GYARPVEGIYILVDMQNMEVIEFEDRKLVPLPPADPLRNYT  290



>ref|XP_006584631.1| PREDICTED: peroxisomal copper-containing amine oxidase isoform 
X1 [Glycine max]
Length=766

 Score =   415 bits (1066),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  92   RAAGATPEVRDGMRFIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  151

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL EVHA TRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  152  KARLVVYNKKSNETSTWIVELREVHATTRGGHHRGKVISSTVVPDVQPPMDAVEYAECEA  211

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  212  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEADAPSRRLAKPLIFCRTESDCPMEN  271

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYT
Sbjct  272  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPPADPLRNYT  312



>ref|XP_002527922.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF34479.1| copper amine oxidase, putative [Ricinus communis]
Length=795

 Score =   416 bits (1068),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 198/221 (90%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP+KNVVALADAYFFPPFQPSL+PRTK GP+IP+KLPPR
Sbjct  120  RAAGATPEVRDSMRFVEVVLLEPEKNVVALADAYFFPPFQPSLIPRTKGGPLIPTKLPPR  179

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS WIVELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  180  KARLIVYNKKSNETSIWIVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  239

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPF EAMKKRGI DMDLVMVD WC GY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  240  VVKDFPPFLEAMKKRGIEDMDLVMVDPWCSGYHSDADAPSRRLAKPLIFCRTESDCPMEN  299

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  300  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  340



>gb|KDO82258.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=701

 Score =   412 bits (1060),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV  VEPDK VVALADAYFFPPFQPSL+PRTK GP+IP+KLPPR
Sbjct  27   RAAGATPEVRDSMRFVEVVRVEPDKQVVALADAYFFPPFQPSLIPRTKGGPIIPTKLPPR  86

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS W+VELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  87   RARLVVYNKRSNETSIWVVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  146

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  147  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPIEN  206

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLV LPPADPLRNYT
Sbjct  207  GYARPVEGIHVLVDMQNMVVIEFEDRKLVHLPPADPLRNYT  247



>ref|XP_006438284.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51524.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=701

 Score =   412 bits (1059),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV  VEPDK VVALADAYFFPPFQPSL+PRTK GP+IP+KLPPR
Sbjct  27   RAAGATPEVRDSMRFVEVVRVEPDKQVVALADAYFFPPFQPSLIPRTKGGPIIPTKLPPR  86

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS W+VELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  87   RARLVVYNKRSNETSIWVVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  146

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  147  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPIEN  206

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLV LPPADPLRNYT
Sbjct  207  GYARPVEGIHVLVDMQNMVVIEFEDRKLVHLPPADPLRNYT  247



>ref|XP_003519633.1| PREDICTED: copper amine oxidase 1-like [Glycine max]
Length=760

 Score =   413 bits (1062),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  86   RAAGATPEVRDSMRFVEVVLVEPDKQVVALADAYFFPPFQPSLLPRTKGGPLIPTKLPPR  145

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVEL EVHA TRGGHHRGKVISS+VVP+VQP MDA EYAECEA
Sbjct  146  KARLVVYNKRSNETSIWIVELREVHAATRGGHHRGKVISSEVVPNVQPPMDAVEYAECEA  205

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VKDFPPFREAMK+RGI DMDLVMVDAWCVGY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  206  AVKDFPPFREAMKRRGIEDMDLVMVDAWCVGYHSEADAPSRRLAKPLIFCRTESDCPMEN  265

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG++ILVDMQNM ++EFEDRKL+PLPPADPLRNYT
Sbjct  266  GYARPVEGIHILVDMQNMEILEFEDRKLIPLPPADPLRNYT  306



>gb|KHN00390.1| Copper methylamine oxidase [Glycine soja]
Length=770

 Score =   414 bits (1063),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR
Sbjct  86   RAAGATPEVRDSMRFVEVVLVEPDKQVVALADAYFFPPFQPSLLPRTKGGPLIPTKLPPR  145

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVEL EVHA TRGGHHRGKVISS+VVP+VQP MDA EYAECEA
Sbjct  146  KARLVVYNKRSNETSIWIVELREVHAATRGGHHRGKVISSEVVPNVQPPMDAVEYAECEA  205

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VKDFPPFREAMK+RGI DMDLVMVDAWCVGY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  206  AVKDFPPFREAMKRRGIEDMDLVMVDAWCVGYHSEADAPSRRLAKPLIFCRTESDCPMEN  265

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG++ILVDMQNM ++EFEDRKL+PLPPADPLRNYT
Sbjct  266  GYARPVEGIHILVDMQNMEILEFEDRKLIPLPPADPLRNYT  306



>gb|KEH20160.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=568

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD +RF EV LVEP+K VVALADAYFFPPFQPSLLPR K GPVIPSKLPPR
Sbjct  26   RAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFPPFQPSLLPRIKGGPVIPSKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL+EVHA TRGGHHRGKVI+S VVPDVQP MDA EYAECEA
Sbjct  86   KARLVVYNKKSNETSIWIVELTEVHATTRGGHHRGKVITSTVVPDVQPPMDAVEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SE DAPSRRLAKPL FCRTESDCPMEN
Sbjct  146  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEGDAPSRRLAKPLFFCRTESDCPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLP ADPLRNYT
Sbjct  206  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPQADPLRNYT  246



>gb|KJB19706.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
 gb|KJB19707.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=791

 Score =   414 bits (1064),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 198/221 (90%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GPVIP+KLP R
Sbjct  113  RAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKNGPVIPTKLPLR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHAVTRGGHHRGKVISS++VPDVQP MDA EYAECEA
Sbjct  173  RARLVVYNKKSNETSIWIVELSEVHAVTRGGHHRGKVISSQIVPDVQPPMDAMEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+AD+PSRRLAKPLIFCRTESDCPMEN
Sbjct  233  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADSPSRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQ M VIEFEDRK VPLPPADPLRNYT
Sbjct  293  GYARPVEGIYVLVDMQKMKVIEFEDRKFVPLPPADPLRNYT  333



>ref|XP_011071936.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=786

 Score =   414 bits (1064),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLL RTK GP IP KLPPR
Sbjct  107  RAAGATPEVRDSMRFIEVVLLEPDKHVVALADAYFFPPFQPSLLARTKGGPAIPFKLPPR  166

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL+EVHA TRGGHHRGKVISS VVPDVQP MDAAEYAECEA
Sbjct  167  RARLVVYNKKSNETSLWIVELTEVHATTRGGHHRGKVISSNVVPDVQPPMDAAEYAECEA  226

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPF EAMKKRGI DMDLVMVD WCVGY+SEADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  227  VVKDYPPFIEAMKKRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLIFCRTESDCPLEN  286

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  287  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  328



>gb|KJB19705.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=795

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/221 (90%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GPVIP+KLP R
Sbjct  113  RAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKNGPVIPTKLPLR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHAVTRGGHHRGKVISS++VPDVQP MDA EYAECEA
Sbjct  173  RARLVVYNKKSNETSIWIVELSEVHAVTRGGHHRGKVISSQIVPDVQPPMDAMEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+AD+PSRRLAKPLIFCRTESDCPMEN
Sbjct  233  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADSPSRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQ M VIEFEDRK VPLPPADPLRNYT
Sbjct  293  GYARPVEGIYVLVDMQKMKVIEFEDRKFVPLPPADPLRNYT  333



>emb|CAN76391.1| hypothetical protein VITISV_023592 [Vitis vinifera]
Length=790

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L EPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  113  RAAGATPEVRDGMRFVEVVLYEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS WIVELSEVHA TRGGHHRGK I+++VVPD+QP MDA EYAECEA
Sbjct  173  KARLIVYNKKSNETSIWIVELSEVHAATRGGHHRGKAITTQVVPDIQPPMDAVEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD P FREAMKKRG+ DMDLVMVDAWCVGY+ EADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  233  VVKDCPLFREAMKKRGVEDMDLVMVDAWCVGYHGEADAPSRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y++VDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  293  GYARPVEGIYVVVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  334



>ref|XP_010532283.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=789

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/222 (89%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPR+K GPVIP+KLPPR
Sbjct  107  RAAGATPEVRDSMRFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRSKGGPVIPTKLPPR  166

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS W VELSEVHAVTRGGHHRGKV+SS+V+PDVQP MDAAEYAECEA
Sbjct  167  RARLIVYNKKSNETSVWAVELSEVHAVTRGGHHRGKVVSSQVIPDVQPPMDAAEYAECEA  226

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMKKRGI DMDLVMVD WCVGY+SEADAPSRRLAKPLIFCRT+SD PMEN
Sbjct  227  IVKDFPPFIEAMKKRGIADMDLVMVDPWCVGYHSEADAPSRRLAKPLIFCRTDSDSPMEN  286

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  287  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  328



>gb|KDO82257.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=775

 Score =   413 bits (1062),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV  VEPDK VVALADAYFFPPFQPSL+PRTK GP+IP+KLPPR
Sbjct  101  RAAGATPEVRDSMRFVEVVRVEPDKQVVALADAYFFPPFQPSLIPRTKGGPIIPTKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS W+VELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  161  RARLVVYNKRSNETSIWVVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  221  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPIEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLV LPPADPLRNYT
Sbjct  281  GYARPVEGIHVLVDMQNMVVIEFEDRKLVHLPPADPLRNYT  321



>gb|KEH20164.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=619

 Score =   408 bits (1049),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD +RF EV LVEP+K VVALADAYFFPPFQPSLLPR K GPVIPSKLPPR
Sbjct  100  RAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFPPFQPSLLPRIKGGPVIPSKLPPR  159

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL+EVHA TRGGHHRGKVI+S VVPDVQP MDA EYAECEA
Sbjct  160  KARLVVYNKKSNETSIWIVELTEVHATTRGGHHRGKVITSTVVPDVQPPMDAVEYAECEA  219

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SE DAPSRRLAKPL FCRTESDCPMEN
Sbjct  220  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEGDAPSRRLAKPLFFCRTESDCPMEN  279

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLP ADPLRNYT
Sbjct  280  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPQADPLRNYT  320



>ref|XP_006483934.1| PREDICTED: copper amine oxidase 1-like [Citrus sinensis]
Length=775

 Score =   413 bits (1061),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV  VEPDK VVALADAYFFPPFQPSL+PRTK GP+IP+KLPPR
Sbjct  101  RAAGATPEVRDSMRFVEVVRVEPDKQVVALADAYFFPPFQPSLIPRTKGGPIIPTKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS W+VELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  161  RARLVVYNKRSNETSIWVVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  221  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPIEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLV LPPADPLRNYT
Sbjct  281  GYARPVEGIHVLVDMQNMVVIEFEDRKLVHLPPADPLRNYT  321



>ref|XP_006438285.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51525.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=775

 Score =   413 bits (1061),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV  VEPDK VVALADAYFFPPFQPSL+PRTK GP+IP+KLPPR
Sbjct  101  RAAGATPEVRDSMRFVEVVRVEPDKQVVALADAYFFPPFQPSLIPRTKGGPIIPTKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS W+VELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  161  RARLVVYNKRSNETSIWVVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  221  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPIEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLV LPPADPLRNYT
Sbjct  281  GYARPVEGIHVLVDMQNMVVIEFEDRKLVHLPPADPLRNYT  321



>ref|XP_002277961.1| PREDICTED: copper amine oxidase 1-like [Vitis vinifera]
Length=791

 Score =   413 bits (1061),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L EPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  113  RAAGATPEVRDGMRFVEVVLYEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS WIVELSEVHA TRGGHHRGK I+++VVPD+QP MDA EYAECEA
Sbjct  173  KARLIVYNKKSNETSIWIVELSEVHAATRGGHHRGKAITTQVVPDIQPPMDAVEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD P FREAMKKRG+ DMDLVMVDAWCVGY+ EADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  233  VVKDCPLFREAMKKRGVEDMDLVMVDAWCVGYHGEADAPSRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y++VDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  293  GYARPVEGIYVVVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  334



>gb|KEH20162.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=629

 Score =   408 bits (1048),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD +RF EV LVEP+K VVALADAYFFPPFQPSLLPR K GPVIPSKLPPR
Sbjct  87   RAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFPPFQPSLLPRIKGGPVIPSKLPPR  146

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL+EVHA TRGGHHRGKVI+S VVPDVQP MDA EYAECEA
Sbjct  147  KARLVVYNKKSNETSIWIVELTEVHATTRGGHHRGKVITSTVVPDVQPPMDAVEYAECEA  206

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SE DAPSRRLAKPL FCRTESDCPMEN
Sbjct  207  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEGDAPSRRLAKPLFFCRTESDCPMEN  266

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLP ADPLRNYT
Sbjct  267  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPQADPLRNYT  307



>gb|KEH20161.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=642

 Score =   408 bits (1049),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD +RF EV LVEP+K VVALADAYFFPPFQPSLLPR K GPVIPSKLPPR
Sbjct  100  RAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFPPFQPSLLPRIKGGPVIPSKLPPR  159

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL+EVHA TRGGHHRGKVI+S VVPDVQP MDA EYAECEA
Sbjct  160  KARLVVYNKKSNETSIWIVELTEVHATTRGGHHRGKVITSTVVPDVQPPMDAVEYAECEA  219

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SE DAPSRRLAKPL FCRTESDCPMEN
Sbjct  220  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEGDAPSRRLAKPLFFCRTESDCPMEN  279

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLP ADPLRNYT
Sbjct  280  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPQADPLRNYT  320



>gb|KEH35029.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=704

 Score =   410 bits (1054),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPR+K GPVIP+KLPPR
Sbjct  26   RAAGATPELRDSMRFIEVVLLEPDKHVVALADAYFFPPFQPSLLPRSKGGPVIPTKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             ARLVVYNKKSNET+ WIVELS+VHAVTRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  86   CARLVVYNKKSNETTLWIVELSQVHAVTRGGHHRGKVISSNVVPDVQPPMDAEEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK FPPF EAMKKRGI DMDLVMVD WCVGY+SEADAP RRLAKPL+FCR+ESDCPMEN
Sbjct  146  VVKSFPPFIEAMKKRGIEDMDLVMVDPWCVGYHSEADAPGRRLAKPLLFCRSESDCPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRKLVPLPP DPLRNYTP
Sbjct  206  GYARPVEGIYVLVDMQNMVVIEFEDRKLVPLPPVDPLRNYTP  247



>gb|KHG07734.1| Primary amine oxidase [Gossypium arboreum]
Length=777

 Score =   412 bits (1059),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 198/221 (90%), Positives = 208/221 (94%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GPVI +KLP R
Sbjct  113  RAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKNGPVISTKLPLR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHAVTRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  173  RARLVVYNKKSNETSIWIVELSEVHAVTRGGHHRGKVISSQVVPDVQPPMDAMEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WCVGY+S+AD+PSRRLAKPLIFCRTESDCPMEN
Sbjct  233  VVKDFPPFREAMKKRGIEDMDLVMVDPWCVGYHSDADSPSRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQ M VIEFEDRK VPLPPADPLRNYT
Sbjct  293  GYARPVEGIYVLVDMQKMKVIEFEDRKFVPLPPADPLRNYT  333



>ref|XP_002322194.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
 gb|EEF06321.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
Length=773

 Score =   412 bits (1058),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GP+IP KLPPR
Sbjct  99   RAAGATPELRDSMRFIEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPMKLPPR  158

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  159  RARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSQVVPDVQPPMDAVEYAECEA  218

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DM+LVMVDAWCVGY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  219  VVKDFPPFREAMKKRGIEDMELVMVDAWCVGYHSDADAPSRRLAKPLIFCRTESDCPMEN  278

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNM V+EFED KLVPLP ADPLRNYTP
Sbjct  279  GYARPVEGIHVLVDMQNMKVVEFEDHKLVPLPLADPLRNYTP  320



>ref|XP_007138024.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
 gb|ESW10018.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
Length=770

 Score =   412 bits (1058),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDSMRF EV L+EPDKNVVALADAYFFPPFQPSLLPRT+ GP+IP+KLPPR
Sbjct  92   RAAGATPELRDSMRFIEVVLLEPDKNVVALADAYFFPPFQPSLLPRTRGGPLIPTKLPPR  151

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             ARLVVYNKKSNETS WIVELS+VHAVTRGGHHRGKVI+S VVPDVQP MDA EYAECEA
Sbjct  152  CARLVVYNKKSNETSIWIVELSQVHAVTRGGHHRGKVIASHVVPDVQPPMDAEEYAECEA  211

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK FPPF EAMKKRGI DMDLVMVD WCVGYYSEADAP RRLAKPL+FC++ESDCPMEN
Sbjct  212  VVKSFPPFIEAMKKRGIEDMDLVMVDPWCVGYYSEADAPGRRLAKPLLFCQSESDCPMEN  271

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRKLVPLPP DPLRNYTP
Sbjct  272  GYARPVEGIYVLVDMQNMVVIEFEDRKLVPLPPVDPLRNYTP  313



>ref|XP_004301007.1| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=789

 Score =   412 bits (1059),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQP+LLPRTK GP+IPSKLPPR
Sbjct  111  RAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPTLLPRTKGGPIIPSKLPPR  170

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNK SNE S WIVELSEVHA TRGGHHRGKVISS+V+PDVQP MDA EYAECEA
Sbjct  171  RARLIVYNKTSNEISTWIVELSEVHAATRGGHHRGKVISSQVIPDVQPPMDAVEYAECEA  230

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPF EAMKKRGI DMDLVMVDAWCVGY+SEADAPS+RLAKPLIFCRTESDCPMEN
Sbjct  231  VVKDFPPFGEAMKKRGIEDMDLVMVDAWCVGYHSEADAPSKRLAKPLIFCRTESDCPMEN  290

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG++ILVDMQ+MVV+EFEDRKLVPLPPADPLRNYT
Sbjct  291  GYARPVEGIHILVDMQSMVVLEFEDRKLVPLPPADPLRNYT  331



>ref|XP_003551224.1| PREDICTED: peroxisomal primary amine oxidase-like isoform X1 
[Glycine max]
 gb|KHN07220.1| Primary amine oxidase [Glycine soja]
Length=764

 Score =   411 bits (1057),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  90   RAAGATPEVRDSMRFIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  149

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVEL EVHA TRGGHHRGKV+SS VVPDVQP MDA EYAECEA
Sbjct  150  KARLVVYNKRSNETSIWIVELREVHAATRGGHHRGKVVSSTVVPDVQPPMDAVEYAECEA  209

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SE DAPSRRLAKPLIFCRTESDCPMEN
Sbjct  210  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEVDAPSRRLAKPLIFCRTESDCPMEN  269

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPV+G+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYT
Sbjct  270  GYARPVDGIHVLVDMQNMVVLEFEDRKLVPLPPADPLRNYT  310



>ref|XP_003601195.1| Primary amine oxidase [Medicago truncatula]
 gb|AES71446.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=769

 Score =   411 bits (1057),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPR+K GPVIP+KLPPR
Sbjct  91   RAAGATPELRDSMRFIEVVLLEPDKHVVALADAYFFPPFQPSLLPRSKGGPVIPTKLPPR  150

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             ARLVVYNKKSNET+ WIVELS+VHAVTRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  151  CARLVVYNKKSNETTLWIVELSQVHAVTRGGHHRGKVISSNVVPDVQPPMDAEEYAECEA  210

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK FPPF EAMKKRGI DMDLVMVD WCVGY+SEADAP RRLAKPL+FCR+ESDCPMEN
Sbjct  211  VVKSFPPFIEAMKKRGIEDMDLVMVDPWCVGYHSEADAPGRRLAKPLLFCRSESDCPMEN  270

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRKLVPLPP DPLRNYTP
Sbjct  271  GYARPVEGIYVLVDMQNMVVIEFEDRKLVPLPPVDPLRNYTP  312



>ref|XP_007036330.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY20831.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=755

 Score =   411 bits (1056),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/222 (89%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  119  RAAGATPEVRDGMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  178

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS WIVELSEVHAVTRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  179  RARLIVYNKKSNETSVWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  238

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DM+LVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  239  VVKDFPPFREAMKKRGIEDMELVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPMEN  298

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQ M VIEFED K VPLP ADPLRNYTP
Sbjct  299  GYARPVEGIYVLVDMQKMKVIEFEDCKFVPLPLADPLRNYTP  340



>ref|XP_006845257.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
 gb|ERN06932.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
Length=786

 Score =   411 bits (1057),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +1

Query  10   GATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQAR  189
            G TPEVRD MRF EV L EPDK+VVALADAYFFPPFQPSLLP+TK GPVIPSKLPPR+AR
Sbjct  116  GKTPEVRDGMRFIEVVLWEPDKSVVALADAYFFPPFQPSLLPKTKGGPVIPSKLPPRRAR  175

Query  190  LVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVK  369
            LVVYNKKSNETS WIVEL+EVHA TRGGHHRGK +SS+VVPDVQP MDA EYAECEAVVK
Sbjct  176  LVVYNKKSNETSIWIVELTEVHAATRGGHHRGKAVSSEVVPDVQPPMDAVEYAECEAVVK  235

Query  370  DFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYA  549
            D+PPFREAMKKRGI DMDLVMVDAWCVGY+S+ADAPSRRLAKPLIFCRTESDCPMENGYA
Sbjct  236  DYPPFREAMKKRGIEDMDLVMVDAWCVGYHSDADAPSRRLAKPLIFCRTESDCPMENGYA  295

Query  550  RPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RPVEG++ILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  296  RPVEGIHILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  334



>ref|XP_011101289.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=777

 Score =   410 bits (1055),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP+K+VV LADAYFFPPFQPSLLPR K GP IPSKLPPR
Sbjct  99   RAAGATPEVRDSMRFIEVVLLEPEKHVVGLADAYFFPPFQPSLLPRAKGGPEIPSKLPPR  158

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVEL+EVHA TRGGHHRGKVISS VVPDVQP MDAAEYAECEA
Sbjct  159  RARLVVYNKRSNETSVWIVELAEVHATTRGGHHRGKVISSTVVPDVQPPMDAAEYAECEA  218

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKD+PPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  219  IVKDYPPFMEAMKRRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLIFCRTESDCPLEN  278

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  279  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  320



>ref|XP_008464520.1| PREDICTED: copper amine oxidase 1 isoform X2 [Cucumis melo]
Length=704

 Score =   408 bits (1048),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP+K+VVALADAYFFPPFQPSLLP+TK GPVIP+KLPPR
Sbjct  26   RAAGATPEVRDSMRFIEVVLLEPEKHVVALADAYFFPPFQPSLLPKTKGGPVIPTKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +AR+VVYNKKSNETS W+VELSEVHAVTRGGHHRGKVISS VVP+VQP MDAAEYAECEA
Sbjct  86   RARIVVYNKKSNETSIWVVELSEVHAVTRGGHHRGKVISSSVVPEVQPPMDAAEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VK++PPF EAMKKRGI DMDLVMVD WCVGY+SE DAP RRLAKPLIFCRTESDCPMEN
Sbjct  146  IVKEYPPFIEAMKKRGIEDMDLVMVDPWCVGYHSEVDAPGRRLAKPLIFCRTESDCPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  206  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  246



>ref|XP_004509661.1| PREDICTED: copper methylamine oxidase-like isoform X1 [Cicer 
arietinum]
Length=760

 Score =   409 bits (1051),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 208/221 (94%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV +VEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  86   RAAGATPEVRDSMRFIEVDMVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  145

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL+EVHA TRGGHHRGKVISS +VPDVQP MDA EYAECEA
Sbjct  146  KARLVVYNKKSNETSIWIVELTEVHATTRGGHHRGKVISSTIVPDVQPPMDAVEYAECEA  205

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPF+EAMKKRGI DMDLVMVD WC GY SEADAPSRRLAKPL FCRTESDCPMEN
Sbjct  206  VVKNYPPFQEAMKKRGIEDMDLVMVDPWCAGYDSEADAPSRRLAKPLFFCRTESDCPMEN  265

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYT
Sbjct  266  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPPADPLRNYT  306



>ref|XP_007036329.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY20830.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   410 bits (1054),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 198/222 (89%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  119  RAAGATPEVRDGMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  178

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS WIVELSEVHAVTRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  179  RARLIVYNKKSNETSVWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPPMDAMEYAECEA  238

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DM+LVMVD WCVGY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  239  VVKDFPPFREAMKKRGIEDMELVMVDPWCVGYHSDADAPSRRLAKPLIFCRTESDCPMEN  298

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQ M VIEFED K VPLP ADPLRNYTP
Sbjct  299  GYARPVEGIYVLVDMQKMKVIEFEDCKFVPLPLADPLRNYTP  340



>ref|XP_011045265.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=700

 Score =   407 bits (1046),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEP K+VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  26   RAAGATPEVRDSMRFVEVVLVEPVKHVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVEL+EV A TRGGHHRGKVISS+VVP+VQP MDA EYAECEA
Sbjct  86   RARLVVYNKRSNETSIWIVELAEVRATTRGGHHRGKVISSEVVPNVQPPMDAVEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+S++DAPSRRLAKPLIFCRTESDCPMEN
Sbjct  146  VVKDFPPFREAMKKRGIDDMDLVMVDPWCAGYHSDSDAPSRRLAKPLIFCRTESDCPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKL+PLPPADPLRNYT
Sbjct  206  GYARPVEGIHVLVDMQNMVVIEFEDRKLIPLPPADPLRNYT  246



>ref|XP_008464519.1| PREDICTED: copper amine oxidase 1 isoform X1 [Cucumis melo]
Length=791

 Score =   409 bits (1052),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP+K+VVALADAYFFPPFQPSLLP+TK GPVIP+KLPPR
Sbjct  113  RAAGATPEVRDSMRFIEVVLLEPEKHVVALADAYFFPPFQPSLLPKTKGGPVIPTKLPPR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +AR+VVYNKKSNETS W+VELSEVHAVTRGGHHRGKVISS VVP+VQP MDAAEYAECEA
Sbjct  173  RARIVVYNKKSNETSIWVVELSEVHAVTRGGHHRGKVISSSVVPEVQPPMDAAEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VK++PPF EAMKKRGI DMDLVMVD WCVGY+SE DAP RRLAKPLIFCRTESDCPMEN
Sbjct  233  IVKEYPPFIEAMKKRGIEDMDLVMVDPWCVGYHSEVDAPGRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  293  GYARPVEGIHVLVDMQNMVVIEFEDRKLVPLPPADPLRNYT  333



>ref|XP_011045264.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=766

 Score =   408 bits (1049),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEP K+VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  92   RAAGATPEVRDSMRFVEVVLVEPVKHVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  151

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVEL+EV A TRGGHHRGKVISS+VVP+VQP MDA EYAECEA
Sbjct  152  RARLVVYNKRSNETSIWIVELAEVRATTRGGHHRGKVISSEVVPNVQPPMDAVEYAECEA  211

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+S++DAPSRRLAKPLIFCRTESDCPMEN
Sbjct  212  VVKDFPPFREAMKKRGIDDMDLVMVDPWCAGYHSDSDAPSRRLAKPLIFCRTESDCPMEN  271

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKL+PLPPADPLRNYT
Sbjct  272  GYARPVEGIHVLVDMQNMVVIEFEDRKLIPLPPADPLRNYT  312



>gb|KEH20158.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=700

 Score =   406 bits (1043),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD +RF EV LVEP+K VVALADAYFFPPFQPSLLPR K GPVIPSKLPPR
Sbjct  26   RAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFPPFQPSLLPRIKGGPVIPSKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL+EVHA TRGGHHRGKVI+S VVPDVQP MDA EYAECEA
Sbjct  86   KARLVVYNKKSNETSIWIVELTEVHATTRGGHHRGKVITSTVVPDVQPPMDAVEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SE DAPSRRLAKPL FCRTESDCPMEN
Sbjct  146  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEGDAPSRRLAKPLFFCRTESDCPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLP ADPLRNYT
Sbjct  206  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPQADPLRNYT  246



>gb|KEH20163.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=724

 Score =   407 bits (1045),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD +RF EV LVEP+K VVALADAYFFPPFQPSLLPR K GPVIPSKLPPR
Sbjct  50   RAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFPPFQPSLLPRIKGGPVIPSKLPPR  109

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL+EVHA TRGGHHRGKVI+S VVPDVQP MDA EYAECEA
Sbjct  110  KARLVVYNKKSNETSIWIVELTEVHATTRGGHHRGKVITSTVVPDVQPPMDAVEYAECEA  169

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SE DAPSRRLAKPL FCRTESDCPMEN
Sbjct  170  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEGDAPSRRLAKPLFFCRTESDCPMEN  229

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLP ADPLRNYT
Sbjct  230  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPQADPLRNYT  270



>ref|XP_007153778.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
 gb|ESW25772.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
Length=755

 Score =   407 bits (1047),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLP R
Sbjct  80   RAAGATPEVRDGMRFIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPLR  139

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL EVHA TRGGHHRGKV+SS VVPDVQP MDA EYAECEA
Sbjct  140  KARLVVYNKKSNETSIWIVELREVHAATRGGHHRGKVVSSTVVPDVQPPMDAVEYAECEA  199

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPFREAMKKRGI DMDL+MVD WC GY+SE DAPSRRLAKPLIFCRTESDCPMEN
Sbjct  200  IVKDFPPFREAMKKRGIEDMDLLMVDPWCAGYHSEVDAPSRRLAKPLIFCRTESDCPMEN  259

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYT
Sbjct  260  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPPADPLRNYT  300



>ref|XP_010027284.1| PREDICTED: copper amine oxidase 1 [Eucalyptus grandis]
Length=769

 Score =   408 bits (1048),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG+TPE+RD MRF EV L+EP K+VVALADAYFFPPFQPSLLPRTK GPV+P+KLPPR
Sbjct  91   RAAGSTPEIRDGMRFVEVVLLEPGKHVVALADAYFFPPFQPSLLPRTKSGPVLPAKLPPR  150

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS WIVELSEVHA TRGGHHRGKVISSK++P+VQP MDA+EYAECEA
Sbjct  151  RARLIVYNKKSNETSVWIVELSEVHAATRGGHHRGKVISSKIIPNVQPPMDASEYAECEA  210

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK+FP FREAMKKRGI DMDLVMVDAWC GY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  211  AVKEFPQFREAMKKRGIEDMDLVMVDAWCAGYHSDADAPSRRLAKPLIFCRTESDCPMEN  270

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG++ILVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  271  GYARPVEGIHILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  311



>ref|XP_010907652.1| PREDICTED: copper amine oxidase 1 [Elaeis guineensis]
Length=771

 Score =   407 bits (1047),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLP R
Sbjct  97   RAAGATPEVRDSMRFVEVVLLEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPAR  156

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  157  RARLVVYNKQSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAVEYAECEA  216

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK +PPF EAMKKRGI DMDLVMVDAWC GY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  217  AVKSYPPFIEAMKKRGIEDMDLVMVDAWCAGYHSEADAPSRRLAKPLIFCRTESDCPMEN  276

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG++ILVD+QN V+IEFEDRKLVPLPPADPLRNYTP
Sbjct  277  GYARPVEGIHILVDIQNNVIIEFEDRKLVPLPPADPLRNYTP  318



>ref|XP_004155025.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
 gb|KGN63544.1| hypothetical protein Csa_1G004100 [Cucumis sativus]
Length=791

 Score =   408 bits (1049),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 193/221 (87%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP+K+VVALADAYFFPPFQPSLLP+TK GPVIP+KLPPR
Sbjct  113  RAAGATPEVRDSMRFIEVVLLEPEKHVVALADAYFFPPFQPSLLPKTKGGPVIPTKLPPR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +AR+VVYNKKSNETS W+VELSEVHAVTRGGHHRGKVISS VVP+VQP MDAAEYAECEA
Sbjct  173  RARIVVYNKKSNETSIWVVELSEVHAVTRGGHHRGKVISSSVVPEVQPPMDAAEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VK++PPF EAMKKRGI DMDLVMVD WCVGY+SE DAP RRLAKPLIFCRTESDCPMEN
Sbjct  233  IVKEYPPFIEAMKKRGIEDMDLVMVDPWCVGYHSEVDAPGRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMV+IEFEDRKLVPLPPADPLRNYT
Sbjct  293  GYARPVEGIHVLVDMQNMVIIEFEDRKLVPLPPADPLRNYT  333



>gb|KEH20157.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=774

 Score =   408 bits (1048),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD +RF EV LVEP+K VVALADAYFFPPFQPSLLPR K GPVIPSKLPPR
Sbjct  100  RAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFPPFQPSLLPRIKGGPVIPSKLPPR  159

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL+EVHA TRGGHHRGKVI+S VVPDVQP MDA EYAECEA
Sbjct  160  KARLVVYNKKSNETSIWIVELTEVHATTRGGHHRGKVITSTVVPDVQPPMDAVEYAECEA  219

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SE DAPSRRLAKPL FCRTESDCPMEN
Sbjct  220  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEGDAPSRRLAKPLFFCRTESDCPMEN  279

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLP ADPLRNYT
Sbjct  280  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPQADPLRNYT  320



>ref|XP_004138093.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
Length=794

 Score =   408 bits (1048),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 193/221 (87%), Positives = 210/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP+K+VVALADAYFFPPFQPSLLP+TK GPVIP+KLPPR
Sbjct  113  RAAGATPEVRDSMRFIEVVLLEPEKHVVALADAYFFPPFQPSLLPKTKGGPVIPTKLPPR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +AR+VVYNKKSNETS W+VELSEVHAVTRGGHHRGKVISS VVP+VQP MDAAEYAECEA
Sbjct  173  RARIVVYNKKSNETSIWVVELSEVHAVTRGGHHRGKVISSSVVPEVQPPMDAAEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VK++PPF EAMKKRGI DMDLVMVD WCVGY+SE DAP RRLAKPLIFCRTESDCPMEN
Sbjct  233  IVKEYPPFIEAMKKRGIEDMDLVMVDPWCVGYHSEVDAPGRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMV+IEFEDRKLVPLPPADPLRNYT
Sbjct  293  GYARPVEGIHVLVDMQNMVIIEFEDRKLVPLPPADPLRNYT  333



>gb|KEH20159.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=761

 Score =   407 bits (1046),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD +RF EV LVEP+K VVALADAYFFPPFQPSLLPR K GPVIPSKLPPR
Sbjct  87   RAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFPPFQPSLLPRIKGGPVIPSKLPPR  146

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL+EVHA TRGGHHRGKVI+S VVPDVQP MDA EYAECEA
Sbjct  147  KARLVVYNKKSNETSIWIVELTEVHATTRGGHHRGKVITSTVVPDVQPPMDAVEYAECEA  206

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+SE DAPSRRLAKPL FCRTESDCPMEN
Sbjct  207  VVKDFPPFREAMKKRGIEDMDLVMVDPWCAGYHSEGDAPSRRLAKPLFFCRTESDCPMEN  266

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVV+EFEDRKLVPLP ADPLRNYT
Sbjct  267  GYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPQADPLRNYT  307



>ref|XP_011046219.1| PREDICTED: copper amine oxidase 1-like [Populus euphratica]
Length=777

 Score =   407 bits (1047),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/222 (87%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GP+IP KLPPR
Sbjct  99   RAAGATPELRDSMRFIEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPMKLPPR  158

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  159  RARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSQVVPDVQPPMDAVEYAECEA  218

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK FPPFREAMKKRGI DM+LVMVDAWCVGY+S+ADAPSRRLAKPLIFCRTES+CPMEN
Sbjct  219  VVKAFPPFREAMKKRGIEDMELVMVDAWCVGYHSDADAPSRRLAKPLIFCRTESECPMEN  278

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNM V+EFED KLVPLP ADPLRNYTP
Sbjct  279  GYARPVEGIHVLVDMQNMKVVEFEDHKLVPLPLADPLRNYTP  320



>ref|XP_002314600.1| copper amine oxidase family protein [Populus trichocarpa]
 gb|EEF00771.1| copper amine oxidase family protein [Populus trichocarpa]
Length=700

 Score =   405 bits (1040),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEP K+VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  26   RAAGATPEVRDSMRFVEVVLVEPVKHVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVY+K+SNETS WIVEL+EV A TRGGHHRGKVISS+VVP+VQP MDA EYAECEA
Sbjct  86   RARLVVYSKRSNETSIWIVELAEVRATTRGGHHRGKVISSEVVPNVQPPMDAVEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVD WC GY+S++DAPSRRLAKPLIFCRTESDCPMEN
Sbjct  146  VVKDFPPFREAMKKRGIDDMDLVMVDPWCAGYHSDSDAPSRRLAKPLIFCRTESDCPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRKL+PLPPADPLRNYT
Sbjct  206  GYARPVEGIHVLVDMQNMVVIEFEDRKLIPLPPADPLRNYT  246



>ref|XP_008389732.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Malus domestica]
Length=781

 Score =   407 bits (1046),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 209/228 (92%), Gaps = 6/228 (3%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV+LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPR
Sbjct  101  RAAGATPEVRDSMRFVEVALVEPDKRVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  161  QARLVVYNKKSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVD------AWCVGYYSEADAPSRRLAKPLIFCRTES  522
            VVK+FPPFREAMKKRGI DMDLVMVD        C GY+S ADAPSRRLAKPLIFCRTES
Sbjct  221  VVKNFPPFREAMKKRGIEDMDLVMVDPCVSLLIRCTGYHSGADAPSRRLAKPLIFCRTES  280

Query  523  DCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            DCP+ENGYARPVEG+ +LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  281  DCPLENGYARPVEGIRVLVDMQNMVVLEFEDRKLVPLPPADPLRNYTP  328



>emb|CBI14968.3| unnamed protein product [Vitis vinifera]
Length=1372

 Score =   420 bits (1079),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L EPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  113  RAAGATPEVRDGMRFVEVVLYEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  172

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS WIVELSEVHA TRGGHHRGK I+++VVPD+QP MDA EYAECEA
Sbjct  173  KARLIVYNKKSNETSIWIVELSEVHAATRGGHHRGKAITTQVVPDIQPPMDAVEYAECEA  232

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD P FREAMKKRG+ DMDLVMVDAWCVGY+ EADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  233  VVKDCPLFREAMKKRGVEDMDLVMVDAWCVGYHGEADAPSRRLAKPLIFCRTESDCPMEN  292

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y++VDMQNMVVIEFEDRKLVPLPPADPLRNYTP
Sbjct  293  GYARPVEGIYVVVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  334



>ref|XP_010506075.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Camelina sativa]
 ref|XP_010506076.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Camelina sativa]
Length=779

 Score =   406 bits (1044),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/222 (87%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRD MRF EV+ VEPDK+VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR
Sbjct  101  RAAGANPEVRDGMRFIEVASVEPDKHVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYN+KSNETS WIVELSEVHAVTRGGHHRGKV+SS+V+PDVQP MDAAEYAECEA
Sbjct  161  RARLVVYNQKSNETSVWIVELSEVHAVTRGGHHRGKVVSSEVIPDVQPPMDAAEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  221  IVKDFPPFIEAMKRRGIEDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  281  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  322



>ref|XP_004501882.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=767

 Score =   405 bits (1042),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPR+K GPVIP+KLPPR
Sbjct  89   RAAGATPELRDSMRFIEVVLLEPDKHVVALADAYFFPPFQPSLLPRSKGGPVIPTKLPPR  148

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             +RLVVYNKKSNET+ WIVELS+VHAVTRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  149  CSRLVVYNKKSNETALWIVELSQVHAVTRGGHHRGKVISSHVVPDVQPPMDAEEYAECEA  208

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK +PPF EAMKKRGI DM++VMVD WCVGY+SEADAP RRLAKPLIFCR+ESDCPMEN
Sbjct  209  VVKSYPPFIEAMKKRGIEDMEVVMVDPWCVGYHSEADAPGRRLAKPLIFCRSESDCPMEN  268

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRKLVPLPP DPLRNYTP
Sbjct  269  GYARPVEGIYVLVDMQNMVVIEFEDRKLVPLPPVDPLRNYTP  310



>ref|XP_011047814.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=774

 Score =   406 bits (1043),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/222 (86%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDSMRF EV L EPDK+VVALADAYFFPPFQPSLLPR+K GP+IP+KLPPR
Sbjct  96   RAAGATPELRDSMRFVEVVLFEPDKHVVALADAYFFPPFQPSLLPRSKGGPIIPTKLPPR  155

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  156  RARLVVYNKRSNETSLWIVELSEVHAATRGGHHRGKVISSQVVPDVQPPMDAVEYAECEA  215

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD  PFREAMK+RGI DMDL+M D WCVGY+S+ADAPSRRLAK LIFCRTESDCPMEN
Sbjct  216  VVKDLHPFREAMKQRGIEDMDLLMADGWCVGYHSDADAPSRRLAKTLIFCRTESDCPMEN  275

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNM VIEFEDRKLVPLPPADPLRNYTP
Sbjct  276  GYARPVEGIHVLVDMQNMRVIEFEDRKLVPLPPADPLRNYTP  317



>ref|XP_011047815.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=771

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/222 (86%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDSMRF EV L EPDK+VVALADAYFFPPFQPSLLPR+K GP+IP+KLPPR
Sbjct  93   RAAGATPELRDSMRFVEVVLFEPDKHVVALADAYFFPPFQPSLLPRSKGGPIIPTKLPPR  152

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  153  RARLVVYNKRSNETSLWIVELSEVHAATRGGHHRGKVISSQVVPDVQPPMDAVEYAECEA  212

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD  PFREAMK+RGI DMDL+M D WCVGY+S+ADAPSRRLAK LIFCRTESDCPMEN
Sbjct  213  VVKDLHPFREAMKQRGIEDMDLLMADGWCVGYHSDADAPSRRLAKTLIFCRTESDCPMEN  272

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVDMQNM VIEFEDRKLVPLPPADPLRNYTP
Sbjct  273  GYARPVEGIHVLVDMQNMRVIEFEDRKLVPLPPADPLRNYTP  314



>emb|CDY14839.1| BnaC04g48360D [Brassica napus]
Length=775

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRDSMRF EV+ VEP+KNVVALADAYFFPPFQPSLLPRTK GPVIP +LPPR
Sbjct  98   RAAGANPEVRDSMRFIEVASVEPEKNVVALADAYFFPPFQPSLLPRTKAGPVIPMRLPPR  157

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +A+LVVYNKKSNETS WIVELSEVHAVTRGGHHRG+V+SS+V+PDVQP MDAAEYAECEA
Sbjct  158  RAKLVVYNKKSNETSVWIVELSEVHAVTRGGHHRGRVVSSEVIPDVQPPMDAAEYAECEA  217

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  218  IVKDFPPFIEAMKRRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  277

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  278  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  319



>emb|CDY47975.1| BnaA04g24530D [Brassica napus]
Length=775

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRDSMRF EV+ VEP+KNVVALADAYFFPPFQPSLLPRTK GPVIP +LPPR
Sbjct  98   RAAGANPEVRDSMRFIEVASVEPEKNVVALADAYFFPPFQPSLLPRTKAGPVIPMRLPPR  157

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +A+LVVYNKKSNETS WIVELSEVHAVTRGGHHRG+V+SS+V+PDVQP MDAAEYAECEA
Sbjct  158  RAKLVVYNKKSNETSVWIVELSEVHAVTRGGHHRGRVVSSEVIPDVQPPMDAAEYAECEA  217

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  218  IVKDFPPFIEAMKRRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  277

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  278  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  319



>ref|XP_007158407.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30401.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=769

 Score =   405 bits (1041),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEP K VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  95   RAAGATPEVRDSMRFVEVVLVEPAKQVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  154

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVEL EVHA TRGGHHRGKVISSKVVP+VQP MDA EYAECEA
Sbjct  155  RARLVVYNKRSNETSVWIVELREVHAATRGGHHRGKVISSKVVPNVQPPMDAVEYAECEA  214

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFP FREAMK+RGI DMDLVMVDAWCVGY+ E DAPSRRLAKPLIFCRTESDCPMEN
Sbjct  215  VVKDFPAFREAMKRRGIEDMDLVMVDAWCVGYHRETDAPSRRLAKPLIFCRTESDCPMEN  274

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+ ILVDMQ+M ++EFEDRKL+PLPPADPLRNYT
Sbjct  275  GYARPVEGINILVDMQHMEILEFEDRKLIPLPPADPLRNYT  315



>ref|XP_009142070.1| PREDICTED: LOW QUALITY PROTEIN: copper amine oxidase 1 [Brassica 
rapa]
Length=778

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRDSMRF EV+ VEP+KNVVALADAYFFPPFQPSLLPRTK GPVIP +LPPR
Sbjct  101  RAAGANPEVRDSMRFIEVASVEPEKNVVALADAYFFPPFQPSLLPRTKAGPVIPMRLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +A+LVVYNKKSNETS WIVELSEVHAVTRGGHHRG+V+SS+V+PDVQP MDAAEYAECEA
Sbjct  161  RAKLVVYNKKSNETSVWIVELSEVHAVTRGGHHRGRVVSSEVIPDVQPPMDAAEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  221  IVKDFPPFIEAMKRRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  281  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  322



>ref|XP_002881856.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58115.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
Length=775

 Score =   405 bits (1041),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRD MRF EV+ VEPDK VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR
Sbjct  97   RAAGANPEVRDGMRFIEVASVEPDKQVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPR  156

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYN+KSNETS WIVELSEVHAVTRGGHHRG+V+SS+V+PDVQP MDAAEYAECEA
Sbjct  157  RARLVVYNQKSNETSVWIVELSEVHAVTRGGHHRGRVVSSQVIPDVQPPMDAAEYAECEA  216

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  217  IVKDFPPFIEAMKRRGIEDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  276

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  277  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  318



>ref|XP_009403621.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=775

 Score =   405 bits (1041),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            R+AGATPEVRDSMRF EV L+EP+KN+VALADAYFFPPFQPSLLPRTK GPVI SKLPPR
Sbjct  103  RSAGATPEVRDSMRFVEVVLLEPEKNIVALADAYFFPPFQPSLLPRTKGGPVILSKLPPR  162

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP MDA EYAECEA
Sbjct  163  RARLVVYNKKSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPDVQPPMDAIEYAECEA  222

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK++PPF EAM+KRG+ DMDLVMVDAWC GY+S+ADAPSRRLAKPLIFCRTESDCP+EN
Sbjct  223  AVKNYPPFIEAMRKRGVDDMDLVMVDAWCAGYHSDADAPSRRLAKPLIFCRTESDCPVEN  282

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+YILVDMQN ++IEFEDRKLVPLPPADPLRNYTP
Sbjct  283  GYARPVEGIYILVDMQNNLIIEFEDRKLVPLPPADPLRNYTP  324



>ref|XP_010682433.1| PREDICTED: copper amine oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=773

 Score =   405 bits (1041),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE RD MRF EV LVEP+K+V+A+ADAYFFPPFQPSLL RT+   VIPSKLPPR
Sbjct  98   RAAGATPEERDGMRFIEVVLVEPEKHVIAMADAYFFPPFQPSLLTRTRGRHVIPSKLPPR  157

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARL+VY+ KSNETS W+VEL EVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  158  QARLIVYSIKSNETSIWVVELLEVHATTRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  217

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPFREAMKKRGI DMDLVMVDAWCVGY+SEADAP RRLAKPLIFCRTESDCPMEN
Sbjct  218  VVKDYPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADAPRRRLAKPLIFCRTESDCPMEN  277

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVV+EFEDRKLVPLPPADPLRNYTP
Sbjct  278  GYARPVEGIYVLVDMQNMVVVEFEDRKLVPLPPADPLRNYTP  319



>ref|XP_010508564.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   405 bits (1040),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRD MRF EV+ VEP+K+VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR
Sbjct  103  RAAGANPEVRDGMRFIEVASVEPEKHVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPR  162

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYN+KSNETS WIVELSEVHAVTRGGHHRGKV+SS+V+PDVQP MDAAEYAECEA
Sbjct  163  RARLVVYNQKSNETSVWIVELSEVHAVTRGGHHRGKVVSSEVIPDVQPPMDAAEYAECEA  222

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  223  IVKDFPPFIEAMKRRGIEDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  282

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  283  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  324



>ref|XP_006581907.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=724

 Score =   403 bits (1035),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/222 (86%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG+TPE+RDSMRF E+ L+EPDKNVVALADAYFFPPFQPSLLPR + GP+IP+KLPPR
Sbjct  46   RAAGSTPELRDSMRFIEIVLLEPDKNVVALADAYFFPPFQPSLLPRARGGPLIPAKLPPR  105

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             ARLVVY++K+NETS WIVELS+VHAVTRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  106  CARLVVYSRKTNETSIWIVELSQVHAVTRGGHHRGKVISSHVVPDVQPPMDAEEYAECEA  165

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK FPPF EAMKKRGI DMDLVMVD WCVGY+SEADAP +RLAKPLIFCR+ESDCPMEN
Sbjct  166  VVKSFPPFIEAMKKRGIEDMDLVMVDPWCVGYHSEADAPGKRLAKPLIFCRSESDCPMEN  225

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVV+EFEDRKLVPLPP DPLRNYTP
Sbjct  226  GYARPVEGIYVLVDMQNMVVLEFEDRKLVPLPPVDPLRNYTP  267



>ref|XP_007158406.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30400.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=757

 Score =   404 bits (1038),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEP K VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  83   RAAGATPEVRDSMRFVEVVLVEPAKQVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  142

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVEL EVHA TRGGHHRGKVISSKVVP+VQP MDA EYAECEA
Sbjct  143  RARLVVYNKRSNETSVWIVELREVHAATRGGHHRGKVISSKVVPNVQPPMDAVEYAECEA  202

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFP FREAMK+RGI DMDLVMVDAWCVGY+ E DAPSRRLAKPLIFCRTESDCPMEN
Sbjct  203  VVKDFPAFREAMKRRGIEDMDLVMVDAWCVGYHRETDAPSRRLAKPLIFCRTESDCPMEN  262

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+ ILVDMQ+M ++EFEDRKL+PLPPADPLRNYT
Sbjct  263  GYARPVEGINILVDMQHMEILEFEDRKLIPLPPADPLRNYT  303



>ref|XP_010533488.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=787

 Score =   405 bits (1040),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L+EP+K VVALADAYFFPPFQPSLLPR K GP+IP+KLPPR
Sbjct  108  RAAGATPEVRDGMRFIEVVLIEPEKRVVALADAYFFPPFQPSLLPRFKGGPIIPTKLPPR  167

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +A L+VYNKKSNETS WIVELSEVHAVTRGGHHRGKV+SS+V+PDVQP MDAAEYAECEA
Sbjct  168  RASLIVYNKKSNETSEWIVELSEVHAVTRGGHHRGKVVSSQVIPDVQPPMDAAEYAECEA  227

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VKDFPPFREAMK+RGI DMDLVMVD WCVGYYSEADAPSRRLAKPLIFCRT+SD PMEN
Sbjct  228  TVKDFPPFREAMKRRGIEDMDLVMVDPWCVGYYSEADAPSRRLAKPLIFCRTDSDSPMEN  287

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLP  DPLRNYTP
Sbjct  288  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPQPDPLRNYTP  329



>ref|XP_010517774.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   404 bits (1039),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRD MRF EV+ VEP+K+VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR
Sbjct  103  RAAGANPEVRDGMRFIEVASVEPEKHVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPR  162

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYN+KSNETS WIVELSEVHAVTRGGHHRGKV+SS+V+PDVQP MDAAEYAECEA
Sbjct  163  RARLVVYNQKSNETSVWIVELSEVHAVTRGGHHRGKVVSSEVIPDVQPPMDAAEYAECEA  222

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  223  IVKDFPPFIEAMKRRGIEDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  282

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  283  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  324



>ref|XP_009379966.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=771

 Score =   404 bits (1038),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 191/221 (86%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L+EP+KN+VALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  99   RAAGATPEVRDGMRFIEVVLLEPEKNIVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  158

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+VV DVQPSMDA EYAECEA
Sbjct  159  RARLVVYNKRSNETSIWIVELSEVHAATRGGHHRGKVISSEVVHDVQPSMDAMEYAECEA  218

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK++P F EAM+KRG+ DMDLVMVDAWCVGYYS+AD PSRRLAKPLIFCRTESDCPMEN
Sbjct  219  AVKNYPAFIEAMRKRGVEDMDLVMVDAWCVGYYSDADGPSRRLAKPLIFCRTESDCPMEN  278

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVD+QN V+IEFEDRKLVPLPPADPLRNYT
Sbjct  279  GYARPVEGIHVLVDIQNNVIIEFEDRKLVPLPPADPLRNYT  319



>ref|NP_181777.2| copper amine oxidase family protein [Arabidopsis thaliana]
 gb|AAM53275.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAN15348.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AEC10126.1| copper amine oxidase family protein [Arabidopsis thaliana]
Length=776

 Score =   404 bits (1037),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/222 (86%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRD MRF EV+ VEPDK VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR
Sbjct  98   RAAGANPEVRDGMRFIEVASVEPDKQVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPR  157

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYN+KSNETS WIV LSEVHAVTRGGHHRG+V+SS+V+PDVQP MDAAEYAECEA
Sbjct  158  RARLVVYNQKSNETSVWIVALSEVHAVTRGGHHRGRVVSSQVIPDVQPPMDAAEYAECEA  217

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  218  IVKDFPPFIEAMKRRGIEDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  277

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  278  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  319



>ref|XP_003527002.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=774

 Score =   403 bits (1035),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/222 (86%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG+TPE+RDSMRF E+ L+EPDKNVVALADAYFFPPFQPSLLPR + GP+IP+KLPPR
Sbjct  96   RAAGSTPELRDSMRFIEIVLLEPDKNVVALADAYFFPPFQPSLLPRARGGPLIPAKLPPR  155

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             ARLVVY++K+NETS WIVELS+VHAVTRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  156  CARLVVYSRKTNETSIWIVELSQVHAVTRGGHHRGKVISSHVVPDVQPPMDAEEYAECEA  215

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK FPPF EAMKKRGI DMDLVMVD WCVGY+SEADAP +RLAKPLIFCR+ESDCPMEN
Sbjct  216  VVKSFPPFIEAMKKRGIEDMDLVMVDPWCVGYHSEADAPGKRLAKPLIFCRSESDCPMEN  275

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVV+EFEDRKLVPLPP DPLRNYTP
Sbjct  276  GYARPVEGIYVLVDMQNMVVLEFEDRKLVPLPPVDPLRNYTP  317



>ref|NP_001237782.1| peroxisomal copper-containing amine oxidase [Glycine max]
 gb|AAD40979.1|AF089851_1 peroxisomal copper-containing amine oxidase [Glycine max]
Length=701

 Score =   401 bits (1030),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 205/222 (92%), Gaps = 1/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR
Sbjct  26   RAAGATPEVRDGMRFIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVEL EVHA TRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  86   KARLVVYNKKSNETSTWIVELREVHATTRGGHHRGKVISSTVVPDVQPPMDAVEYAECEA  145

Query  361  VVKDFPPFREAMKKR-GIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            VVKDFPPFREA + R GI +MDLVMVD WC GY+SEADAPSRRLAKPLIFCRTESDCPME
Sbjct  146  VVKDFPPFREANEGRGGIEEMDLVMVDPWCAGYHSEADAPSRRLAKPLIFCRTESDCPME  205

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            NGYARPVEG+++LVDMQNMVV+EFEDRKLVPLPPADPLRNYT
Sbjct  206  NGYARPVEGIHVLVDMQNMVVLEFEDRKLVPLPPADPLRNYT  247



>ref|XP_010678857.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   400 bits (1029),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/222 (84%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV+LVEP+K++VALADAYFFPPFQPSL+PRTK GP IPSKLP R
Sbjct  69   RAAGATPEVRDSMRFIEVALVEPEKHIVALADAYFFPPFQPSLVPRTKGGPFIPSKLPLR  128

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKK+NET  WIVELSEVHAVTRGGHHRGK+ISS V+P+VQP+MDAAEYAECEA
Sbjct  129  KARLIVYNKKTNETRIWIVELSEVHAVTRGGHHRGKIISSCVIPEVQPAMDAAEYAECEA  188

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPFREAM+KRG+ +MDLVMVD WCVGY+SEAD PSRRLAKPLIFCRTESDCPMEN
Sbjct  189  VVKDYPPFREAMRKRGVENMDLVMVDPWCVGYHSEADIPSRRLAKPLIFCRTESDCPMEN  248

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYA+PVEG+++LVD+QNMV++EFEDRKLVPLP  DPLRNYTP
Sbjct  249  GYAQPVEGIHVLVDLQNMVILEFEDRKLVPLPSPDPLRNYTP  290



>ref|XP_006293724.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
 gb|EOA26622.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
Length=771

 Score =   402 bits (1034),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/222 (86%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRD MRF EV+ VEPDK+VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR
Sbjct  93   RAAGANPEVRDGMRFIEVASVEPDKHVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPR  152

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYN+KSN TS WIVELSEVHAVTRGGHHRGKV+SS+++PDVQP MDAAEYAECEA
Sbjct  153  RARLVVYNQKSNVTSVWIVELSEVHAVTRGGHHRGKVVSSEIIPDVQPPMDAAEYAECEA  212

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  213  IVKDFPPFIEAMKRRGIEDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  272

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  273  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  314



>ref|XP_009133538.1| PREDICTED: copper amine oxidase 1-like [Brassica rapa]
Length=757

 Score =   402 bits (1032),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/222 (86%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRDSMRF EV+ VEP+K+VVALADAYFFPPFQPSLLPR K GPVIP KLPPR
Sbjct  78   RAAGANPEVRDSMRFIEVASVEPEKHVVALADAYFFPPFQPSLLPRNKSGPVIPMKLPPR  137

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK SNETS WIVELS VHAVTRGGHHRG+V+SS+V+PDVQP MDA EYAECEA
Sbjct  138  RARLVVYNKTSNETSVWIVELSSVHAVTRGGHHRGRVVSSQVIPDVQPPMDAEEYAECEA  197

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SDCPMEN
Sbjct  198  IVKDFPPFIEAMKRRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDCPMEN  257

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  258  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  299



>gb|KEH27747.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=714

 Score =   400 bits (1029),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/222 (87%), Positives = 207/222 (93%), Gaps = 1/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKG-PVIPSKLPP  177
            RAAGATPEVRDSMRF EV LVEP K VVALADAYFFPPFQPSLLPRTK G P+IP+KLP 
Sbjct  62   RAAGATPEVRDSMRFVEVVLVEPVKQVVALADAYFFPPFQPSLLPRTKGGGPLIPTKLPT  121

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            R+ARLVVYNKKSNETS WIVEL EVHA TRGG HRGKVISS+VVP+VQP MDA EYAECE
Sbjct  122  RKARLVVYNKKSNETSVWIVELREVHAATRGGPHRGKVISSQVVPNVQPPMDAMEYAECE  181

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            AVVKDFPPFREAMK+RGI DMDLVMVDAWCVGY+SEADAP+RRLAKPLIFCR+ESDCPME
Sbjct  182  AVVKDFPPFREAMKRRGIEDMDLVMVDAWCVGYHSEADAPNRRLAKPLIFCRSESDCPME  241

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            NGYARPVEG+Y+LVDMQNMVV+EFEDRKL+PLPP DPLRNYT
Sbjct  242  NGYARPVEGIYVLVDMQNMVVLEFEDRKLIPLPPTDPLRNYT  283



>gb|EYU22171.1| hypothetical protein MIMGU_mgv1a001639mg [Erythranthe guttata]
Length=781

 Score =   402 bits (1032),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 191/221 (86%), Positives = 206/221 (93%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP+K VVALADAYFFPPFQPSLLPRTK GP IPSKLPPR
Sbjct  100  RAAGATPEVRDSMRFVEVVLLEPEKQVVALADAYFFPPFQPSLLPRTKGGPAIPSKLPPR  159

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS W+VEL+EVHA TR G HRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  160  RARLIVYNKKSNETSLWVVELTEVHATTRSGLHRGKVISSKVVPDVQPPMDAVEYAECEA  219

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPF EAM+KRGI DMDLVMVD WCVGY+SEADAPSRRLAKPL+FCR ESDCP+EN
Sbjct  220  VVKDYPPFIEAMRKRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLLFCRIESDCPLEN  279

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRK+VPLPPADPLRNYT
Sbjct  280  GYARPVEGIHVLVDMQNMVVIEFEDRKIVPLPPADPLRNYT  320



>ref|XP_010678856.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   400 bits (1029),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 186/222 (84%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV+LVEP+K++VALADAYFFPPFQPSL+PRTK GP IPSKLP R
Sbjct  69   RAAGATPEVRDSMRFIEVALVEPEKHIVALADAYFFPPFQPSLVPRTKGGPFIPSKLPLR  128

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKK+NET  WIVELSEVHAVTRGGHHRGK+ISS V+P+VQP+MDAAEYAECEA
Sbjct  129  KARLIVYNKKTNETRIWIVELSEVHAVTRGGHHRGKIISSCVIPEVQPAMDAAEYAECEA  188

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPFREAM+KRG+ +MDLVMVD WCVGY+SEAD PSRRLAKPLIFCRTESDCPMEN
Sbjct  189  VVKDYPPFREAMRKRGVENMDLVMVDPWCVGYHSEADIPSRRLAKPLIFCRTESDCPMEN  248

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYA+PVEG+++LVD+QNMV++EFEDRKLVPLP  DPLRNYTP
Sbjct  249  GYAQPVEGIHVLVDLQNMVILEFEDRKLVPLPSPDPLRNYTP  290



>gb|KCW83296.1| hypothetical protein EUGRSUZ_B00228 [Eucalyptus grandis]
Length=1349

 Score =   414 bits (1064),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG+TPE+RD MRF EV L+EP K+VVALADAYFFPPFQPSLLPRTK GPV+P+KLPPR
Sbjct  91   RAAGSTPEIRDGMRFVEVVLLEPGKHVVALADAYFFPPFQPSLLPRTKSGPVLPAKLPPR  150

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKKSNETS WIVELSEVHA TRGGHHRGKVISSK++P+VQP MDA+EYAECEA
Sbjct  151  RARLIVYNKKSNETSVWIVELSEVHAATRGGHHRGKVISSKIIPNVQPPMDASEYAECEA  210

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK+FP FREAMKKRGI DMDLVMVDAWC GY+S+ADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  211  AVKEFPQFREAMKKRGIEDMDLVMVDAWCAGYHSDADAPSRRLAKPLIFCRTESDCPMEN  270

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG++ILVDMQNMVVIEFEDRKLVPLPPADPLRNYT
Sbjct  271  GYARPVEGIHILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  311



>gb|ACW82416.1| putative copper amine oxidase, partial [Olea europaea]
Length=529

 Score =   394 bits (1011),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 189/221 (86%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  4    AAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQ  183
            AAGATPEVRD MRF EV L+EPDK+VVALADAYFF PFQPSLLPRTK G  IPSKLPPR+
Sbjct  107  AAGATPEVRDGMRFIEVVLLEPDKHVVALADAYFFSPFQPSLLPRTKGGLTIPSKLPPRR  166

Query  184  ARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAV  363
            ARLVVYNKKSNETS WIVEL++VHA TRGGHHRGKVISS VV DVQP MDA EYAECEAV
Sbjct  167  ARLVVYNKKSNETSIWIVELTQVHATTRGGHHRGKVISSTVVLDVQPPMDAVEYAECEAV  226

Query  364  VKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENG  543
            VKD+PPF EAMKKRGI DMDLVMVD WCVGY+ E+D+PSRRLAKPLIFCRTESD P+ENG
Sbjct  227  VKDYPPFIEAMKKRGIDDMDLVMVDPWCVGYHRESDSPSRRLAKPLIFCRTESDRPLENG  286

Query  544  YARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            YARPVEG+++LVDMQNMVVIEFEDRK VPLPPADPLRNYTP
Sbjct  287  YARPVEGIHVLVDMQNMVVIEFEDRKFVPLPPADPLRNYTP  327



>gb|AES96091.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=737

 Score =   399 bits (1026),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/222 (87%), Positives = 207/222 (93%), Gaps = 1/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKG-PVIPSKLPP  177
            RAAGATPEVRDSMRF EV LVEP K VVALADAYFFPPFQPSLLPRTK G P+IP+KLP 
Sbjct  62   RAAGATPEVRDSMRFVEVVLVEPVKQVVALADAYFFPPFQPSLLPRTKGGGPLIPTKLPT  121

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            R+ARLVVYNKKSNETS WIVEL EVHA TRGG HRGKVISS+VVP+VQP MDA EYAECE
Sbjct  122  RKARLVVYNKKSNETSVWIVELREVHAATRGGPHRGKVISSQVVPNVQPPMDAMEYAECE  181

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            AVVKDFPPFREAMK+RGI DMDLVMVDAWCVGY+SEADAP+RRLAKPLIFCR+ESDCPME
Sbjct  182  AVVKDFPPFREAMKRRGIEDMDLVMVDAWCVGYHSEADAPNRRLAKPLIFCRSESDCPME  241

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            NGYARPVEG+Y+LVDMQNMVV+EFEDRKL+PLPP DPLRNYT
Sbjct  242  NGYARPVEGIYVLVDMQNMVVLEFEDRKLIPLPPTDPLRNYT  283



>ref|XP_003613133.1| Copper amine oxidase [Medicago truncatula]
Length=750

 Score =   400 bits (1027),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/222 (87%), Positives = 207/222 (93%), Gaps = 1/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKG-PVIPSKLPP  177
            RAAGATPEVRDSMRF EV LVEP K VVALADAYFFPPFQPSLLPRTK G P+IP+KLP 
Sbjct  62   RAAGATPEVRDSMRFVEVVLVEPVKQVVALADAYFFPPFQPSLLPRTKGGGPLIPTKLPT  121

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            R+ARLVVYNKKSNETS WIVEL EVHA TRGG HRGKVISS+VVP+VQP MDA EYAECE
Sbjct  122  RKARLVVYNKKSNETSVWIVELREVHAATRGGPHRGKVISSQVVPNVQPPMDAMEYAECE  181

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            AVVKDFPPFREAMK+RGI DMDLVMVDAWCVGY+SEADAP+RRLAKPLIFCR+ESDCPME
Sbjct  182  AVVKDFPPFREAMKRRGIEDMDLVMVDAWCVGYHSEADAPNRRLAKPLIFCRSESDCPME  241

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            NGYARPVEG+Y+LVDMQNMVV+EFEDRKL+PLPP DPLRNYT
Sbjct  242  NGYARPVEGIYVLVDMQNMVVLEFEDRKLIPLPPTDPLRNYT  283



>gb|KFK37100.1| hypothetical protein AALP_AA4G213000 [Arabis alpina]
Length=767

 Score =   400 bits (1028),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/222 (86%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRDSMRF EV+ VEP+K+VVALADAYFFPPFQPSLLPR K GPVIP KLPPR
Sbjct  88   RAAGANPEVRDSMRFIEVASVEPEKHVVALADAYFFPPFQPSLLPRNKAGPVIPMKLPPR  147

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNK SNETS WIVELSEVHAVTRGGHHRGKV+SS V+PDVQP MDAAEYAECEA
Sbjct  148  RARLIVYNKTSNETSVWIVELSEVHAVTRGGHHRGKVVSSHVIPDVQPPMDAAEYAECEA  207

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKD+PPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPL++CRT+SD PMEN
Sbjct  208  IVKDYPPFIEAMKRRGIEDMDLVMVDPWCVGYHSEADAPSRRLAKPLLYCRTDSDSPMEN  267

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG++ILVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  268  GYARPVEGIHILVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  309



>ref|XP_006438286.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51526.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=785

 Score =   400 bits (1029),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 196/231 (85%), Positives = 208/231 (90%), Gaps = 10/231 (4%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV  VEPDK VVALADAYFFPPFQPSL+PRTK GP+IP+KLPPR
Sbjct  101  RAAGATPEVRDSMRFVEVVRVEPDKQVVALADAYFFPPFQPSLIPRTKGGPIIPTKLPPR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS W+VELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  161  RARLVVYNKRSNETSIWVVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCV----------GYYSEADAPSRRLAKPLIFC  510
            VVKDFPPFREAMKKRGI DMDLVMVD W V          GY+S+ADAPSRRLAKPLIFC
Sbjct  221  VVKDFPPFREAMKKRGIEDMDLVMVDPWLVPCWDYFKLMFGYHSDADAPSRRLAKPLIFC  280

Query  511  RTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            RTESDCP+ENGYARPVEG+++LVDMQNMVVIEFEDRKLV LPPADPLRNYT
Sbjct  281  RTESDCPIENGYARPVEGIHVLVDMQNMVVIEFEDRKLVHLPPADPLRNYT  331



>ref|XP_004489782.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=761

 Score =   399 bits (1026),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 207/222 (93%), Gaps = 1/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKG-PVIPSKLPP  177
            RAAGATPEVRDSMRF EV LVEP K VVALADAYFFPPFQPSLLPRTK G P+IP+KLP 
Sbjct  86   RAAGATPEVRDSMRFVEVVLVEPVKQVVALADAYFFPPFQPSLLPRTKGGGPLIPTKLPT  145

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            R+ARLVVYNKKSNETS WIVEL EVHA TRGG HRGKVISS+VVP+VQP MDA EYAECE
Sbjct  146  RKARLVVYNKKSNETSIWIVELREVHAATRGGPHRGKVISSQVVPNVQPPMDAMEYAECE  205

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            AVVKDFPPFREAMK+RGI DMDLVMVDAWCVGY+SEAD+P+RRLAKPLIFCR+ESDCPME
Sbjct  206  AVVKDFPPFREAMKRRGIEDMDLVMVDAWCVGYHSEADSPNRRLAKPLIFCRSESDCPME  265

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            NGYARPVEG+Y+LVDMQNMVV+EFEDRKL+PLPP DPLRNYT
Sbjct  266  NGYARPVEGIYVLVDMQNMVVLEFEDRKLIPLPPTDPLRNYT  307



>emb|CDY22564.1| BnaC03g23740D [Brassica napus]
Length=1075

 Score =   406 bits (1043),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/222 (86%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRDSMRF EV+ VEP+K+VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR
Sbjct  78   RAAGANPEVRDSMRFIEVASVEPEKHVVALADAYFFPPFQPSLLPRTKAGPVIPMKLPPR  137

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK SNETS WIVELS VHAVTRGGHHRG+V+SS+V+PDVQP MDA EYAECEA
Sbjct  138  RARLVVYNKTSNETSVWIVELSSVHAVTRGGHHRGRVVSSQVIPDVQPPMDAEEYAECEA  197

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SDCPMEN
Sbjct  198  IVKDFPPFIEAMKRRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDCPMEN  257

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  258  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  299



>ref|XP_003601196.1| Primary amine oxidase [Medicago truncatula]
Length=674

 Score =   394 bits (1013),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            +RDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPR+K GPVIP+KLPPR ARLVVYN
Sbjct  4    LRDSMRFIEVVLLEPDKHVVALADAYFFPPFQPSLLPRSKGGPVIPTKLPPRCARLVVYN  63

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
            KKSNET+ WIVELS+VHAVTRGGHHRGKVISS VVPDVQP MDA EYAECEAVVK FPPF
Sbjct  64   KKSNETTLWIVELSQVHAVTRGGHHRGKVISSNVVPDVQPPMDAEEYAECEAVVKSFPPF  123

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
             EAMKKRGI DMDLVMVD WCVGY+SEADAP RRLAKPL+FCR+ESDCPMENGYARPVEG
Sbjct  124  IEAMKKRGIEDMDLVMVDPWCVGYHSEADAPGRRLAKPLLFCRSESDCPMENGYARPVEG  183

Query  565  LYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            +Y+LVDMQNMVVIEFEDRKLVPLPP DPLRNYTP
Sbjct  184  IYVLVDMQNMVVIEFEDRKLVPLPPVDPLRNYTP  217



>ref|XP_006600619.1| PREDICTED: copper amine oxidase 1-like isoform X4 [Glycine max]
Length=680

 Score =   394 bits (1012),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDS+RF EV L+EPDK+VVALADAYFF PFQPSLLPRTK G VIPS LPPR
Sbjct  71   RAAGATPELRDSIRFIEVVLLEPDKHVVALADAYFFSPFQPSLLPRTKGGAVIPSNLPPR  130

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             AR+VVYNKK+NETS WIVELS+VHAVTR GHHRGKVISS+VVPD QP MDA EYAECEA
Sbjct  131  CARIVVYNKKTNETSIWIVELSQVHAVTRRGHHRGKVISSQVVPDAQPPMDAMEYAECEA  190

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGYY+EAD P+RRL KPLIFCR ESD PMEN
Sbjct  191  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYYNEADDPNRRLTKPLIFCRGESDSPMEN  250

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQNM+VIEFEDRK VPLPP DPLR YT
Sbjct  251  GYARPVEGIYVLVDMQNMLVIEFEDRKFVPLPPVDPLRRYT  291



>emb|CDY35376.1| BnaA03g19840D [Brassica napus]
Length=1065

 Score =   404 bits (1037),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/222 (86%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRDSMRF EV+ VEP+K+VVALADAYFFPPFQPSLLPR K GPVIP KLPPR
Sbjct  78   RAAGANPEVRDSMRFIEVASVEPEKHVVALADAYFFPPFQPSLLPRNKSGPVIPMKLPPR  137

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK SNETS WIVELS VHAVTRGGHHRG+V+SS+V+PDVQP MDA EYAECEA
Sbjct  138  RARLVVYNKTSNETSVWIVELSSVHAVTRGGHHRGRVVSSQVIPDVQPPMDAEEYAECEA  197

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SDCPMEN
Sbjct  198  IVKDFPPFIEAMKRRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDCPMEN  257

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+Y+LVDMQNMVVIEFEDRK VPLPP DPLRNYTP
Sbjct  258  GYARPVEGIYVLVDMQNMVVIEFEDRKFVPLPPPDPLRNYTP  299



>ref|XP_006600618.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Glycine max]
Length=697

 Score =   394 bits (1011),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDS+RF EV L+EPDK+VVALADAYFF PFQPSLLPRTK G VIPS LPPR
Sbjct  71   RAAGATPELRDSIRFIEVVLLEPDKHVVALADAYFFSPFQPSLLPRTKGGAVIPSNLPPR  130

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             AR+VVYNKK+NETS WIVELS+VHAVTR GHHRGKVISS+VVPD QP MDA EYAECEA
Sbjct  131  CARIVVYNKKTNETSIWIVELSQVHAVTRRGHHRGKVISSQVVPDAQPPMDAMEYAECEA  190

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGYY+EAD P+RRL KPLIFCR ESD PMEN
Sbjct  191  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYYNEADDPNRRLTKPLIFCRGESDSPMEN  250

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQNM+VIEFEDRK VPLPP DPLR YT
Sbjct  251  GYARPVEGIYVLVDMQNMLVIEFEDRKFVPLPPVDPLRRYT  291



>ref|XP_006600617.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=722

 Score =   393 bits (1010),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDS+RF EV L+EPDK+VVALADAYFF PFQPSLLPRTK G VIPS LPPR
Sbjct  71   RAAGATPELRDSIRFIEVVLLEPDKHVVALADAYFFSPFQPSLLPRTKGGAVIPSNLPPR  130

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             AR+VVYNKK+NETS WIVELS+VHAVTR GHHRGKVISS+VVPD QP MDA EYAECEA
Sbjct  131  CARIVVYNKKTNETSIWIVELSQVHAVTRRGHHRGKVISSQVVPDAQPPMDAMEYAECEA  190

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGYY+EAD P+RRL KPLIFCR ESD PMEN
Sbjct  191  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYYNEADDPNRRLTKPLIFCRGESDSPMEN  250

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQNM+VIEFEDRK VPLPP DPLR YT
Sbjct  251  GYARPVEGIYVLVDMQNMLVIEFEDRKFVPLPPVDPLRRYT  291



>ref|XP_003550715.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=751

 Score =   393 bits (1009),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RDS+RF EV L+EPDK+VVALADAYFF PFQPSLLPRTK G VIPS LPPR
Sbjct  71   RAAGATPELRDSIRFIEVVLLEPDKHVVALADAYFFSPFQPSLLPRTKGGAVIPSNLPPR  130

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             AR+VVYNKK+NETS WIVELS+VHAVTR GHHRGKVISS+VVPD QP MDA EYAECEA
Sbjct  131  CARIVVYNKKTNETSIWIVELSQVHAVTRRGHHRGKVISSQVVPDAQPPMDAMEYAECEA  190

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKDFPPFREAMKKRGI DMDLVMVDAWCVGYY+EAD P+RRL KPLIFCR ESD PMEN
Sbjct  191  VVKDFPPFREAMKKRGIEDMDLVMVDAWCVGYYNEADDPNRRLTKPLIFCRGESDSPMEN  250

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQNM+VIEFEDRK VPLPP DPLR YT
Sbjct  251  GYARPVEGIYVLVDMQNMLVIEFEDRKFVPLPPVDPLRRYT  291



>ref|XP_009606421.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=786

 Score =   393 bits (1010),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/221 (83%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV L+EPDK+VVALADAYFFPPFQ SL+PRTK G +IP+KLPPR
Sbjct  107  RAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFPPFQSSLMPRTKGGSLIPTKLPPR  166

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKK+NETS WIVEL+EVHA  RGGHHRGKVISS VVPDVQP +DA EYAECEA
Sbjct  167  RARLIVYNKKTNETSIWIVELNEVHAAARGGHHRGKVISSNVVPDVQPPIDAQEYAECEA  226

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK +PPFR+AM++RGI D+DLVMVD WCVGY+SEADAPSRRLAKPL+FCRTESDCPMEN
Sbjct  227  VVKSYPPFRDAMRRRGIDDLDLVMVDPWCVGYHSEADAPSRRLAKPLVFCRTESDCPMEN  286

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVD+QNM +IEFEDRKLVPLPPADPLRNYT
Sbjct  287  GYARPVEGIYVLVDVQNMQIIEFEDRKLVPLPPADPLRNYT  327



>tpg|DAA37329.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
Length=442

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  10   GATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQAR  189
            G +PE RDSMRF E  L+EP+KNVVALADAYFFPPFQPSLLPR+K   VIPS+LPPR+AR
Sbjct  110  GRSPEERDSMRFVEAVLLEPEKNVVALADAYFFPPFQPSLLPRSKGSAVIPSRLPPRRAR  169

Query  190  LVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVK  369
            LVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+V+PDVQP+MDA EYAECEA VK
Sbjct  170  LVVYNKQSNETSIWIVELSEVHAATRGGHHRGKVISSEVIPDVQPAMDAMEYAECEATVK  229

Query  370  DFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYA  549
             +PPF EAMK+RG+ DMDLVMVDAWC GYYSEADAPSRRL KPLIFCRTESD PMENGYA
Sbjct  230  SYPPFIEAMKRRGVDDMDLVMVDAWCAGYYSEADAPSRRLGKPLIFCRTESDSPMENGYA  289

Query  550  RPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RPVEG++++VDMQN  VIEFEDRKLVPLPP D LRNYTP
Sbjct  290  RPVEGIHVVVDMQNNAVIEFEDRKLVPLPPPDHLRNYTP  328



>gb|EPS66989.1| hypothetical protein M569_07787, partial [Genlisea aurea]
Length=574

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 206/221 (93%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EP+KNVVALADAYFFPPFQPSLLPRT+ GPVIPSKLP R
Sbjct  101  RAAGATPEVRDSMRFIEVVLLEPEKNVVALADAYFFPPFQPSLLPRTRGGPVIPSKLPAR  160

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKKSNETS WIVELSEVHA TRGGHHRGKVISS VVPDVQP MDA EYAECEA
Sbjct  161  RARLVVYNKKSNETSVWIVELSEVHATTRGGHHRGKVISSTVVPDVQPPMDAVEYAECEA  220

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK+FPPF EAMKKRG+ DMD+VMVD WCVGY+SEAD+PSRRLAKPL+FCRTESD P+EN
Sbjct  221  VVKEFPPFIEAMKKRGVDDMDMVMVDPWCVGYHSEADSPSRRLAKPLVFCRTESDSPLEN  280

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNMVVIEFEDRK VPLPP DPLRNYT
Sbjct  281  GYARPVEGIHVLVDMQNMVVIEFEDRKFVPLPPVDPLRNYT  321



>ref|XP_009778427.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 gb|ABI93948.1| methylputrescine oxidase [Nicotiana tabacum]
 dbj|BAF49519.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=790

 Score =   390 bits (1002),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV LVEPDK+VVALADAYFFPPFQ SL+PRTK G  IP+KLPPR
Sbjct  111  RAAGETPEVRDGMRFIEVVLVEPDKSVVALADAYFFPPFQSSLMPRTKGGSQIPTKLPPR  170

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKK+NETS WIVEL+EVHA  RGGHHRGKVI+S VVPDVQP +DA EYAECEA
Sbjct  171  RARLIVYNKKTNETSIWIVELNEVHAAARGGHHRGKVIASNVVPDVQPPIDAQEYAECEA  230

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK +PPFR+AM++RGI D+DLVMVD WCVGY+SEADAPSRRLAKPL+FCRTESDCPMEN
Sbjct  231  VVKSYPPFRDAMRRRGIDDLDLVMVDPWCVGYHSEADAPSRRLAKPLVFCRTESDCPMEN  290

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVD+QNM +IEFEDRKLVPLPP DPLRNYT
Sbjct  291  GYARPVEGIYVLVDVQNMKIIEFEDRKLVPLPPVDPLRNYT  331



>ref|XP_007155469.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
 gb|ESW27463.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
Length=1289

 Score =   401 bits (1030),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/221 (84%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            R AG TPE+RD+MRF EV L+EPDK+VVALADAYFFPPFQPSLLPRTK+G VI SKLPPR
Sbjct  61   REAGVTPELRDNMRFIEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKEGTVISSKLPPR  120

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNKK+NETS WIVELS VH VTRGGHHRGK+ISS+VVPDVQP MDA EYAECEA
Sbjct  121  RARLVVYNKKTNETSIWIVELSHVHTVTRGGHHRGKLISSQVVPDVQPPMDAMEYAECEA  180

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+PPFREA+K RGI DMDLVMVDAWCVGYYSEAD P+RRL+KPLIFCR+ESDCPMEN
Sbjct  181  VVKDYPPFREAIKIRGIEDMDLVMVDAWCVGYYSEADGPNRRLSKPLIFCRSESDCPMEN  240

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVDMQN  VIEFEDR+ VPLPP DPLRNYT
Sbjct  241  GYARPVEGIYVLVDMQNRAVIEFEDREFVPLPPVDPLRNYT  281



>ref|XP_009404245.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   389 bits (999),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/222 (84%), Positives = 203/222 (91%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRD MRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK GPVI  KLPPR
Sbjct  95   RAAGATPEVRDGMRFIEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGGPVILGKLPPR  154

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS WIVELSEVHA TRGG HRGKVISS+VVP VQPSMDA EYAECEA
Sbjct  155  RARLVVYNKRSNETSIWIVELSEVHAATRGGRHRGKVISSEVVPVVQPSMDAMEYAECEA  214

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK   PF EAM+KRG+ DMDLVMVD+WCVG+YS+AD P+RRLA+PLIFCRTESDCPMEN
Sbjct  215  AVKSHLPFIEAMRKRGVEDMDLVMVDSWCVGFYSDADGPNRRLARPLIFCRTESDCPMEN  274

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG+++LVD+QN V+IEFEDRKLVPLPPADPLRNYTP
Sbjct  275  GYARPVEGIHVLVDIQNNVIIEFEDRKLVPLPPADPLRNYTP  316



>ref|XP_006351050.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=786

 Score =   389 bits (1000),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV L+EPDK+VVALADAYFFPPFQ SL+PR K G +IP+KLPPR
Sbjct  106  RAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFPPFQSSLMPRNKGGSLIPTKLPPR  165

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKK+NETS WIVEL+EVHA  RGGHHRGKVISS  VPDVQP +DA EYAECEA
Sbjct  166  RARLIVYNKKTNETSIWIVELTEVHAAARGGHHRGKVISSNSVPDVQPPIDAQEYAECEA  225

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPFREAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPL+FCR+ESDCPMEN
Sbjct  226  VVKNYPPFREAMKRRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLVFCRSESDCPMEN  285

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVD+QNM +IEFEDRKLVPLPP DPLRNYT
Sbjct  286  GYARPVEGIHVLVDVQNMEIIEFEDRKLVPLPPVDPLRNYT  326



>ref|XP_004244763.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=788

 Score =   389 bits (998),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV L+EPDK+VVALADAYFFPPFQ SL+PRTK G +IP+KLPPR
Sbjct  108  RAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFPPFQSSLMPRTKGGSLIPTKLPPR  167

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKK+NETS WIVEL+EVHA  RGGHHRGKVISS VVPDVQP +DA EYAECEA
Sbjct  168  RARLIVYNKKTNETSIWIVELTEVHAAARGGHHRGKVISSNVVPDVQPPIDAQEYAECEA  227

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPFREAMK+R I DMDLVMVD WCVGY+SEADAP+RRLAKPL+FCR+ESDCPMEN
Sbjct  228  VVKNYPPFREAMKRRDIDDMDLVMVDPWCVGYHSEADAPNRRLAKPLVFCRSESDCPMEN  287

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVD+QNM +IEFEDRKLVPLPP DPLRNYT
Sbjct  288  GYARPVEGIHVLVDVQNMQIIEFEDRKLVPLPPVDPLRNYT  328



>ref|XP_009618867.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=702

 Score =   385 bits (988),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV L+EPDK+VVALADAYFFPPFQ SL+ R K G  IP+KLPPR
Sbjct  87   RAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFPPFQSSLMSRRKGGLPIPTKLPPR  146

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+ YNKK+NETS WIVEL+EVHA  RGGHH+GKVISS VVPDVQP +DA EYA+CEA
Sbjct  147  RARLIAYNKKTNETSIWIVELAEVHAAARGGHHKGKVISSNVVPDVQPPIDAQEYADCEA  206

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPFREAMK+RGI DMD+VMVD WCVGY+SEADAPSRRLAKPL+FCRTESDCPMEN
Sbjct  207  VVKNYPPFREAMKRRGIDDMDVVMVDPWCVGYHSEADAPSRRLAKPLVFCRTESDCPMEN  266

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVD+QNM VIEFEDRKLVPLPPADPLRNYT
Sbjct  267  GYARPVEGIYVLVDVQNMQVIEFEDRKLVPLPPADPLRNYT  307



>ref|XP_009618866.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=723

 Score =   385 bits (989),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV L+EPDK+VVALADAYFFPPFQ SL+ R K G  IP+KLPPR
Sbjct  87   RAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFPPFQSSLMSRRKGGLPIPTKLPPR  146

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+ YNKK+NETS WIVEL+EVHA  RGGHH+GKVISS VVPDVQP +DA EYA+CEA
Sbjct  147  RARLIAYNKKTNETSIWIVELAEVHAAARGGHHKGKVISSNVVPDVQPPIDAQEYADCEA  206

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPFREAMK+RGI DMD+VMVD WCVGY+SEADAPSRRLAKPL+FCRTESDCPMEN
Sbjct  207  VVKNYPPFREAMKRRGIDDMDVVMVDPWCVGYHSEADAPSRRLAKPLVFCRTESDCPMEN  266

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVD+QNM VIEFEDRKLVPLPPADPLRNYT
Sbjct  267  GYARPVEGIYVLVDVQNMQVIEFEDRKLVPLPPADPLRNYT  307



>ref|XP_009618862.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618864.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618865.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=766

 Score =   384 bits (987),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV L+EPDK+VVALADAYFFPPFQ SL+ R K G  IP+KLPPR
Sbjct  87   RAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFPPFQSSLMSRRKGGLPIPTKLPPR  146

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+ YNKK+NETS WIVEL+EVHA  RGGHH+GKVISS VVPDVQP +DA EYA+CEA
Sbjct  147  RARLIAYNKKTNETSIWIVELAEVHAAARGGHHKGKVISSNVVPDVQPPIDAQEYADCEA  206

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPFREAMK+RGI DMD+VMVD WCVGY+SEADAPSRRLAKPL+FCRTESDCPMEN
Sbjct  207  VVKNYPPFREAMKRRGIDDMDVVMVDPWCVGYHSEADAPSRRLAKPLVFCRTESDCPMEN  266

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVD+QNM VIEFEDRKLVPLPPADPLRNYT
Sbjct  267  GYARPVEGIYVLVDVQNMQVIEFEDRKLVPLPPADPLRNYT  307



>dbj|BAF49520.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=766

 Score =   383 bits (984),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV L+EPDK+VVALADAYFFPPFQ SL+ R K G  IP+KLPPR
Sbjct  87   RAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFPPFQSSLMSRRKGGLPIPTKLPPR  146

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+ YNKK+NETS WIVEL+EVHA  RGGHH+GKVISS VVPDVQP +DA EYA+CEA
Sbjct  147  RARLIAYNKKTNETSIWIVELAEVHAAARGGHHKGKVISSNVVPDVQPPIDAQEYADCEA  206

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPFREAMK+RGI DMD+VMVD WCVGY+SEADAPSRRLAKPL+FCRTESDCPMEN
Sbjct  207  VVKNYPPFREAMKRRGIDDMDVVMVDPWCVGYHSEADAPSRRLAKPLVFCRTESDCPMEN  266

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y LVD+QNM VIEFEDRKLVPLPPADPLRNYT
Sbjct  267  GYARPVEGIYALVDVQNMQVIEFEDRKLVPLPPADPLRNYT  307



>gb|EMS61925.1| Copper methylamine oxidase [Triticum urartu]
Length=760

 Score =   382 bits (982),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/214 (84%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            VRDSMRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK GPVIPS+LPPR+ARLVVYN
Sbjct  96   VRDSMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGGPVIPSRLPPRRARLVVYN  155

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
            K++NETS W+VELSEVHA TRGGHHRGKVISS+VVPDVQP+MDA EYAECEA VKDFPPF
Sbjct  156  KQTNETSIWVVELSEVHAATRGGHHRGKVISSEVVPDVQPAMDAMEYAECEATVKDFPPF  215

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
             EAMKKRGI DM+LVMVDAWC GYYS+ADAP+RRL KPLIFCRTESD PMENGYARPVEG
Sbjct  216  IEAMKKRGIDDMELVMVDAWCAGYYSDADAPNRRLGKPLIFCRTESDSPMENGYARPVEG  275

Query  565  LYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            ++++VDMQN +VIEFED K VPLPP D LRNYTP
Sbjct  276  IHVIVDMQNNIVIEFEDSKFVPLPPPDHLRNYTP  309



>ref|XP_002448036.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
 gb|EES12364.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
Length=782

 Score =   383 bits (983),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  10   GATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQAR  189
            G +PE RDSMRF EV L+EP+KNVVALADAYFFPPFQPSLLPR+K   VIPS+LPPR+AR
Sbjct  112  GRSPEERDSMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRSKGSAVIPSRLPPRRAR  171

Query  190  LVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVK  369
            LVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP+MDA EYAECEA VK
Sbjct  172  LVVYNKQSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPDVQPAMDAMEYAECEATVK  231

Query  370  DFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYA  549
             +PPF EAMK+RG+ DMDLVMVDAWC GYYSEADAPSRRL KPLIFCRTESD PMENGYA
Sbjct  232  SYPPFIEAMKRRGVDDMDLVMVDAWCAGYYSEADAPSRRLGKPLIFCRTESDSPMENGYA  291

Query  550  RPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RPVEG++++VDMQN  VIEFEDRKLVPLPP D LRNYTP
Sbjct  292  RPVEGIHVVVDMQNNAVIEFEDRKLVPLPPPDHLRNYTP  330



>emb|CAH67316.1| OSIGBa0106G07.12 [Oryza sativa Indica Group]
Length=699

 Score =   380 bits (977),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/222 (81%), Positives = 200/222 (90%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG +PE RD MRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR
Sbjct  26   RAAGKSPEERDGMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +A+L VYN++SNETS WIVELSEVHA TRGGHHRGKVISS+VVP+VQP+MDA EYAECEA
Sbjct  86   RAKLTVYNRQSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPEVQPAMDAMEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK +PPF EAMK+RG+ DM+LVMVDAWC GYYS+ADAPSRRL KPLIFCRT+SD PMEN
Sbjct  146  TVKSYPPFIEAMKRRGVDDMELVMVDAWCAGYYSDADAPSRRLGKPLIFCRTDSDSPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG++++VDMQN VVIEFEDRKLVPLPP D LRNYTP
Sbjct  206  GYARPVEGIHVIVDMQNNVVIEFEDRKLVPLPPPDHLRNYTP  247



>emb|CAE05498.2| OSJNBa0022H21.18 [Oryza sativa Japonica Group]
Length=699

 Score =   380 bits (976),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/222 (81%), Positives = 200/222 (90%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG +PE RD MRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR
Sbjct  26   RAAGKSPEERDGMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPR  85

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +A+L VYN++SNETS WIVELSEVHA TRGGHHRGKVISS+VVP+VQP+MDA EYAECEA
Sbjct  86   RAKLTVYNRQSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPEVQPAMDAMEYAECEA  145

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK +PPF EAMK+RG+ DM+LVMVDAWC GYYS+ADAPSRRL KPLIFCRT+SD PMEN
Sbjct  146  TVKSYPPFIEAMKRRGVDDMELVMVDAWCAGYYSDADAPSRRLGKPLIFCRTDSDSPMEN  205

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG++++VDMQN VVIEFEDRKLVPLPP D LRNYTP
Sbjct  206  GYARPVEGIHVIVDMQNNVVIEFEDRKLVPLPPPDHLRNYTP  247



>gb|EMT09520.1| Copper methylamine oxidase [Aegilops tauschii]
Length=808

 Score =   383 bits (984),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            R      +VRDSMRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK GPVIPS+LPPR
Sbjct  136  RGGHHRGKVRDSMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGGPVIPSRLPPR  195

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK++NETS W+VELSEVHA TRGGHHRGKVISS+VVPDVQP+MDA EYAECEA
Sbjct  196  RARLVVYNKQTNETSIWVVELSEVHAATRGGHHRGKVISSEVVPDVQPAMDAMEYAECEA  255

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VKDFPPF EAMKKRGI DM+LVMVDAWC GYYS+ADAP+RRL KPLIFCRTESD PMEN
Sbjct  256  TVKDFPPFIEAMKKRGIDDMELVMVDAWCAGYYSDADAPNRRLGKPLIFCRTESDNPMEN  315

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG++++VDMQN VVIEFEDRK VPLPP D LRNYT
Sbjct  316  GYARPVEGIHVIVDMQNNVVIEFEDRKFVPLPPPDHLRNYT  356


 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 99/130 (76%), Gaps = 7/130 (5%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            VRDSMRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK GPVIPS+LPPR+ARL VYN
Sbjct  56   VRDSMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGGPVIPSRLPPRRARLDVYN  115

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDV---QPSMDAAEYAECEAVVKDF  375
            K++NETS W+VELSEVHA TRGGHHRGKV  S    +V   +P  +    A+       F
Sbjct  116  KQTNETSIWVVELSEVHAATRGGHHRGKVRDSMRFVEVVLLEPEKNVVALADAYF----F  171

Query  376  PPFREAMKKR  405
            PPF+ ++  R
Sbjct  172  PPFQPSLLPR  181



>ref|XP_008668433.1| PREDICTED: uncharacterized protein LOC100383438 isoform X1 [Zea 
mays]
 tpg|DAA37327.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
 tpg|DAA37328.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
Length=780

 Score =   381 bits (978),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  10   GATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQAR  189
            G +PE RDSMRF E  L+EP+KNVVALADAYFFPPFQPSLLPR+K   VIPS+LPPR+AR
Sbjct  110  GRSPEERDSMRFVEAVLLEPEKNVVALADAYFFPPFQPSLLPRSKGSAVIPSRLPPRRAR  169

Query  190  LVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVK  369
            LVVYNK+SNETS WIVELSEVHA TRGGHHRGKVISS+V+PDVQP+MDA EYAECEA VK
Sbjct  170  LVVYNKQSNETSIWIVELSEVHAATRGGHHRGKVISSEVIPDVQPAMDAMEYAECEATVK  229

Query  370  DFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYA  549
             +PPF EAMK+RG+ DMDLVMVDAWC GYYSEADAPSRRL KPLIFCRTESD PMENGYA
Sbjct  230  SYPPFIEAMKRRGVDDMDLVMVDAWCAGYYSEADAPSRRLGKPLIFCRTESDSPMENGYA  289

Query  550  RPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RPVEG++++VDMQN  VIEFEDRKLVPLPP D LRNYTP
Sbjct  290  RPVEGIHVVVDMQNNAVIEFEDRKLVPLPPPDHLRNYTP  328



>ref|XP_009773282.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 ref|XP_009773283.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
Length=774

 Score =   380 bits (977),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 179/221 (81%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV L+EPDK+V+ALADAYFFPPFQ SL+ R K G  IP+KLPPR
Sbjct  95   RAAGETPEVRDGMRFIEVVLLEPDKSVIALADAYFFPPFQSSLMSRRKGGLPIPTKLPPR  154

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKK+NETS WIVEL+EVHA  RGGHH+GKVISS VVPDVQP +DA EYA+CEA
Sbjct  155  RARLIVYNKKTNETSIWIVELAEVHAAARGGHHKGKVISSYVVPDVQPPIDAQEYADCEA  214

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPFREAMK+RGI DMDLVMVD WCVG++SEADAPSRRLAKPL+FCR+ESDCPMEN
Sbjct  215  VVKNYPPFREAMKRRGIDDMDLVMVDPWCVGFHSEADAPSRRLAKPLVFCRSESDCPMEN  274

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+Y+LVD+Q M VIEFEDRKLVPLPPADPLRNYT
Sbjct  275  GYARPVEGIYVLVDVQKMQVIEFEDRKLVPLPPADPLRNYT  315



>ref|XP_004975956.1| PREDICTED: copper amine oxidase 1-like [Setaria italica]
Length=781

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 196/219 (89%), Gaps = 0/219 (0%)
 Frame = +1

Query  10   GATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQAR  189
            G +PE RDSMRF E  L+EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR+AR
Sbjct  110  GRSPEERDSMRFVEAVLLEPNKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPRRAR  169

Query  190  LVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVK  369
            LVVYNK+SNETS WIVELSEVHA TRGGHHRGKVIS++VVPDVQP+MDA EYAECEA VK
Sbjct  170  LVVYNKQSNETSIWIVELSEVHAATRGGHHRGKVISAEVVPDVQPAMDAMEYAECEATVK  229

Query  370  DFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYA  549
             +PPF EAMK+RG+ DMDLVMVDAWC GYY EADAPSRRL KPLIFCRTESD PMENGYA
Sbjct  230  SYPPFIEAMKRRGVDDMDLVMVDAWCAGYYGEADAPSRRLGKPLIFCRTESDSPMENGYA  289

Query  550  RPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RPVEG++++VDMQN  VIEFEDRKLVPLPP D LRNYTP
Sbjct  290  RPVEGIHVVVDMQNNTVIEFEDRKLVPLPPPDHLRNYTP  328



>gb|EAY94528.1| hypothetical protein OsI_16305 [Oryza sativa Indica Group]
Length=787

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/222 (81%), Positives = 200/222 (90%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG +PE RD MRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR
Sbjct  114  RAAGKSPEERDGMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPR  173

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +A+L VYN++SNETS WIVELSEVHA TRGGHHRGKVISS+VVP+VQP+MDA EYAECEA
Sbjct  174  RAKLTVYNRQSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPEVQPAMDAMEYAECEA  233

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK +PPF EAMK+RG+ DM+LVMVDAWC GYYS+ADAPSRRL KPLIFCRT+SD PMEN
Sbjct  234  TVKSYPPFIEAMKRRGVDDMELVMVDAWCAGYYSDADAPSRRLGKPLIFCRTDSDSPMEN  293

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG++++VDMQN VVIEFEDRKLVPLPP D LRNYTP
Sbjct  294  GYARPVEGIHVIVDMQNNVVIEFEDRKLVPLPPPDHLRNYTP  335



>gb|KHN18421.1| Copper methylamine oxidase [Glycine soja]
Length=711

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  4    AAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQ  183
            AA  +  +RDS+RF EV L+EPDK+VVALADAYFF PFQPSLLPRTK G VIPS LPPR 
Sbjct  60   AAEISVALRDSIRFIEVVLLEPDKHVVALADAYFFSPFQPSLLPRTKGGAVIPSNLPPRC  119

Query  184  ARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAV  363
            AR+VVYNKK+NETS WIVELS+VHAVTR GHHRGKVISS+VVPD QP MDA EYAECEAV
Sbjct  120  ARIVVYNKKTNETSIWIVELSQVHAVTRRGHHRGKVISSQVVPDAQPPMDAMEYAECEAV  179

Query  364  VKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENG  543
            VKDFPPFREAMKKRGI DMDLVMVDAWCVGYY+EAD P+RRL KPLIFCR ESD PMENG
Sbjct  180  VKDFPPFREAMKKRGIEDMDLVMVDAWCVGYYNEADDPNRRLTKPLIFCRGESDSPMENG  239

Query  544  YARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            YARPVEG+Y+LVDMQNM+VIEFEDRK VPLPP DPLR YT
Sbjct  240  YARPVEGIYVLVDMQNMLVIEFEDRKFVPLPPVDPLRRYT  279



>gb|EAZ31082.1| hypothetical protein OsJ_15179 [Oryza sativa Japonica Group]
Length=838

 Score =   381 bits (978),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 179/222 (81%), Positives = 200/222 (90%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG +PE RD MRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR
Sbjct  165  RAAGKSPEERDGMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPR  224

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +A+L VYN++SNETS WIVELSEVHA TRGGHHRGKVISS+VVP+VQP+MDA EYAECEA
Sbjct  225  RAKLTVYNRQSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPEVQPAMDAMEYAECEA  284

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
             VK +PPF EAMK+RG+ DM+LVMVDAWC GYYS+ADAPSRRL KPLIFCRT+SD PMEN
Sbjct  285  TVKSYPPFIEAMKRRGVDDMELVMVDAWCAGYYSDADAPSRRLGKPLIFCRTDSDSPMEN  344

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVEG++++VDMQN VVIEFEDRKLVPLPP D LRNYTP
Sbjct  345  GYARPVEGIHVIVDMQNNVVIEFEDRKLVPLPPPDHLRNYTP  386



>ref|XP_006652410.1| PREDICTED: copper amine oxidase 1-like [Oryza brachyantha]
Length=699

 Score =   377 bits (968),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  10   GATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQAR  189
            G +PE RD MRF E  L+EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR+A+
Sbjct  29   GKSPEERDGMRFVEAVLLEPEKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPRRAK  88

Query  190  LVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVK  369
            L VYN++SNETS WIVELSEVHA TRGGHHRGKVISS+VVPDVQP+MDA EYAECEA VK
Sbjct  89   LTVYNRQSNETSIWIVELSEVHAATRGGHHRGKVISSEVVPDVQPAMDAMEYAECEATVK  148

Query  370  DFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYA  549
             +PPF EAMK+RG+ DM+LVMVDAWC GYYS+ADAPSRRLAKPLIFCRTESD PMENGYA
Sbjct  149  SYPPFIEAMKRRGVDDMELVMVDAWCAGYYSDADAPSRRLAKPLIFCRTESDSPMENGYA  208

Query  550  RPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RPVEG++++VDMQN VVIEFEDRKLVPLPP D LRNYTP
Sbjct  209  RPVEGIHVVVDMQNNVVIEFEDRKLVPLPPPDHLRNYTP  247



>gb|EMS63127.1| Primary amine oxidase [Triticum urartu]
Length=735

 Score =   378 bits (970),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  10   GATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQAR  189
            G +PE RDSMRF E  L+EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR+A+
Sbjct  63   GKSPEERDSMRFVEAVLLEPEKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPRRAK  122

Query  190  LVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVK  369
            LVVYN+ SNET+ WIVELSEVHA TRGGHHRGKVISS+VVPDVQP+MDA EYAECEA VK
Sbjct  123  LVVYNRHSNETTIWIVELSEVHAATRGGHHRGKVISSEVVPDVQPAMDAMEYAECEATVK  182

Query  370  DFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYA  549
            ++PPF EAMKKRG+ DM+LVMVDAWC GYYS+ADAPSRRLA+PLIFCRTESD PMENGYA
Sbjct  183  NYPPFVEAMKKRGVDDMELVMVDAWCAGYYSDADAPSRRLARPLIFCRTESDSPMENGYA  242

Query  550  RPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RPVEG++++VDMQN +VIEFEDRK VPLPP D LRNYTP
Sbjct  243  RPVEGIHVVVDMQNNIVIEFEDRKFVPLPPPDHLRNYTP  281



>ref|XP_010322539.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=774

 Score =   375 bits (964),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 197/221 (89%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV L+EPDK  VALADAYF+PPFQ SL+PRTK G ++PSKLPPR
Sbjct  95   RAAGDTPEVRDGMRFVEVVLLEPDKTFVALADAYFYPPFQSSLMPRTKGGLLVPSKLPPR  154

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
             ARL+VYNKK+NETS WIV L+EVHA  RGG HRGKVISSKV+PDVQP MDA EYA+CE+
Sbjct  155  HARLIVYNKKTNETSVWIVRLTEVHAAVRGGQHRGKVISSKVIPDVQPPMDAQEYADCES  214

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLIFCRTES CPMEN
Sbjct  215  VVKNYPPFIEAMKRRGIDDMDLVMVDPWCVGYHSEADAPSRRLAKPLIFCRTESYCPMEN  274

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVD+Q M VIEFEDRKLVPL PADPLRNYT
Sbjct  275  GYARPVEGIHVLVDVQIMQVIEFEDRKLVPLLPADPLRNYT  315



>gb|AAD23730.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAM15387.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=759

 Score =   375 bits (962),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGA PEVRD MRF EV+ VEPDK VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR
Sbjct  98   RAAGANPEVRDGMRFIEVASVEPDKQVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPR  157

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYN+KSNETS WIV LSEVHAVTRGGHHRG+V+SS+V+PDVQP MDAAEYAECEA
Sbjct  158  RARLVVYNQKSNETSVWIVALSEVHAVTRGGHHRGRVVSSQVIPDVQPPMDAAEYAECEA  217

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            +VKDFPPF EAMK+RGI DMDLVMVD WCVGY+SEADAPSRRLAKPLI+CRT+SD PMEN
Sbjct  218  IVKDFPPFIEAMKRRGIEDMDLVMVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMEN  277

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRK  621
            GYARPVEG+Y+LVDMQNMVVIEFEDR+
Sbjct  278  GYARPVEGIYVLVDMQNMVVIEFEDRE  304



>ref|XP_006347431.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=769

 Score =   374 bits (961),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 197/221 (89%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAG TPEVRD MRF EV L+EPDK  VALADAYF+PPFQ SLLPRTK G ++PSKLPPR
Sbjct  90   RAAGDTPEVRDGMRFVEVVLLEPDKTFVALADAYFYPPFQSSLLPRTKGGLLVPSKLPPR  149

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARL+VYNKK+NETS WIV+L+E HA  RGG HRGKVISSKVVPDVQP MDA EYAECE+
Sbjct  150  RARLIVYNKKTNETSIWIVQLTEAHAAARGGQHRGKVISSKVVPDVQPPMDAQEYAECES  209

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPF EAMK+RGI DM LVMVD WCVGY+SEADAPSRRLAKPL+FCR ESDCPMEN
Sbjct  210  VVKNYPPFIEAMKRRGIDDMYLVMVDPWCVGYHSEADAPSRRLAKPLVFCRAESDCPMEN  269

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARP+EG+++LVD+Q M VIEFEDRKLVPL PADPLRNYT
Sbjct  270  GYARPIEGIHVLVDVQIMQVIEFEDRKLVPLLPADPLRNYT  310



>ref|XP_003581353.1| PREDICTED: copper amine oxidase 1-like [Brachypodium distachyon]
Length=771

 Score =   374 bits (959),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  10   GATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQAR  189
            G +PE RDSMRF E  L+EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR+A+
Sbjct  100  GKSPEERDSMRFVEAVLLEPEKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPRRAK  159

Query  190  LVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVK  369
            LVVYN+ SNET+ WIVELSEVHA TRGGHHRGKVISS VVPDVQP+MDA EYAECEA VK
Sbjct  160  LVVYNRHSNETTIWIVELSEVHAATRGGHHRGKVISSAVVPDVQPAMDAMEYAECEATVK  219

Query  370  DFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYA  549
            ++PPF EAMK+RG+ DM+LVMVDAWC GYY++AD+PSRRLA+PLIFCRTESD PMENGYA
Sbjct  220  NYPPFIEAMKRRGVDDMELVMVDAWCAGYYTDADSPSRRLARPLIFCRTESDSPMENGYA  279

Query  550  RPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RPVEG++++VDMQN VVIEFEDRK VPLPP D LRNYTP
Sbjct  280  RPVEGIHVVVDMQNDVVIEFEDRKFVPLPPPDHLRNYTP  318



>ref|XP_001759255.1| predicted protein [Physcomitrella patens]
 gb|EDQ75939.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   371 bits (952),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 196/223 (88%), Gaps = 1/223 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLL-PRTKKGPVIPSKLPP  177
            RAAGATPEVRD MRF EV L EPDKNVVALADAYFFPP+QP+L  P+ K G + P +LPP
Sbjct  33   RAAGATPEVRDGMRFVEVVLNEPDKNVVALADAYFFPPYQPTLYRPKAKGGAMYPLQLPP  92

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            RQARLVVYNK++N+TS W+VELSEVHA  RGGHHRGKV++S+VVPDVQP MDA EYAECE
Sbjct  93   RQARLVVYNKRTNQTSIWMVELSEVHATARGGHHRGKVLTSEVVPDVQPPMDAMEYAECE  152

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            AVVK++PPF EAMKKRGI DMDLVMVD WCVGYY E D+PSRRL +PLIFCRTESDCP+E
Sbjct  153  AVVKEYPPFVEAMKKRGIEDMDLVMVDPWCVGYYGEEDSPSRRLGRPLIFCRTESDCPLE  212

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            NGYARPVEG+++LVDM+ M VIEFEDR  VPLPP DPLRNYTP
Sbjct  213  NGYARPVEGIHVLVDMRQMQVIEFEDRNFVPLPPPDPLRNYTP  255



>ref|XP_001757203.1| predicted protein [Physcomitrella patens]
 gb|EDQ78062.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   366 bits (939),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 193/222 (87%), Gaps = 1/222 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLL-PRTKKGPVIPSKLPP  177
            RAAGATPEVRD MRF EV L EPDKNVVALADAYFFPP+QP+L  P+ K G + P +LPP
Sbjct  33   RAAGATPEVRDGMRFVEVVLNEPDKNVVALADAYFFPPYQPTLYRPKAKGGAMYPLQLPP  92

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            RQARLVVYNK++NETS W+VELSEVHA  RGGHHRGKV SS  VPDVQP MDA EYAECE
Sbjct  93   RQARLVVYNKRTNETSIWVVELSEVHATARGGHHRGKVFSSVNVPDVQPPMDAMEYAECE  152

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            A+VK++PPF EAMKKRGI DMDLVMVD WCVGYY E D+PSRRL +PLIFCRTESDCP+E
Sbjct  153  ALVKEYPPFVEAMKKRGIEDMDLVMVDPWCVGYYGEEDSPSRRLGRPLIFCRTESDCPLE  212

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            NGYARPVEG+++LVDM++M VIEFEDR  VPLPP DPLRNYT
Sbjct  213  NGYARPVEGIHVLVDMRHMQVIEFEDRNFVPLPPPDPLRNYT  254



>gb|ABR16250.1| unknown [Picea sitchensis]
Length=788

 Score =   365 bits (938),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPE+RD MRF EV L EPDK+VVALADAYFFPPFQPSLLP+TK GPVIP +LPPR
Sbjct  116  RAAGATPEMRDGMRFIEVVLKEPDKHVVALADAYFFPPFQPSLLPKTKGGPVIPRQLPPR  175

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QAR++VYNK+SNETS WIVEL EVHA  RGGHHRGKVISSKV+ DVQP MDA EYA+CE+
Sbjct  176  QARIIVYNKRSNETSVWIVELLEVHAAARGGHHRGKVISSKVIEDVQPPMDAMEYADCES  235

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVKD+ PFREAMKKRGI DMDLVMVD WCVGYY E DAPSRRLA+PLIFCRTESDCP+EN
Sbjct  236  VVKDYRPFREAMKKRGIDDMDLVMVDPWCVGYYMEEDAPSRRLARPLIFCRTESDCPLEN  295

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQ M V+EFED+KL+PLPP DPLRNYT
Sbjct  296  GYARPVEGIHVLVDMQKMEVVEFEDQKLIPLPPPDPLRNYT  336



>ref|XP_010251089.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nelumbo nucifera]
Length=740

 Score =   361 bits (926),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 179/222 (81%), Positives = 188/222 (85%), Gaps = 26/222 (12%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV L+EPDKNVVALADAYFFPPFQPSLLP++K GPVIPSKLPPR
Sbjct  93   RAAGATPEVRDSMRFIEVVLLEPDKNVVALADAYFFPPFQPSLLPKSKGGPVIPSKLPPR  152

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +ARLVVYNK+SNETS W+VELSEVHA TRGGHHRGKVISSKVVPDVQP MDA EYAECEA
Sbjct  153  RARLVVYNKRSNETSIWVVELSEVHAATRGGHHRGKVISSKVVPDVQPPMDAVEYAECEA  212

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK++PPFREAMKKRGI DMDLVMVDAWCVGY+SEADAPSRRLAKPLIFCRTESDCPMEN
Sbjct  213  VVKEYPPFREAMKKRGIEDMDLVMVDAWCVGYHSEADAPSRRLAKPLIFCRTESDCPMEN  272

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GYARPVE                          ADPLRNYTP
Sbjct  273  GYARPVE--------------------------ADPLRNYTP  288



>gb|EEC76708.1| hypothetical protein OsI_14715 [Oryza sativa Indica Group]
Length=729

 Score =   351 bits (901),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 194/224 (87%), Gaps = 3/224 (1%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            +AA +TPEVRD MRF EV+L+EP+KNVVALADAYFF PFQPSLLP  +  P+I +KLPPR
Sbjct  37   KAAASTPEVRDGMRFVEVALLEPEKNVVALADAYFFRPFQPSLLPGNRNAPIIATKLPPR  96

Query  181  QARLVVYNKKSNETSFWIVELSEVHAV--TRGGHHRG-KVISSKVVPDVQPSMDAAEYAE  351
            +A+LVVYN+++NETS WIVE SEVHA   TRGGHHRG K++SS+VVPDVQP+MDA E+ E
Sbjct  97   RAKLVVYNRQTNETSIWIVEFSEVHADSDTRGGHHRGGKLVSSEVVPDVQPAMDAMEFVE  156

Query  352  CEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCP  531
            CEA VK  PPF EAM+KRGI DMDLV VD WC GYYS+ADAPSRR+AKPL+FCRTESD P
Sbjct  157  CEATVKSHPPFIEAMRKRGIDDMDLVTVDPWCAGYYSDADAPSRRIAKPLVFCRTESDNP  216

Query  532  MENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            +ENGYARPVEG++I+VDMQ   VIEFEDRKLVPLPP+D LRNYT
Sbjct  217  IENGYARPVEGIHIIVDMQKNTVIEFEDRKLVPLPPSDHLRNYT  260



>emb|CAE02362.2| OSJNBb0016B03.15 [Oryza sativa Japonica Group]
Length=792

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 195/224 (87%), Gaps = 3/224 (1%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            +AA +TPEVRD MRF EV+L+EP+KNVVALADAYFFPPFQPSLLP  +  P+IP+KLPP 
Sbjct  127  KAAASTPEVRDGMRFVEVALLEPEKNVVALADAYFFPPFQPSLLPGNRNAPIIPTKLPPS  186

Query  181  QARLVVYNKKSNETSFWIVELSEVHAV--TRGGHHRG-KVISSKVVPDVQPSMDAAEYAE  351
            +A+LVVYN+++NETS WIVE SEVHA   TRGG+ RG K++SS+VVPDVQP+MDA E+ E
Sbjct  187  RAKLVVYNRQTNETSIWIVEFSEVHADSDTRGGYERGGKLVSSEVVPDVQPAMDAMEFVE  246

Query  352  CEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCP  531
            CEA VK  PPF EAM+KRGI DMDLV VD WC GYYS+ADAPSRR+AKPL+FCRTESD P
Sbjct  247  CEATVKSHPPFIEAMRKRGIDDMDLVTVDPWCAGYYSDADAPSRRIAKPLVFCRTESDNP  306

Query  532  MENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            +ENGYARPVEG++I+VDMQN  VIEFEDRKLVPLPP+D LRNYT
Sbjct  307  IENGYARPVEGVHIIVDMQNNTVIEFEDRKLVPLPPSDHLRNYT  350



>gb|EAZ29581.1| hypothetical protein OsJ_13655 [Oryza sativa Japonica Group]
Length=819

 Score =   351 bits (901),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 195/224 (87%), Gaps = 3/224 (1%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            +AA +TPEVRD MRF EV+L+EP+KNVVALADAYFFPPFQPSLLP  +  P+IP+KLPP 
Sbjct  127  KAAASTPEVRDGMRFVEVALLEPEKNVVALADAYFFPPFQPSLLPGNRNAPIIPTKLPPS  186

Query  181  QARLVVYNKKSNETSFWIVELSEVHAV--TRGGHHRG-KVISSKVVPDVQPSMDAAEYAE  351
            +A+LVVYN+++NETS WIVE SEVHA   TRGG+ RG K++SS+VVPDVQP+MDA E+ E
Sbjct  187  RAKLVVYNRQTNETSIWIVEFSEVHADSDTRGGYERGGKLVSSEVVPDVQPAMDAMEFVE  246

Query  352  CEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCP  531
            CEA VK  PPF EAM+KRGI DMDLV VD WC GYYS+ADAPSRR+AKPL+FCRTESD P
Sbjct  247  CEATVKSHPPFIEAMRKRGIDDMDLVTVDPWCAGYYSDADAPSRRIAKPLVFCRTESDNP  306

Query  532  MENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            +ENGYARPVEG++I+VDMQN  VIEFEDRKLVPLPP+D LRNYT
Sbjct  307  IENGYARPVEGVHIIVDMQNNTVIEFEDRKLVPLPPSDHLRNYT  350



>emb|CDP13212.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   338 bits (868),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 188/221 (85%), Gaps = 19/221 (9%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            RAAGATPEVRDSMRF EV LVEP KNVVALADAYFFPPFQP                   
Sbjct  26   RAAGATPEVRDSMRFIEVGLVEPPKNVVALADAYFFPPFQP-------------------  66

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            QARLVVYNKKSN TS WIVELSEVHAVTRGGHHRGKVISS +VP+VQP MDA EYAECEA
Sbjct  67   QARLVVYNKKSNATSIWIVELSEVHAVTRGGHHRGKVISSTIVPNVQPPMDAVEYAECEA  126

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMEN  540
            VVK+FP FREAMKKRGI DMDLVMVD WCVGYY EADAP+RRLAKPLIFCRTESDCPMEN
Sbjct  127  VVKEFPAFREAMKKRGIEDMDLVMVDPWCVGYYGEADAPNRRLAKPLIFCRTESDCPMEN  186

Query  541  GYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            GYARPVEG+++LVDMQNM V+EFEDR++VPLPP DPLRNYT
Sbjct  187  GYARPVEGIHVLVDMQNMAVLEFEDRRVVPLPPPDPLRNYT  227



>ref|XP_001774529.1| predicted protein [Physcomitrella patens]
 gb|EDQ60597.1| predicted protein [Physcomitrella patens]
Length=705

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 188/223 (84%), Gaps = 1/223 (0%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPS-KLPP  177
            RAAG TPEVRD MRF EV L EPDKNVVA+ADAYFFPP+QP L     K  + PS +LP 
Sbjct  28   RAAGETPEVRDGMRFVEVVLNEPDKNVVAMADAYFFPPYQPMLFKPKGKPTIYPSLQLPH  87

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            RQARLVVYNK++N TS W+VELSEVHA  RGGHHRGKV+SS ++PDVQP MDA EYAECE
Sbjct  88   RQARLVVYNKRTNVTSVWVVELSEVHAAARGGHHRGKVMSSDIIPDVQPPMDAVEYAECE  147

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            A VK+ P F EAMKKRGI DMDLVMVD WCVGYYSE D+PSRRLA+PLIFCRTESDCP+E
Sbjct  148  ATVKEHPSFVEAMKKRGIEDMDLVMVDPWCVGYYSEEDSPSRRLARPLIFCRTESDCPLE  207

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            NGYARPVEG+++LVDMQ M VIE EDR LVPLPP DPLRNYTP
Sbjct  208  NGYARPVEGIHVLVDMQKMEVIECEDRYLVPLPPPDPLRNYTP  250



>ref|XP_002977869.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
 gb|EFJ21207.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
Length=797

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSL-LPRTKKG-PVIPSKLP  174
            R AG + E+RD+MRF EV L EP+K+VVALADA+FFPP+ P+  L  T KG P+IP +LP
Sbjct  99   RGAGKSAEIRDAMRFVEVVLNEPEKDVVALADAHFFPPYHPAQGLRTTAKGLPLIPFQLP  158

Query  175  PRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAEC  354
            PRQA+L VYN  SNETS WIVEL+EVHA+TRGGH +GKVIS + + DVQP+ DA EYA C
Sbjct  159  PRQAKLTVYNVASNETSIWIVELTEVHALTRGGHRKGKVISCETLTDVQPAFDAEEYALC  218

Query  355  EAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPM  534
            EA +K + PF EA+KKRGI +MDLVMVD WCVGY+ E DAPS+RLAKPLIFCRTESDCP+
Sbjct  219  EAAIKAYKPFVEAVKKRGIENMDLVMVDPWCVGYFGERDAPSKRLAKPLIFCRTESDCPI  278

Query  535  ENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            ENGYARP+EG++ILVD+Q+M ++EFED + VPLPP DPLRNYTP
Sbjct  279  ENGYARPLEGIHILVDLQHMRILEFEDLEFVPLPPPDPLRNYTP  322



>ref|XP_001753509.1| predicted protein [Physcomitrella patens]
 gb|EDQ81732.1| predicted protein [Physcomitrella patens]
Length=668

 Score =   319 bits (817),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 172/209 (82%), Gaps = 0/209 (0%)
 Frame = +1

Query  37   MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKKSN  216
            MRF EV L EP+K+VVA+ADAYFFPP+QP L     K  + P +LP R+ARLVVYNK +N
Sbjct  1    MRFVEVVLSEPEKHVVAMADAYFFPPYQPMLFTLKGKSSLYPLRLPHRRARLVVYNKNTN  60

Query  217  ETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAM  396
             TS W+VELSEVHA  RGGHHRGK+ISS +VPDVQP MDA EYAECEA+VK+ P   EAM
Sbjct  61   MTSIWVVELSEVHAAARGGHHRGKIISSNIVPDVQPPMDAVEYAECEALVKEHPAAIEAM  120

Query  397  KKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYIL  576
            K+RGI DMDLVMVD WCVGYYSE D+PSRRLA+PLIFCRTESDCP++NGYARPVEG+++L
Sbjct  121  KRRGIYDMDLVMVDPWCVGYYSEKDSPSRRLARPLIFCRTESDCPLDNGYARPVEGIHVL  180

Query  577  VDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            VDMQ M V+E  D  LVPLP  DPLRNYT
Sbjct  181  VDMQKMEVVEVADNNLVPLPAPDPLRNYT  209



>ref|XP_002979456.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
 gb|EFJ19345.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
Length=668

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 178/212 (84%), Gaps = 2/212 (1%)
 Frame = +1

Query  37   MRFAEVSLVEPDKNVVALADAYFFPPFQPSL-LPRTKKG-PVIPSKLPPRQARLVVYNKK  210
            MRF EV L EP+K+VVALADA+FFPP+ P+  L  T KG P+IP +LPPRQA+L VYN  
Sbjct  1    MRFVEVVLNEPEKDVVALADAHFFPPYHPAQGLRTTAKGLPLIPFQLPPRQAKLTVYNVA  60

Query  211  SNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFRE  390
            SNETS WIVEL+EVHA+TRGGH +GKVIS + + DVQP+ DA EYA CEA +K F PF E
Sbjct  61   SNETSIWIVELTEVHALTRGGHRKGKVISCETLTDVQPAFDAEEYALCEAAIKAFKPFVE  120

Query  391  AMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLY  570
            A+KKRGI +MDLVMVD WCVGY+ E DAPS+RLAKPLIFCRTESDCP+ENGYARP+EG++
Sbjct  121  AVKKRGIENMDLVMVDPWCVGYFGERDAPSKRLAKPLIFCRTESDCPIENGYARPLEGIH  180

Query  571  ILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            ILVD+Q+M ++EFED + VPLPP DPLRNYTP
Sbjct  181  ILVDLQHMRILEFEDLEFVPLPPPDPLRNYTP  212



>ref|XP_002462763.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
 gb|EER99284.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
Length=651

 Score =   296 bits (759),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 173/214 (81%), Gaps = 4/214 (2%)
 Frame = +1

Query  28   RDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNK  207
            R  MRF EV L+EP+KNVVALADAY F   QPS+LPR +    +PS LPPR+ARLVVYNK
Sbjct  9    RQCMRFVEVVLLEPEKNVVALADAYHF---QPSVLPRMQGYDGVPSILPPRRARLVVYNK  65

Query  208  KSNETSFWIVELSEVHAV-TRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
             SNETS WI+ELSE+HA    GGH    VISS+VV DVQP+MD  E AECEA+VK +PPF
Sbjct  66   LSNETSIWILELSEMHAAANEGGHETCNVISSEVVRDVQPAMDVMEDAECEAIVKSYPPF  125

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
             EAM KRGI +M+LVMVDAW  GYYS++DAPSRRL+KPLIFCRTE+  PM+NGYARPVEG
Sbjct  126  IEAMNKRGIDNMELVMVDAWFAGYYSKSDAPSRRLSKPLIFCRTENCGPMDNGYARPVEG  185

Query  565  LYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            ++I+VDMQN VV EFED KL+PLPP D LRNYTP
Sbjct  186  IHIVVDMQNNVVTEFEDWKLIPLPPPDHLRNYTP  219



>ref|XP_002984811.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
 gb|EFJ14061.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
Length=710

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 140/210 (67%), Gaps = 18/210 (9%)
 Frame = +1

Query  37   MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKKSN  216
            + F EV L EP+K ++AL        +Q  L  +     ++    PPRQARL VYN  +N
Sbjct  87   INFIEVILDEPEKTLLAL--------YQCQLQVKHNHRQLV---RPPRQARLTVYNAHNN  135

Query  217  ETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAM  396
            ETS W+VEL    A  R      KV+  + +PDVQP +   EY  CEA+VK   P  EA+
Sbjct  136  ETSLWVVELP---AAPRAP----KVLWCQYIPDVQPPVGTEEYVLCEAIVKSHKPLIEAL  188

Query  397  KKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYIL  576
            +KRGI + DL+MVD WC GY+ E DAPSRRLA+PL+F RTES CPMENGYARP+EGL +L
Sbjct  189  RKRGITNTDLIMVDTWCTGYHEEKDAPSRRLARPLMFYRTESSCPMENGYARPIEGLSLL  248

Query  577  VDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            VD+QNM V+E E+R+  PLPP DP+RNYTP
Sbjct  249  VDLQNMNVVELEEREAAPLPPPDPMRNYTP  278



>ref|XP_002985875.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
 gb|EFJ13052.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
Length=710

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 139/210 (66%), Gaps = 18/210 (9%)
 Frame = +1

Query  37   MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKKSN  216
            + F EV L EP+K ++AL        +Q  L  +     ++    P RQARL VYN  +N
Sbjct  87   INFIEVILDEPEKMLLAL--------YQCQLQVKHNHQQLV---RPSRQARLTVYNAHNN  135

Query  217  ETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAM  396
            ETS W+VEL    A  R      KV+  + +PDVQP +   EY  CEA+VK   P  EA+
Sbjct  136  ETSLWVVELP---AAPRAP----KVLWCQYIPDVQPPVGTEEYVLCEAIVKSHKPLIEAL  188

Query  397  KKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYIL  576
            +KRGI + DL+MVD WC GY+ E DAPSRRLA+PL+F RTES CPMENGYARP+EGL +L
Sbjct  189  RKRGITNTDLIMVDTWCTGYHEEKDAPSRRLARPLMFYRTESSCPMENGYARPIEGLSLL  248

Query  577  VDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            VD+QNM V+E E+R+  PLPP DP+RNYTP
Sbjct  249  VDLQNMNVVELEEREAAPLPPPDPMRNYTP  278



>gb|EEC73513.1| hypothetical protein OsI_07883 [Oryza sativa Indica Group]
Length=529

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  331  DAAEYAECEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFC  510
            DA EYAECEA VK  PPF EAMKKRG+ DMDLVMVD WC GYYS+ADAP+RR+AKPLIFC
Sbjct  76   DAMEYAECEATVKSHPPFIEAMKKRGVDDMDLVMVDPWCAGYYSDADAPNRRIAKPLIFC  135

Query  511  RTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RTESD PMENGYARPVEG++I++D+QN  VIEFEDRK VPLPP D LRNYTP
Sbjct  136  RTESDSPMENGYARPVEGIHIVIDVQNNTVIEFEDRKFVPLPPPDHLRNYTP  187



>gb|EEE57286.1| hypothetical protein OsJ_07344 [Oryza sativa Japonica Group]
Length=681

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  331  DAAEYAECEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFC  510
            DA EYAECEA VK  PPF EAMKKRG+ DMDLVMVD WC GYYS+ADAP+RR+AKPLIFC
Sbjct  34   DAMEYAECEATVKSHPPFIEAMKKRGVDDMDLVMVDPWCAGYYSDADAPNRRIAKPLIFC  93

Query  511  RTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            RTESD PMENGYARPVEG++I++D+QN  VIEFEDRK VPLPP D LRNYTP
Sbjct  94   RTESDSPMENGYARPVEGIHIVIDVQNNTVIEFEDRKFVPLPPPDHLRNYTP  145



>gb|AES71447.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=548

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  MKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYI  573
            MKKRGI DMDLVMVD WCVGY+SEADAP RRLAKPL+FCR+ESDCPMENGYARPVEG+Y+
Sbjct  1    MKKRGIEDMDLVMVDPWCVGYHSEADAPGRRLAKPLLFCRSESDCPMENGYARPVEGIYV  60

Query  574  LVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            LVDMQNMVVIEFEDRKLVPLPP DPLRNYTP
Sbjct  61   LVDMQNMVVIEFEDRKLVPLPPVDPLRNYTP  91



>gb|AFK35388.1| unknown [Lotus japonicus]
Length=163

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  445  CVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKL  624
            C G+YS+ DAPSRRLAKPLIFCRTESDCPMENGYARPV+G+ +LVDMQNMVV+EFEDRKL
Sbjct  34   CAGHYSDVDAPSRRLAKPLIFCRTESDCPMENGYARPVDGIRVLVDMQNMVVLEFEDRKL  93

Query  625  VPLPPADPLRNYT  663
            VPLPPADPLRNYT
Sbjct  94   VPLPPADPLRNYT  106



>dbj|BAJ87935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +1

Query  451  GYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVP  630
            GYYS+ADAPSRRLA+PLIFCRTESD PMENGYARPVEG++++VDMQN VVIEFEDRK VP
Sbjct  2    GYYSDADAPSRRLARPLIFCRTESDSPMENGYARPVEGIHVVVDMQNNVVIEFEDRKFVP  61

Query  631  LPPADPLRNYTP  666
            LPP D LRNYTP
Sbjct  62   LPPPDHLRNYTP  73



>ref|NP_001053078.1| Os04g0476100 [Oryza sativa Japonica Group]
 dbj|BAF14992.1| Os04g0476100, partial [Oryza sativa Japonica Group]
Length=518

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  469  DAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADP  648
            DAPSRRL KPLIFCRT+SD PMENGYARPVEG++++VDMQN VVIEFEDRKLVPLPP D 
Sbjct  1    DAPSRRLGKPLIFCRTDSDSPMENGYARPVEGIHVIVDMQNNVVIEFEDRKLVPLPPPDH  60

Query  649  LRNYTP  666
            LRNYTP
Sbjct  61   LRNYTP  66



>ref|WP_013678400.1| tyramine oxidase [Pseudonocardia dioxanivorans]
 gb|AEA28518.1| Copper amine oxidase domain-containing protein [Pseudonocardia 
dioxanivorans CB1190]
Length=669

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 110/215 (51%), Gaps = 36/215 (17%)
 Frame = +1

Query  22   EVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVY  201
            ++ + +RF  VSL EPDK  V   D                 GPV     P R A +V+Y
Sbjct  36   QLDEQVRFVTVSLHEPDKREVLDHD--------------RNGGPV-----PERAAFVVLY  76

Query  202  NKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPP  381
            ++    T   +V L+            G V S +VV DVQPS+   E+   E + +  P 
Sbjct  77   DRGHQRTVEAVVSLTS-----------GDVTSWQVVEDVQPSVMLEEFFSAEEITRADPR  125

Query  382  FREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVE  561
            ++EAM+KRG+ D  L M+D W  GY  + D   RRL +PL F R+  D   +NGYARPVE
Sbjct  126  WQEAMRKRGVTDFSLAMIDPWAAGYDID-DPAGRRLLRPLTFVRSRED---DNGYARPVE  181

Query  562  GLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            GL +L+DM  M VI+  D  +VPLPP     NY P
Sbjct  182  GLVVLLDMDRMEVIDVCDHGVVPLPPK--AGNYAP  214



>ref|WP_006456034.1| tyramine oxidase [Synechococcus sp. PCC 7335]
 gb|EDX86269.1| Copper amine oxidase, enzyme domain protein [Synechococcus sp. 
PCC 7335]
Length=646

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 113/214 (53%), Gaps = 37/214 (17%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            + +S+RFA V+L EP K  V          FQP        G  I      R+A +V+ N
Sbjct  43   LNESVRFASVALQEPSKETVL--------SFQP--------GDSIE-----RRAFIVLLN  81

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
              +  T   +V L+E            +V+S + +P VQP +   E+ ECEA VK  P F
Sbjct  82   NATGRTYEAVVSLNE-----------AEVVSWEHIPGVQPPIMLDEFVECEAAVKASPEF  130

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
            + A+ KRGI D +LVMVD W  G+Y  A+    RL++ L + R     P ++GYARP+EG
Sbjct  131  QAAIAKRGITDPNLVMVDPWSAGHYGIAEEDGVRLSRALCWVRAN---PTDHGYARPIEG  187

Query  565  LYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            +  +VD+  M VI  ED  +VPLPP D   NYTP
Sbjct  188  VIPVVDLNKMEVIRVEDYGVVPLPPKD--GNYTP  219



>ref|WP_036480875.1| tyramine oxidase [Myxosarcina sp. GI1]
Length=634

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 3/117 (3%)
 Frame = +1

Query  289  VISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEA  468
            V S K +P VQPS+   E+ ECEA VK  P F+EA+KKRGI D DLVMVD W  GYY   
Sbjct  85   VTSWKHIPGVQPSIMLDEFEECEAAVKASPEFKEAIKKRGIEDPDLVMVDPWSAGYYGIE  144

Query  469  DAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPP  639
            D   +RL++ L + R   D P +NGYARP+EG+  +VD+  M VI  ED  +VPLPP
Sbjct  145  DEKGQRLSRALCWVR---DNPTDNGYARPIEGVIPVVDLNKMEVIRVEDHGVVPLPP  198



>ref|WP_035986372.1| tyramine oxidase [Leptolyngbya sp. KIOST-1]
Length=643

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 103/202 (51%), Gaps = 35/202 (17%)
 Frame = +1

Query  34   SMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKKS  213
            S RFA V+L EP K  V          F+P        G  I      R+A  ++ +  +
Sbjct  41   STRFATVTLNEPAKETVL--------GFRP--------GDAIV-----REAFAIILDNAT  79

Query  214  NETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREA  393
             +T   IV L+E           G VIS K +P+VQP +   E+ ECE  VK  P F EA
Sbjct  80   AQTYEAIVSLTE-----------GTVISWKHIPNVQPPIMLDEFLECENAVKACPEFIEA  128

Query  394  MKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYI  573
            + KRGI D  LVMVD W  G Y  AD    RL++ L + R     P +NGYARP+EG+  
Sbjct  129  IAKRGITDTSLVMVDPWSAGNYGVADEEGVRLSRALCWVRAN---PTDNGYARPIEGVIP  185

Query  574  LVDMQNMVVIEFEDRKLVPLPP  639
            +VD+  M VI  ED  +VPLPP
Sbjct  186  VVDLNKMEVIRVEDHGVVPLPP  207



>emb|CEG30995.1| Primary amine oxidase precursor [Bacillus simplex]
Length=650

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 110/212 (52%), Gaps = 37/212 (17%)
 Frame = +1

Query  31   DSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKK  210
            D  RFA +SL+EP K++V              L  R ++          R+A  ++ + +
Sbjct  39   DHYRFANISLLEPAKSIV--------------LDYRDEE-------QIKREAFCIILHNQ  77

Query  211  SNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFRE  390
              +T   +V L+E           G + S K++P VQPS+ A E+ EC+ VVK  P   +
Sbjct  78   EGKTYEAVVSLTE-----------GSITSWKLIPGVQPSIMADEFMECQEVVKSHPEMIK  126

Query  391  AMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLY  570
            A  KRG+ +MD +MVD W  G +   +    R+ + L + RT      +NGYARP+ GLY
Sbjct  127  AFAKRGLTNMDNIMVDPWSAGNFGIEEEVDVRIVRALCYYRT---SLYDNGYARPISGLY  183

Query  571  ILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            +LVD+  M VI+  D+ ++P PP D   NYTP
Sbjct  184  VLVDLNKMEVIKIVDKGVIPFPPLDG--NYTP  213



>ref|WP_034315126.1| tyramine oxidase [Bacillus simplex]
Length=650

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 110/212 (52%), Gaps = 37/212 (17%)
 Frame = +1

Query  31   DSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKK  210
            D  RFA +SL+EP K++V              L  R ++          R+A  ++ + +
Sbjct  39   DHYRFANISLLEPAKSIV--------------LDYRDEE-------QIKREAFCIILHNQ  77

Query  211  SNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFRE  390
              +T   +V L+E           G + S K++P VQPS+ A E+ EC+ VVK  P   +
Sbjct  78   EGKTYEAVVSLTE-----------GSITSWKLIPGVQPSIMADEFMECQEVVKSHPEMIK  126

Query  391  AMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLY  570
            A  KRG+ +MD +MVD W  G +   +    R+ + L + RT      +NGYARP+ GLY
Sbjct  127  AFAKRGLTNMDNIMVDPWSAGNFGIEEEVDVRIVRALCYYRT---SLYDNGYARPISGLY  183

Query  571  ILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            +LVD+  M VI+  D+ ++P PP D   NYTP
Sbjct  184  VLVDLNKMEVIKIVDKGVIPFPPLDG--NYTP  213



>ref|WP_007513287.1| tyramine oxidase [Frankia sp. CN3]
Length=664

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 93/164 (57%), Gaps = 17/164 (10%)
 Frame = +1

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            RQA +V+ N K+  T   +V L+           RG V+S + V  +Q  M   E+  CE
Sbjct  66   RQAAMVLRNPKTRTTYEAVVSLT-----------RGHVVSWRAVDGMQAPMMTEEFMACE  114

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPLIFCRTESDCPM  534
            AVV+  P +REA++KRG+ D +L M+D W  GY    D P+ RR+ +PL F R+      
Sbjct  115  AVVRADPRWREAVRKRGVTDFELCMIDPWASGYTGPEDDPALRRIIRPLTFVRSSQ---F  171

Query  535  ENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            +NGYARPVEGL + VD+  M V+E  D  +VPLPP     NY P
Sbjct  172  DNGYARPVEGLIVTVDLDTMEVVEVADHGVVPLPPLG--GNYEP  213



>ref|WP_037040542.1| tyramine oxidase [Pseudonocardia autotrophica]
Length=668

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 109/218 (50%), Gaps = 36/218 (17%)
 Frame = +1

Query  13   ATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARL  192
            A  ++   +RF  V+L EP K  V              L      GP      P R A +
Sbjct  32   AERQIDQGLRFVTVTLHEPPKREV--------------LDHGRGDGPT-----PERAAFV  72

Query  193  VVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKD  372
            ++Y+++  +T   +V L            RG V S +V+ DVQPS+   E+   E + + 
Sbjct  73   ILYDRRHQQTVEAVVSLD-----------RGVVASWEVIDDVQPSVMLEEFFSAEEITRS  121

Query  373  FPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYAR  552
             P ++EAM+KRG+ D  L M+D W  GY  + D   RRL +PL F R+  D   +NGYAR
Sbjct  122  DPRWQEAMRKRGVTDFSLAMIDPWAAGYDID-DPTGRRLLRPLTFVRSRED---DNGYAR  177

Query  553  PVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            PVEGL +L+DM  M VI+  D  +VPLP      NY P
Sbjct  178  PVEGLVVLLDMDKMEVIDVRDHGVVPLPSK--AGNYAP  213



>gb|AJP05492.1| tyramine oxidase [Streptomyces cyaneogriseus subsp. noncyanogenus]
Length=656

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 109/223 (49%), Gaps = 38/223 (17%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            +A     E     RF  +SL EPDK  +   + +                     +  PR
Sbjct  26   KAVKTQREFTADTRFVMISLREPDKRRLLHHNGH---------------------EALPR  64

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +  +V+ ++K   +   +V L            + KVI  + +P VQ ++   E+A+C+A
Sbjct  65   EVFMVLRDRKRRRSYEAVVSLD-----------KAKVIDWRYLPGVQTAITEEEFAQCDA  113

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEA-DAPSRRLAKPLIFCRTESDCPME  537
             V+  P ++EAM++RG+ D  L MVDAW  GY  E  DA  RRLA PL F R     P +
Sbjct  114  AVRSDPRWQEAMRRRGVEDFSLAMVDAWPTGYTGELDDASGRRLACPLTFVRA---FPGD  170

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            NGYARPVE L  L+D+  M V+E  D+  VPLPP     NY P
Sbjct  171  NGYARPVENLVALIDLDTMEVLEVTDKGTVPLPPLSG--NYDP  211



>ref|WP_044379234.1| tyramine oxidase [Streptomyces cyaneogriseus]
Length=659

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 109/223 (49%), Gaps = 38/223 (17%)
 Frame = +1

Query  1    RAAGATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  180
            +A     E     RF  +SL EPDK  +   + +                     +  PR
Sbjct  29   KAVKTQREFTADTRFVMISLREPDKRRLLHHNGH---------------------EALPR  67

Query  181  QARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEA  360
            +  +V+ ++K   +   +V L            + KVI  + +P VQ ++   E+A+C+A
Sbjct  68   EVFMVLRDRKRRRSYEAVVSLD-----------KAKVIDWRYLPGVQTAITEEEFAQCDA  116

Query  361  VVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEA-DAPSRRLAKPLIFCRTESDCPME  537
             V+  P ++EAM++RG+ D  L MVDAW  GY  E  DA  RRLA PL F R     P +
Sbjct  117  AVRSDPRWQEAMRRRGVEDFSLAMVDAWPTGYTGELDDASGRRLACPLTFVRA---FPGD  173

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            NGYARPVE L  L+D+  M V+E  D+  VPLPP     NY P
Sbjct  174  NGYARPVENLVALIDLDTMEVLEVTDKGTVPLPPLSG--NYDP  214



>ref|WP_006520181.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
 gb|EKU99059.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
Length=647

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 108/213 (51%), Gaps = 37/213 (17%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            ++   RFA V+L EP K  V          FQP        G  I      R+A L++ +
Sbjct  39   LKTRFRFATVTLHEPIKETVL--------GFQP--------GDTIE-----REAFLILLD  77

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
              +  T   +V +S            G++ S + +PDVQP +   E+ ECEA VK    F
Sbjct  78   NATARTYEAVVSISS-----------GQLKSWEHIPDVQPPIMLDEFVECEAAVKASEEF  126

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
            R A+ KRGI D DLVMVD W  G Y  AD    RL++ L + +     P +NGYARP+EG
Sbjct  127  RAAIAKRGITDPDLVMVDPWSAGNYGIADEQGVRLSRALCWVKAN---PTDNGYARPIEG  183

Query  565  LYILVDMQNMVVIEFEDRKLVPLPPADPLRNYT  663
            +  +VD+  M VI  ED  +VPLPP D   NYT
Sbjct  184  VIPVVDLNKMEVIRVEDYGVVPLPPKD--GNYT  214



>ref|WP_015595580.1| tyramine oxidase [Bacillus sp. 1NLA3E]
 gb|AGK55538.1| tyramine oxidase [Bacillus sp. 1NLA3E]
Length=645

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 112/214 (52%), Gaps = 37/214 (17%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            + +S+RFA+V L EP K VV                   K+G  I      R+A +++ +
Sbjct  36   LTESVRFAQVVLQEPTKEVVL----------------NFKEGQPIS-----REAFIILLD  74

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
             ++ +T   +V +++            KV+S + +PDVQP     E+ ECE VVKD P +
Sbjct  75   NETEKTYEAVVSITDE-----------KVVSYEYIPDVQPGFLLDEFEECERVVKDHPDY  123

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
            + A+ KRG+ D +LVM+D W  GY+   +   +R+A+ L + R     P +NGYA P+ G
Sbjct  124  QAALLKRGVTDPELVMIDPWSAGYFGVEEDEGKRVARALAWVRK---SPEDNGYAYPLSG  180

Query  565  LYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            LY +VD+  M V+  ED  + PLPP     NY P
Sbjct  181  LYAVVDLNKMEVMRIEDYGVKPLPPTGA--NYAP  212



>ref|WP_035740546.1| tyramine oxidase, partial [Frankia sp. BMG5.12]
Length=667

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 93/171 (54%), Gaps = 22/171 (13%)
 Frame = +1

Query  172  PPRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAE  351
            P RQ+  V+Y + +  T   +V L+            G ++  + VP VQPSM   EY  
Sbjct  76   PDRQSFCVLYERGARRTYEAVVSLTA-----------GTLVELRAVPGVQPSMLWEEYLA  124

Query  352  CEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPLIFCRTESDC  528
            CE  V+  P ++ A+ +RG+ D+ L  +D W  GY   AD P+ RR+A+PL F R     
Sbjct  125  CENAVRADPGWQAALARRGVTDLSLATIDIWSAGYTGSADDPTARRIARPLTFVRA---A  181

Query  529  PMENGYARPVEGLYILVDMQNMVVIEFEDR-----KLVPLPPADPLRNYTP  666
            P ENGYARPVEGL ++VD+  M V+E  D      ++VPLPP     NY P
Sbjct  182  PGENGYARPVEGLLVVVDLDAMAVVELVDHGVAPGEMVPLPPCP--GNYVP  230



>ref|WP_041797277.1| tyramine oxidase, partial [Modestobacter marinus]
Length=645

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +1

Query  283  GKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYS  462
            G+V+S + V  VQP M A E+  CE VV+  P ++ AM+ RG+ D  LVM+D W  GY  
Sbjct  94   GEVVSWRHVEGVQPPMTAEEFMACEDVVRADPDWQAAMRARGVEDFSLVMLDPWASGYTG  153

Query  463  EADAPS-RRLAKPLIFCRTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPP  639
              D PS RRLA+PL F R++ D   +NGYARPVEGL + VDM  M V++  D  +VPLPP
Sbjct  154  PDDHPSGRRLARPLTFVRSKPD---DNGYARPVEGLVVTVDMDTMTVVDVADHGIVPLPP  210



>emb|CCH89603.1| Primary amine oxidase [Modestobacter marinus]
Length=667

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 81/129 (63%), Gaps = 6/129 (5%)
 Frame = +1

Query  283  GKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYS  462
            G+V+S + V  VQP M A E+  CE VV+  P ++ AM+ RG+ D  LVM+D W  GY  
Sbjct  94   GEVVSWRHVEGVQPPMTAEEFMACEDVVRADPDWQAAMRARGVEDFSLVMLDPWASGYTG  153

Query  463  EADAPS-RRLAKPLIFCRTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPP  639
              D PS RRLA+PL F R++ D   +NGYARPVEGL + VDM  M V++  D  +VPLPP
Sbjct  154  PDDHPSGRRLARPLTFVRSKPD---DNGYARPVEGLVVTVDMDTMTVVDVADHGIVPLPP  210

Query  640  ADPLRNYTP  666
                 NY P
Sbjct  211  QP--GNYLP  217



>ref|WP_007920030.1| tyramine oxidase [Ktedonobacter racemifer]
 gb|EFH82153.1| Primary-amine oxidase [Ktedonobacter racemifer DSM 44963]
Length=649

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 110/218 (50%), Gaps = 37/218 (17%)
 Frame = +1

Query  13   ATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARL  192
            A  ++   +RF  V+L EP K +V                   K+G  I      R+A +
Sbjct  38   AEQQLSTDVRFVSVNLHEPAKEIVL----------------NFKEGDEIA-----REAFI  76

Query  193  VVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKD  372
            V+ +K S  T   +V ++E            +V   K +P VQP++   E  E E V+K 
Sbjct  77   VLLDKASGATYEAVVSVTE-----------KRVKIWKRIPSVQPAVLFEEVVESEKVLKA  125

Query  373  FPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYAR  552
             P F+EA+++RGI D+DLVMVD W VG Y   +  +RR+ + L + R     P +NGYAR
Sbjct  126  HPEFQEALRRRGITDLDLVMVDTWTVGNYGNEEERTRRILRSLAYLRHN---PTDNGYAR  182

Query  553  PVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            P+EG+   +D+  M VI  ED  +VP+PP      YTP
Sbjct  183  PIEGIIAFIDVNQMEVIRVEDHGIVPVPPE--AGEYTP  218



>ref|WP_015186652.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
 gb|AFZ28775.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
Length=646

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 3/117 (3%)
 Frame = +1

Query  289  VISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEA  468
            V S K + DVQPS+   E+ ECEA VK  P F+EA+KKRGI D  LVMVD W  GYY+  
Sbjct  97   VKSWKQIADVQPSIMLDEFIECEAAVKASPEFQEAIKKRGITDPSLVMVDPWSAGYYAIE  156

Query  469  DAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPP  639
            D    RL++ L + R+    P +NGYARP+EG+  +VD+  M VI  ED  +VPLPP
Sbjct  157  DEKGLRLSRALCWVRS---SPTDNGYARPIEGVIPVVDLNKMEVIRVEDYGVVPLPP  210



>ref|WP_017299862.1| tyramine oxidase [Nodosilinea nodulosa]
Length=642

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 100/204 (49%), Gaps = 35/204 (17%)
 Frame = +1

Query  34   SMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKKS  213
            + RFA V+L EP K  V       F P  P                  R+A  ++ +  +
Sbjct  41   TTRFATVTLHEPAKETVL-----NFKPGNPI----------------AREAFAIILDNAT  79

Query  214  NETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREA  393
             +T   IV ++E           GKV S + +P VQP +   E+ ECE  VK  P F+ A
Sbjct  80   AQTYEAIVSITE-----------GKVTSWQHIPGVQPPIMLDEFIECEEAVKACPEFQAA  128

Query  394  MKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYI  573
            + KRGI D  LVMVD W  G Y   D    RL++ L + R     P +NGYARP+EG+  
Sbjct  129  IAKRGITDTSLVMVDPWSAGNYGLVDEEGVRLSRALCWVRAN---PTDNGYARPIEGVIP  185

Query  574  LVDMQNMVVIEFEDRKLVPLPPAD  645
            +VD+  M VI  ED  +VPLPP D
Sbjct  186  VVDLNKMEVIRVEDYGVVPLPPRD  209



>ref|WP_041436864.1| tyramine oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=647

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = +1

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            RQA +V+ +  S  T   +V LS             +V S ++VP VQP +   E   C+
Sbjct  64   RQAFVVLLDPASGNTYEAVVSLSTQ-----------QVRSWQLVPGVQPPLLDDEVYACD  112

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
             ++K+ P F  A+++RGI D+DLVMVD W VGY+   +   RRL +   F RT    P +
Sbjct  113  RLLKEDPQFLAALQRRGIADVDLVMVDYWTVGYFGIPEEEGRRLVRGFCFLRTS---PCD  169

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPP  639
            NGYARP+EGLY  +D+  M V++ EDR L PLPP
Sbjct  170  NGYARPIEGLYPWIDLNRMQVVKVEDRGLWPLPP  203



>gb|ABD03718.1| putative copper methylamine oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=641

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = +1

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            RQA +V+ +  S  T   +V LS             +V S ++VP VQP +   E   C+
Sbjct  58   RQAFVVLLDPASGNTYEAVVSLSTQ-----------QVRSWQLVPGVQPPLLDDEVYACD  106

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
             ++K+ P F  A+++RGI D+DLVMVD W VGY+   +   RRL +   F RT    P +
Sbjct  107  RLLKEDPQFLAALQRRGIADVDLVMVDYWTVGYFGIPEEEGRRLVRGFCFLRTS---PCD  163

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPP  639
            NGYARP+EGLY  +D+  M V++ EDR L PLPP
Sbjct  164  NGYARPIEGLYPWIDLNRMQVVKVEDRGLWPLPP  197



>ref|WP_028065493.1| tyramine oxidase [Solirubrobacter soli]
Length=644

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 92/165 (56%), Gaps = 17/165 (10%)
 Frame = +1

Query  175  PRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAEC  354
            PR+A +V+Y +    T   +V L++             V+S K V  VQP +   E+  C
Sbjct  60   PREAFIVLYERSQRATYEAVVSLTDR-----------NVVSFKHVEGVQPQITMEEFMAC  108

Query  355  EAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPLIFCRTESDCP  531
            E  V+  P ++ A++KRG+ D  L M+D W  GY  E DAP+ RR+ +PL + R+E   P
Sbjct  109  EEAVQANPEWQAAVRKRGVEDFSLTMLDPWAAGYTGEHDAPTERRILRPLTWVRSE---P  165

Query  532  MENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
             +NGYARPVEGL +  D+  M V+  ED  +VPLPP     NY P
Sbjct  166  GDNGYARPVEGLIVEFDIDRMEVVNVEDHGVVPLPPK--AGNYDP  208



>ref|WP_014740127.1| tyramine oxidase [Modestobacter marinus]
 emb|CCH87532.1| Primary amine oxidase [Modestobacter marinus]
Length=678

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 80/225 (36%), Positives = 113/225 (50%), Gaps = 39/225 (17%)
 Frame = +1

Query  1    RAAGATPEVRD---SMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKL  171
            RA+    + RD    +RF  V+L EP K+ V                   ++G    S  
Sbjct  27   RASAVLRDQRDLGPRVRFVSVTLQEPTKSEVL----------------GWQRGE---SAA  67

Query  172  PPRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAE  351
            P R A  V+Y++ + +T   +V L+            G V S +VV  VQP +   E+  
Sbjct  68   PERSAFAVLYDRDAQQTIETVVSLAS-----------GVVTSWRVVEGVQPGVMLEEFFA  116

Query  352  CEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCP  531
             E + +  P ++EAM+KRG+ D  L M+D W  GY  E D   RRL +PL F R+ +D  
Sbjct  117  TEEITRADPRWQEAMRKRGVTDFSLAMIDPWAAGYDIE-DPLGRRLIRPLTFVRSRAD--  173

Query  532  MENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
             +NGYARPVEGL +LVD+  M V++  D  +VPLPP     NY P
Sbjct  174  -DNGYARPVEGLIVLVDLDLMEVVDVRDHGVVPLPPK--AGNYMP  215



>ref|WP_037709039.1| tyramine oxidase [Streptomyces mirabilis]
Length=656

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 104/216 (48%), Gaps = 38/216 (18%)
 Frame = +1

Query  22   EVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVY  201
            E     RF  +SL EPDK  +   D +                     +  PR   +V+ 
Sbjct  33   EFTSDTRFVMISLQEPDKERLLHHDGH---------------------EALPRNVFMVLR  71

Query  202  NKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPP  381
            ++K   +   +V L              KVI  + +P VQ ++   E+A+C+A V+    
Sbjct  72   DRKRRRSYEAVVSLDAA-----------KVIDWRYLPGVQTAITEEEFAQCDAAVRSDAR  120

Query  382  FREAMKKRGIVDMDLVMVDAWCVGYYSEA-DAPSRRLAKPLIFCRTESDCPMENGYARPV  558
            +++AM++RG+ D  L MVDAW  GY  E  DA  RRLA PL + R     P +NGYARPV
Sbjct  121  WQQAMRRRGVEDFSLAMVDAWPTGYTGELDDASGRRLACPLTYVRA---YPEDNGYARPV  177

Query  559  EGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            E L  L+D+  M V+E  D+  VPLPP     NY P
Sbjct  178  ENLVALIDLDTMEVLEVTDKGTVPLPPLSG--NYDP  211



>ref|WP_033187870.1| tyramine oxidase [Rhodococcus fascians]
Length=648

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 90/154 (58%), Gaps = 15/154 (10%)
 Frame = +1

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            R+A +V+ ++ ++ T   IV L+E             V+S   + D QP +   E+ +CE
Sbjct  60   RRAFIVLRDRDAHATFEAIVSLTE-----------DAVVSYTEIEDAQPPITLEEFLQCE  108

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAP-SRRLAKPLIFCRTESDCPM  534
             V+K  P ++EAM KRG+ D  L MVD W  G+ +E D P  RRLA+PL F R+E+    
Sbjct  109  EVIKADPRWQEAMIKRGVTDFSLAMVDKWASGHTTENDNPGGRRLARPLTFVRSEA---Q  165

Query  535  ENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLP  636
            ENGYARPVE L + VDM  M V++  D  +VP+P
Sbjct  166  ENGYARPVENLVVTVDMDTMEVVDVADTGVVPIP  199



>ref|WP_028390396.1| tyramine oxidase [Bacillus sp. FJAT-14515]
Length=653

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 106/213 (50%), Gaps = 35/213 (16%)
 Frame = +1

Query  13   ATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARL  192
            A   + ++ RF ++ L EP K+VV                   K+G  I      R+A  
Sbjct  32   AQKNLNENARFEQIGLHEPPKDVVL----------------NFKEGDPIN-----REAFA  70

Query  193  VVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKD  372
            ++ N+  + T   ++ L+             +VIS K VP VQPS    EY+E EA+VK 
Sbjct  71   IIINRTDSTTHEAVISLT-----------NEEVISFKHVPGVQPSFLLEEYSELEALVKS  119

Query  373  FPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYAR  552
             P F  A+KKRGI D DLVMVD W VGY+   +   RRL + L F +   + P +N YA 
Sbjct  120  HPDFHVALKKRGIEDPDLVMVDPWSVGYFGIEEDEGRRLLRALCFVK---EYPEDNAYAH  176

Query  553  PVEGLYILVDMQNMVVIEFEDRKLVPLPPADPL  651
            P+ GL  +VDM  M ++  ED  + P+ P + L
Sbjct  177  PLTGLLPVVDMNKMEIVRIEDHGVQPIAPKNAL  209



>ref|WP_037182195.1| tyramine oxidase [Rhodococcus fascians]
Length=648

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 93/164 (57%), Gaps = 17/164 (10%)
 Frame = +1

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            R+A +V+ ++ ++ T   IV L+E             V+S   + D QP +   E+ +CE
Sbjct  60   RRAFIVLRDRDAHATFEAIVSLTE-----------DAVVSYTEIEDAQPPITLEEFLQCE  108

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAP-SRRLAKPLIFCRTESDCPM  534
             V+K  P ++EAM KRG+ D  L MVD W  G+ +E D P  RRLA+PL F R+E+    
Sbjct  109  EVIKADPRWQEAMIKRGVTDFSLAMVDKWASGHTTENDNPGGRRLARPLTFVRSEA---Q  165

Query  535  ENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            ENGYARPVE L + VDM  M +++  D  +VP+P      NY P
Sbjct  166  ENGYARPVENLVVTVDMDTMEIVDVADTGVVPIPRTSG--NYLP  207



>ref|WP_008314860.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 6406]
Length=643

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 101/207 (49%), Gaps = 41/207 (20%)
 Frame = +1

Query  34   SMRFAEVSLVEPDKNVV---ALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            S RFA V+L EP K  V    L DA                          R+A  +V +
Sbjct  41   SARFASVTLNEPPKATVLGFKLGDAI------------------------EREAFAIVLD  76

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
              + +T   ++ L+            G V S + +P VQP +   E+ ECEA VK  P F
Sbjct  77   NATAQTYEAVISLA-----------TGSVKSWQHIPGVQPPIMLDEFVECEAAVKASPEF  125

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
            + A+ KRGI D  LVMVD W  G+Y  A+    RL++ L + R     P +NGYARP+EG
Sbjct  126  QAAIAKRGITDPSLVMVDPWSAGHYGLAEEDGVRLSRALCWVRAN---PTDNGYARPIEG  182

Query  565  LYILVDMQNMVVIEFEDRKLVPLPPAD  645
            +  +VD+  M VI  ED  +VPLPP D
Sbjct  183  VIPVVDLNKMEVIRVEDHGIVPLPPKD  209



>ref|WP_026844103.1| tyramine oxidase [Geodermatophilaceae bacterium URHA0031]
Length=678

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 116/225 (52%), Gaps = 39/225 (17%)
 Frame = +1

Query  1    RAAGATPEVRD---SMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKL  171
            RA+    + RD    +RF  V+L EP K+ V LA                ++G  +P + 
Sbjct  27   RASAVLRDQRDLGPRVRFVSVALQEPPKHEV-LA---------------WQRGESVPLE-  69

Query  172  PPRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAE  351
              R A  V+Y++++ +T   +V LS            G V S +VV  VQP +   E+  
Sbjct  70   --RSAFAVLYDREAQQTIETVVSLSS-----------GVVTSWRVVEGVQPGVMLEEFFA  116

Query  352  CEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCP  531
             E + +  P ++EAM+KRG+ D  L M+D W  GY  E D   RRL +PL F R+  D  
Sbjct  117  TEEITRADPRWQEAMRKRGVTDFSLAMIDPWAAGYDIE-DPLGRRLIRPLTFVRSRED--  173

Query  532  MENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
             +NGYARPVEGL +LVD+  M VI+  D  +VPLP  +   NY P
Sbjct  174  -DNGYARPVEGLIVLVDLDLMEVIDVRDHGVVPLP--EKAGNYMP  215



>ref|WP_012873420.1| tyramine oxidase [Sphaerobacter thermophilus]
 gb|ACZ40385.1| Primary-amine oxidase [Sphaerobacter thermophilus DSM 20745]
Length=646

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 104/204 (51%), Gaps = 35/204 (17%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            + DS R   ++L EP K+VV       F P  P                  R+A +VV +
Sbjct  34   LTDSARIVSITLHEPSKDVVQS-----FKPGDPI----------------DREAFIVVLD  72

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
            K    T   +V ++            G+V S K VPDVQP +   E+  CE+VVK  P F
Sbjct  73   KAERATYEAVVSITA-----------GEVRSWKHVPDVQPPIIFDEFLACESVVKQHPDF  121

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
            +EAM+KRGI D+DLVMV+ W  GYY +     +RL + L++ R +   P  NGYA PV+ 
Sbjct  122  QEAMRKRGITDLDLVMVEPWSAGYYGDESERGQRLLRALVWVRPD---PEGNGYAHPVDN  178

Query  565  LYILVDMQNMVVIEFEDRKLVPLP  636
            + ++ D+    V+  ED  ++P+P
Sbjct  179  VVVVFDLNANQVVRVEDYGVIPVP  202



>ref|WP_037408872.1| tyramine oxidase [Solirubrobacter sp. URHD0082]
Length=644

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 93/166 (56%), Gaps = 15/166 (9%)
 Frame = +1

Query  145  KGPVIPSKLPPRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQP  324
            K  V   +  PR+A +V+Y +   +T   +V L++            +V++ K V  VQP
Sbjct  48   KAAVQAGETVPREAFVVLYERSERKTYEAVVSLTDE-----------RVVAWKHVDGVQP  96

Query  325  SMDAAEYAECEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPL  501
             +   E+  CEA V+  P ++EAM+KRG+ D  L M+D W  GY  E DA + RR+ +PL
Sbjct  97   PITFEEFMACEAAVQADPGWQEAMRKRGVEDFSLAMIDPWAAGYMGEEDAATARRILRPL  156

Query  502  IFCRTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPP  639
             + R+E   P E+GYARPVEGL +  D+  M V    D  +VPLPP
Sbjct  157  TWVRSE---PGEHGYARPVEGLVVEFDLDKMAVAAVHDYGVVPLPP  199



>ref|WP_013421977.1| tyramine oxidase [Frankia sp. EuI1c]
 gb|ADP78856.1| Copper amine oxidase domain-containing protein [Frankia sp. EuI1c]
Length=666

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 93/171 (54%), Gaps = 17/171 (10%)
 Frame = +1

Query  157  IPSKLPPRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDA  336
            +P     RQ  L++ N K+  T   +V L+           RG V+S +V   +Q    A
Sbjct  58   VPGTPWDRQVALLLRNPKTRSTYEAVVSLT-----------RGLVVSWRVAEGLQAPTTA  106

Query  337  AEYAECEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPLIFCR  513
            AE+  CE +V+  P ++ AM++RG+ D  L MVD W  G+    D P+ RR+ +PL F R
Sbjct  107  AEFMACEEIVRADPRWQAAMRRRGVSDFGLCMVDPWAAGHTGPEDDPALRRILRPLTFVR  166

Query  514  TESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            T    P +NGYARPVEGL  +VD+  M VI+  D  +VPLPP     NY P
Sbjct  167  TS---PHDNGYARPVEGLIAVVDLDAMEVIDVIDHGVVPLPPL--AGNYEP  212



>ref|WP_003350826.1| tyramine oxidase [Bacillus methanolicus]
 gb|EIJ82043.1| tyramine oxidase [Bacillus methanolicus PB1]
Length=651

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 112/214 (52%), Gaps = 37/214 (17%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            +  S+RFA+V L EP K VV                 + K G  I      R+A +++ +
Sbjct  36   LSQSVRFAQVVLKEPLKEVVL----------------QYKNGDPIN-----REAFIILLD  74

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
             ++ +T   +V ++             +++S + +PDVQP     E+ ECE VVK+ P +
Sbjct  75   NETEKTYEVVVSIT-----------NEEIVSWEHIPDVQPGFMLDEFEECEQVVKNNPEY  123

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
            + A+ KRG+ D DLVM+D W  GY++  +   +R+A+ L + R     P +NGYA P+ G
Sbjct  124  QAALLKRGVTDPDLVMIDPWSAGYFNVEEDEGKRVARALAWVRK---SPNDNGYAYPLTG  180

Query  565  LYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            L  +VD+  M V+  ED  + PLPP D   NY+P
Sbjct  181  LIAVVDLNKMEVMRIEDYAVKPLPPLDG--NYSP  212



>ref|WP_009075996.1| tyramine oxidase [Streptomyces sp. AA4]
 gb|EFL06694.1| tyramine oxidase [Streptomyces sp. AA4]
Length=636

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 93/163 (57%), Gaps = 16/163 (10%)
 Frame = +1

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            R+A  V+ ++ S  T   +V ++           RG+++S + +PD QP     E+AEC+
Sbjct  55   REAFAVLRDRDSRTTIEAVVSIT-----------RGELVSWREIPDAQPGFSRDEFAECD  103

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            AV++  P F+EA+++RGI D+D V++D W  G    A+ P+RRL +P ++ R       +
Sbjct  104  AVLRADPGFQEALRRRGITDLDSVVIDLWAAGNTGPAEDPARRLMRPQVYVRQGI---YD  160

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            N YA PVEGL  LVD+  M V E  D  +VP+PP     NY P
Sbjct  161  NRYAHPVEGLTALVDIDRMEVAELADHGVVPIPPRHG--NYIP  201



>ref|WP_036531589.1| tyramine oxidase [Neosynechococcus sphagnicola]
 gb|KGF73303.1| tyramine oxidase [Neosynechococcus sphagnicola sy1]
Length=641

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 108/216 (50%), Gaps = 37/216 (17%)
 Frame = +1

Query  19   PEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVV  198
            P +   +RF  V+L EP K+VV   D     P +                   RQA +VV
Sbjct  38   PGLGSQVRFPIVTLHEPPKSVVR--DFQLGDPME-------------------RQAFVVV  76

Query  199  YNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFP  378
             + +   T   I  L++            +++S  ++P VQP +   E  ECEAV+K  P
Sbjct  77   LDNQMGATYEAIASLTQ-----------QRLLSWTLIPGVQPRIMPDEVVECEAVIKANP  125

Query  379  PFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPV  558
             F+ A+ KRGI ++DLVMVD W  G +  A+    RLA+ L + RT    P +N YA P+
Sbjct  126  EFQAALHKRGIANLDLVMVDPWLPGNFGFAEEAGVRLARSLCWLRTS---PTDNAYAHPI  182

Query  559  EGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            +GL  +VD+  M V++ EDR  VP+PP     NY P
Sbjct  183  DGLVAIVDLNQMQVVQIEDRGKVPVPPT--AGNYAP  216



>ref|WP_028921142.1| tyramine oxidase [Pseudonocardia acaciae]
Length=656

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 89/156 (57%), Gaps = 15/156 (10%)
 Frame = +1

Query  175  PRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAEC  354
            PR+A + +Y +    T   +V LS            G+++S + V  VQPS+ A E+  C
Sbjct  68   PREAAVTLYERGEKRTYEAVVSLSA-----------GELVSWRAVEGVQPSIMAEEFEAC  116

Query  355  EAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPLIFCRTESDCP  531
            E +V+  P ++EAM++RG+ D  L M+D W   Y    D PS RR+ +PL + R     P
Sbjct  117  EDIVRSDPRWQEAMRRRGVEDFSLTMIDPWASSYTGPEDHPSARRILRPLTWLRA---AP  173

Query  532  MENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPP  639
             E+GYARPVEGL ++VD+    V++ +D  +VP PP
Sbjct  174  GEHGYARPVEGLIVIVDLDAGEVVDVQDHGVVPFPP  209



>ref|WP_035752309.1| tyramine oxidase [Frankia sp. BCU110501]
Length=681

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 89/162 (55%), Gaps = 20/162 (12%)
 Frame = +1

Query  172  PPRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAE  351
            P RQA  V++ + +  T   +V LS            G V+    VP VQ +M   E+  
Sbjct  76   PDRQAFCVLHERGARLTHEAVVSLSA-----------GTVVEMYAVPGVQAAMMMEEFLA  124

Query  352  CEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPLIFCRTESDC  528
            CE VV+  P ++ AM++RG+ D  L M+D W  GY    D P+ RR+A+P+ F R+    
Sbjct  125  CEDVVRADPGWQAAMRRRGVTDFSLAMIDPWSAGYTGREDDPARRRIARPVTFVRS---G  181

Query  529  PMENGYARPVEGLYILVDMQNMVVIEFEDRKL-----VPLPP  639
            P ENGYARPVEGL ++VD++ M V+E  D        VPLPP
Sbjct  182  PGENGYARPVEGLQVVVDLEAMAVVEVTDHGQGPDGPVPLPP  223



>ref|WP_014677218.1| tyramine oxidase [Streptomyces hygroscopicus]
 gb|AEY93937.1| tyramine oxidase [Streptomyces hygroscopicus subsp. jinggangensis 
5008]
Length=668

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 104/211 (49%), Gaps = 38/211 (18%)
 Frame = +1

Query  37   MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKKSN  216
            +RF  +SL EPDK  +A  D                     P   PPR+  +V+ +++  
Sbjct  41   VRFVMMSLKEPDKERLADED---------------------PRHRPPREVSVVLRDRRHR  79

Query  217  ETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAM  396
             T   +V L              +V   +  P V  ++   E+A+C+A V+  P ++E M
Sbjct  80   RTYEAVVCLDTE-----------EVTLWRPCPGVHTAITEEEFAQCDAAVRADPRWQEGM  128

Query  397  KKRGIVDMDLVMVDAWCVGYYSEA-DAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYI  573
            ++RG  D  L MVDAW  G+  +  D P RRL+  L F RT    P +NGYARPVE L  
Sbjct  129  RRRGCGDFSLAMVDAWPTGHTGDHPDWPGRRLSYALTFLRTR---PRDNGYARPVENLVA  185

Query  574  LVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            LVD+ +M V+E  DR +VPLPP     NY P
Sbjct  186  LVDLDSMEVLEVTDRGVVPLPPLSG--NYDP  214



>ref|WP_015493445.1| tyramine oxidase [Streptomyces hygroscopicus]
 gb|AGF68094.1| tyramine oxidase [Streptomyces hygroscopicus subsp. jinggangensis 
TL01]
Length=668

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 104/211 (49%), Gaps = 38/211 (18%)
 Frame = +1

Query  37   MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKKSN  216
            +RF  +SL EPDK  +A  D                     P   PPR+  +V+ +++  
Sbjct  41   VRFVMMSLKEPDKERLADED---------------------PRHRPPREVSVVLRDRRHR  79

Query  217  ETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAM  396
             T   +V L              +V   +  P V  ++   E+A+C+A V+  P ++E M
Sbjct  80   RTYEAVVCLDTE-----------EVTLWRPCPGVHTAITEEEFAQCDAAVRADPRWQEGM  128

Query  397  KKRGIVDMDLVMVDAWCVGYYSEA-DAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYI  573
            ++RG  D  L MVDAW  G+  +  D P RRL+  L F RT    P +NGYARPVE L  
Sbjct  129  RRRGCGDFSLAMVDAWPTGHTGDHPDWPGRRLSYALTFLRTR---PRDNGYARPVENLVA  185

Query  574  LVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            LVD+ +M V+E  DR +VPLPP     NY P
Sbjct  186  LVDLDSMEVLEVTDRGVVPLPPLSG--NYDP  214



>ref|WP_027416719.1| tyramine oxidase [Aneurinibacillus terranovensis]
Length=650

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 72/214 (34%), Positives = 108/214 (50%), Gaps = 37/214 (17%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            +  S RFA+V L EP K VV               L   +  PV       R+A +++ +
Sbjct  36   ISSSARFAQVVLQEPLKEVV---------------LNYQEGDPV------NREAFIIILD  74

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
                +T   +V ++             +V+S + +PDVQP     E+ ECE  VK+ P +
Sbjct  75   NAKEKTYEAVVSIT-----------NEEVVSWEHIPDVQPGFMLDEFEECERAVKNNPDY  123

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
            + A+ KRG+ D DLVM+D W  GY++  +   +R+A+ L + R     P +NGYA P+ G
Sbjct  124  QAALLKRGVTDPDLVMIDPWSAGYFNVEEDEGKRVARALAWVRK---FPNDNGYAYPLTG  180

Query  565  LYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            L  +VD+  M V+  ED  + PLPP D   NYTP
Sbjct  181  LIAVVDLNKMEVMRIEDYAVKPLPPFDG--NYTP  212



>ref|WP_036002001.1| tyramine oxidase [Leptolyngbya sp. JSC-1]
Length=652

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = +1

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            R+A L++ +  +  T   IV L++            KV+S + +P VQP++ A E AECE
Sbjct  71   REAFLILLDNTTGATYEAIVSLTQT-----------KVLSWQHIPGVQPNIMADELAECE  119

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
            A VK  P F+  + KRGI D+DLV+VD W +G +  AD    RL++ L + R+  D    
Sbjct  120  AAVKAHPEFQAVLAKRGITDLDLVVVDPWAIGNFGFADEVGMRLSRCLCYLRSRPDG---  176

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPP  639
            N YARP++G+  +VD+  M V+  ED  +VP+PP
Sbjct  177  NFYARPIDGVVPVVDLNQMQVVRIEDMGVVPVPP  210



>ref|WP_030340720.1| tyramine oxidase [Streptomyces sp. NRRL S-1022]
Length=671

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/211 (34%), Positives = 107/211 (51%), Gaps = 38/211 (18%)
 Frame = +1

Query  37   MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKKSN  216
            +RF  +SL EPD+  +A  D                     P + PPR+  +V+ +++  
Sbjct  41   VRFVMMSLKEPDRERLADDD---------------------PGRRPPREVSVVLRDRRHR  79

Query  217  ETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAM  396
             T   +V L             G+V   +  PDV  ++   E+ +C+A V+  P +++AM
Sbjct  80   RTYEAVVCLDT-----------GEVPVWRPRPDVHTAITEEEFEQCDAAVRADPRWQDAM  128

Query  397  KKRGIVDMDLVMVDAWCVGYYSEA-DAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYI  573
            ++RG+ D  L MVDAW  G+  +  D P RRL+  L F R+    P +NGYARPVE L  
Sbjct  129  RRRGVTDFSLAMVDAWPTGHTGDHPDWPGRRLSYALTFARSH---PRDNGYARPVENLVA  185

Query  574  LVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            LVD+ ++ V+E  D  +VPLPP     NY P
Sbjct  186  LVDLDSVEVLEVTDEGVVPLPPLSG--NYDP  214



>ref|WP_020464622.1| tyramine oxidase [Frankia sp. EAN1pec]
 gb|ABW16566.1| Amine oxidase (copper-containing) [Frankia sp. EAN1pec]
Length=675

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 89/162 (55%), Gaps = 20/162 (12%)
 Frame = +1

Query  172  PPRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAE  351
            P RQA  V++ + +  T   +V LS            G V+   VVP VQ +M   E+  
Sbjct  76   PDRQAFCVLHERGARLTHEAVVSLSA-----------GTVVEMYVVPGVQAAMMMEEFLA  124

Query  352  CEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPLIFCRTESDC  528
            CE VV+  P ++ AM++RG+ D  L M+D W  GY    D P+ RR+A+P+ F R+    
Sbjct  125  CEDVVRADPHWQAAMRRRGVTDFSLAMIDPWSAGYTGREDDPARRRIARPVTFVRS---G  181

Query  529  PMENGYARPVEGLYILVDMQNMVVIEFEDRKL-----VPLPP  639
            P ENGYARP EGL ++VD++ M V++  D        VPLPP
Sbjct  182  PGENGYARPAEGLQVVVDLEAMAVVDVTDHGQGPDGPVPLPP  223



>ref|WP_033288996.1| tyramine oxidase [Amycolatopsis jejuensis]
Length=651

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 100/203 (49%), Gaps = 35/203 (17%)
 Frame = +1

Query  34   SMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYNKKS  213
            S+RF  ++L EP K     AD   + P QP+L               PR+A +V Y +  
Sbjct  38   SLRFVFIALHEPPK-----ADVLGWAPGQPAL---------------PREAEIVAYVRDE  77

Query  214  NETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREA  393
              T   +V L +            K+ S   VP VQP+    E+  C   V+    ++EA
Sbjct  78   RMTYEAVVSLDDE-----------KIASLSAVPGVQPAFFHEEFTRCAEAVRADSRWQEA  126

Query  394  MKKRGIVDMDLVMVDAWCVGYYS-EADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLY  570
            M+KRG+ D  L ++D W   +   + DA +RRLA+PL + R     P ENGYARPVEGL 
Sbjct  127  MRKRGVTDFSLALIDTWAPSWTGPDDDAAARRLARPLTWMRA---APGENGYARPVEGLV  183

Query  571  ILVDMQNMVVIEFEDRKLVPLPP  639
              VD+    V++  D  +VPLPP
Sbjct  184  AEVDLDTFEVLDILDHGVVPLPP  206



>ref|WP_034299883.1| tyramine oxidase, partial [Bacillus sp. 37MA]
Length=304

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 103/207 (50%), Gaps = 37/207 (18%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            + D+ RF +V L EP+K+VV                   K+G  +      R+A ++V +
Sbjct  35   LTDAARFEQVGLYEPEKSVVL----------------NFKEGDAVV-----REAFMIVLD  73

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
               ++T   ++ L++            KV+S   VP VQPS    EY+E EA VK+ P F
Sbjct  74   TSDSQTYEGVISLTD-----------EKVVSWTHVPGVQPSFLFEEYSELEATVKNHPDF  122

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRT-ESDCPMENGYARPVE  561
             +A+ KRGI D  LVMVD W VG +   +   +RLAK L F R  E D    N YA P+ 
Sbjct  123  HKALAKRGITDPSLVMVDPWSVGNFGIQEDEGKRLAKALCFVRKFEGD----NAYAYPLS  178

Query  562  GLYILVDMQNMVVIEFEDRKLVPLPPA  642
            GL  +VD+  M ++  ED  + P+ P 
Sbjct  179  GLLPVVDLSTMEIVRIEDHGVRPIAPT  205



>gb|EFC82890.1| Primary-amine oxidase [Frankia sp. EUN1f]
Length=703

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 97/204 (48%), Gaps = 31/204 (15%)
 Frame = +1

Query  37   MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPP-RQARLVVYNKKS  213
             RF  V L EP K                +L+ R  +     +  PP RQA  V+Y + +
Sbjct  31   FRFVSVELQEPPK---------------AALVARESEREAADALAPPDRQAFCVLYERGT  75

Query  214  NETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREA  393
              T   +V L+            G V+  +VVP VQPS+   E   CE  V+    ++ A
Sbjct  76   RRTHEAVVSLTA-----------GTVVDLRVVPGVQPSIMMDEILACEDAVRADGAWQAA  124

Query  394  MKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPLIFCRTESDCPMENGYARPVEGLY  570
            M  RG+ D+ L M+D W  GY    D P+ RR+A+PL F R     P ENGYARPVEGL 
Sbjct  125  MAGRGVTDLSLAMIDIWSAGYTGSDDDPARRRIARPLTFVRA---APGENGYARPVEGLT  181

Query  571  ILVDMQNMVVIEFEDRKLVPLPPA  642
            ++VD+  M V+E  D       PA
Sbjct  182  VVVDLDAMAVVEVVDHAAASDGPA  205



>ref|WP_011430198.1| tyramine oxidase [Synechococcus sp. JA-3-3Ab]
 gb|ABC99520.1| copper amine oxidase [Synechococcus sp. JA-3-3Ab]
Length=672

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 87/156 (56%), Gaps = 14/156 (9%)
 Frame = +1

Query  178  RQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECE  357
            RQA  V+ +     T   +V LS           R +V S ++VP +QP +   E   C+
Sbjct  89   RQAFAVLLDPAEGSTYEAVVSLS-----------RQQVCSWQLVPGMQPPLLDDEVYACD  137

Query  358  AVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPME  537
             ++K  P F  A+++RGI D++ VMVD W VGY+   +   RRL + L F RT    P +
Sbjct  138  RLLKADPQFLAALQRRGIADVERVMVDYWTVGYFGIPEEEGRRLVRGLCFLRTS---PYD  194

Query  538  NGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPAD  645
            NGYARP+EGLY  +D+  M V++ EDR   PLPP D
Sbjct  195  NGYARPIEGLYPWIDLNQMQVVKVEDRGPWPLPPED  230



>ref|WP_035952394.1| tyramine oxidase, partial [Frankia sp. EUN1f]
Length=666

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 83/158 (53%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  PPRQARLVVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAE  351
            P RQA  V+Y + +  T   +V L+            G V+  +VVP VQPS+   E   
Sbjct  62   PDRQAFCVLYERGTRRTHEAVVSLTA-----------GTVVDLRVVPGVQPSIMMDEILA  110

Query  352  CEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPLIFCRTESDC  528
            CE  V+    ++ AM  RG+ D+ L M+D W  GY    D P+ RR+A+PL F R     
Sbjct  111  CEDAVRADGAWQAAMAGRGVTDLSLAMIDIWSAGYTGSDDDPARRRIARPLTFVRA---A  167

Query  529  PMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPA  642
            P ENGYARPVEGL ++VD+  M V+E  D       PA
Sbjct  168  PGENGYARPVEGLTVVVDLDAMAVVEVVDHAAASDGPA  205



>ref|WP_037709969.1| tyramine oxidase [Streptomyces mirabilis]
Length=666

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 109/206 (53%), Gaps = 35/206 (17%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            + ++ RF  V+L EP K  V LA    + P +P L               PR+A +++Y 
Sbjct  44   LTETARFVFVTLHEPPKPAV-LA----WQPGEPPL---------------PREAFVLLYE  83

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
            +    T   +V L+             +V+S + +  VQP +   E+  CE +V+  P +
Sbjct  84   RGERRTYEAVVSLTAR-----------EVVSWQHIEGVQPPIMDEEFNACEDIVRADPRW  132

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPS-RRLAKPLIFCRTESDCPMENGYARPVE  561
            +EAM++RG+ D  L MVD W   +    DAP+ RR+A+PL + R+    P E+GYARPVE
Sbjct  133  QEAMRRRGVEDFSLTMVDPWAASWTGPQDAPTARRIARPLTWVRS---APGEHGYARPVE  189

Query  562  GLYILVDMQNMVVIEFEDRKLVPLPP  639
            GL ++VD+    V+E ED  +VP PP
Sbjct  190  GLVVIVDLDERRVVEVEDHGVVPFPP  215



>ref|WP_032395037.1| tyramine oxidase [Rhodococcus fascians]
Length=649

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 75/127 (59%), Gaps = 6/127 (5%)
 Frame = +1

Query  289  VISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAMKKRGIVDMDLVMVDAWCVGYYSEA  468
            +IS   + D QP +   E+  CE V+K  P ++ AM KRG+ D  L MVD W  G+  E 
Sbjct  86   LISYTEIADAQPPITLEEFLRCEEVIKADPRWQAAMVKRGVTDFSLAMVDKWASGHTMEG  145

Query  469  DAP-SRRLAKPLIFCRTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPAD  645
            D P  RRLA+PL F R+E+    ENGYARPVE L + VDM  M V++  D  +VP+P  D
Sbjct  146  DNPGGRRLARPLTFVRSEA---QENGYARPVENLVVTVDMDTMEVVDVADTGVVPIP--D  200

Query  646  PLRNYTP  666
               NY P
Sbjct  201  TPGNYLP  207



>ref|WP_042206338.1| tyramine oxidase [Paenibacillus durus]
 gb|AIQ12487.1| tyramine oxidase [Paenibacillus durus]
Length=648

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 104/218 (48%), Gaps = 37/218 (17%)
 Frame = +1

Query  13   ATPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARL  192
            A  ++ +  RFA V+L+EP K +V                         P     R+A  
Sbjct  27   AEKDLDEFCRFASVNLLEPSKELVLRWS---------------------PGDSFEREAFC  65

Query  193  VVYNKKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKD  372
            +V+N K N+T   IV LS             KV S   VP +QP +   E+  C+ +VK+
Sbjct  66   IVFNYKKNQTFEAIVSLS-----------GNKVKSWTHVPGMQPGILLEEFEACQRIVKE  114

Query  373  FPPFREAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYAR  552
             P  +EA +KRGI D   +MVD W  G +   +    RL + + + +T      +NGYAR
Sbjct  115  HPEMQEAFRKRGITDFARIMVDPWSAGNFGIEEEIGVRLVRAICYYKTSD---YDNGYAR  171

Query  553  PVEGLYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            P+ GLY + D+  + V++  D+  VPLPP D   NYTP
Sbjct  172  PLSGLYAIFDLNRLQVMKIVDKGPVPLPPLD--GNYTP  207



>ref|WP_016205391.1| tyramine oxidase [Bacillus nealsonii]
 gb|EOR20880.1| tyramine oxidase [Bacillus nealsonii AAU1]
Length=652

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 105/214 (49%), Gaps = 37/214 (17%)
 Frame = +1

Query  25   VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQARLVVYN  204
            + + +RF  V L EPDK VV                    KG  I      R+  +++ +
Sbjct  34   LHEKVRFVTVVLHEPDKKVVL----------------DYNKGDEI-----NREVFMILLD  72

Query  205  KKSNETSFWIVELSEVHAVTRGGHHRGKVISSKVVPDVQPSMDAAEYAECEAVVKDFPPF  384
             ++ +T   +V ++              VIS + +  VQP +   E+ ECE VVK+ P F
Sbjct  73   NETEQTYEAVVSIT-----------NKAVISWEHIEGVQPGVMLDEFEECEQVVKNSPEF  121

Query  385  REAMKKRGIVDMDLVMVDAWCVGYYSEADAPSRRLAKPLIFCRTESDCPMENGYARPVEG  564
            +EA+ KRGI D+DLVMVD W  G +   +    RLA+ + + R     P +NGYA P+ G
Sbjct  122  QEALLKRGITDVDLVMVDPWSAGNFGIEEDEGVRLARAICWVRK---FPNDNGYAYPLTG  178

Query  565  LYILVDMQNMVVIEFEDRKLVPLPPADPLRNYTP  666
            + + VD+  M V  FED  +  +PP D   NY+P
Sbjct  179  IVVYVDLNKMTVHRFEDHGIREMPPTDA--NYSP  210



>ref|WP_020471082.1| hypothetical protein [Zavarzinella formosa]
Length=631

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = +1

Query  286  KVISSKVVPDVQPSMDAAEYAECEAVVKDFPPFREAMKKR-GIVDMDLVMVDAWCVGYYS  462
            KV+S K +P VQP+M   E AECE  V   P F+ A+KK  GI D  LVMVD W  G Y 
Sbjct  78   KVLSWKHIPGVQPTMTIDEQAECEQAVIHSPEFKAALKKHHGIEDTSLVMVDIWSAGNYG  137

Query  463  EADAPSRRLAKPLIFCRTESDCPMENGYARPVEGLYILVDMQNMVVIEFEDRKLVPLPPA  642
              +  ++RLA+PL F RT+   P +NGY RP+EG+  +VD+  M VI  E+     LPP 
Sbjct  138  SEEDRTKRLARPLCFLRTD---PTDNGYVRPIEGIRPIVDLNEMKVIRVEEYGTWDLPPG  194

Query  643  D  645
            +
Sbjct  195  E  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960