BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024O03

Length=693
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621089.1|  PREDICTED: uncharacterized GPI-anchored prot...    250   3e-78   Nicotiana tomentosiformis
ref|XP_010318632.1|  PREDICTED: uncharacterized GPI-anchored prot...    247   4e-77   Solanum lycopersicum
ref|XP_006341566.1|  PREDICTED: uncharacterized GPI-anchored prot...    246   8e-77   Solanum tuberosum [potatoes]
ref|XP_006365405.1|  PREDICTED: uncharacterized GPI-anchored prot...    230   2e-70   Solanum tuberosum [potatoes]
emb|CDO98373.1|  unnamed protein product                                231   2e-70   Coffea canephora [robusta coffee]
ref|XP_009793934.1|  PREDICTED: uncharacterized GPI-anchored prot...    229   3e-70   Nicotiana sylvestris
ref|XP_007036757.1|  Uncharacterized protein isoform 2                  223   3e-68   
ref|XP_007036758.1|  Uncharacterized protein isoform 3                  221   3e-68   
ref|XP_011039109.1|  PREDICTED: uncharacterized GPI-anchored prot...    224   3e-68   Populus euphratica
gb|EYU24115.1|  hypothetical protein MIMGU_mgv1a009301mg                224   5e-68   Erythranthe guttata [common monkey flower]
ref|XP_007036756.1|  Uncharacterized protein isoform 1                  224   8e-68   
ref|XP_011084420.1|  PREDICTED: uncharacterized GPI-anchored prot...    224   8e-68   Sesamum indicum [beniseed]
ref|XP_011000468.1|  PREDICTED: uncharacterized GPI-anchored prot...    224   2e-67   Populus euphratica
ref|XP_002322090.1|  hypothetical protein POPTR_0015s04320g             221   4e-67   Populus trichocarpa [western balsam poplar]
gb|ABK95654.1|  unknown                                                 221   5e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009611061.1|  PREDICTED: uncharacterized GPI-anchored prot...    221   8e-67   Nicotiana tomentosiformis
ref|XP_010322619.1|  PREDICTED: uncharacterized GPI-anchored prot...    219   4e-66   Solanum lycopersicum
ref|XP_009780115.1|  PREDICTED: uncharacterized GPI-anchored prot...    218   8e-66   Nicotiana sylvestris
ref|XP_003634199.1|  PREDICTED: uncharacterized GPI-anchored prot...    212   2e-63   Vitis vinifera
ref|XP_006451658.1|  hypothetical protein CICLE_v10008811mg             212   4e-63   Citrus clementina [clementine]
emb|CBI15549.3|  unnamed protein product                                212   5e-63   Vitis vinifera
ref|XP_002533130.1|  conserved hypothetical protein                     211   7e-63   Ricinus communis
gb|KDO62890.1|  hypothetical protein CISIN_1g038515mg                   209   1e-62   Citrus sinensis [apfelsine]
ref|XP_008453468.1|  PREDICTED: uncharacterized GPI-anchored prot...    209   2e-62   Cucumis melo [Oriental melon]
ref|XP_002317884.2|  hypothetical protein POPTR_0012s04630g             209   2e-62   Populus trichocarpa [western balsam poplar]
gb|KCW83996.1|  hypothetical protein EUGRSUZ_B00868                     206   1e-61   Eucalyptus grandis [rose gum]
ref|XP_004160422.1|  PREDICTED: uncharacterized GPI-anchored prot...    206   4e-61   
ref|XP_010032707.1|  PREDICTED: uncharacterized GPI-anchored prot...    206   6e-61   Eucalyptus grandis [rose gum]
ref|XP_008374829.1|  PREDICTED: uncharacterized GPI-anchored prot...    205   1e-60   Malus domestica [apple tree]
gb|KJB77262.1|  hypothetical protein B456_012G128400                    202   1e-60   Gossypium raimondii
gb|KHG14842.1|  hypothetical protein F383_16641                         205   2e-60   Gossypium arboreum [tree cotton]
gb|KJB77261.1|  hypothetical protein B456_012G128400                    204   4e-60   Gossypium raimondii
ref|XP_009356061.1|  PREDICTED: uncharacterized GPI-anchored prot...    201   5e-59   Pyrus x bretschneideri [bai li]
ref|XP_008393412.1|  PREDICTED: uncharacterized GPI-anchored prot...    200   9e-59   Malus domestica [apple tree]
ref|XP_009360091.1|  PREDICTED: uncharacterized GPI-anchored prot...    199   2e-58   
gb|EPS70389.1|  hypothetical protein M569_04371                         198   4e-58   Genlisea aurea
ref|XP_010097582.1|  hypothetical protein L484_017392                   195   8e-57   Morus notabilis
ref|XP_004299540.1|  PREDICTED: uncharacterized GPI-anchored prot...    194   2e-56   Fragaria vesca subsp. vesca
gb|KDP41131.1|  hypothetical protein JCGZ_03622                         193   4e-56   Jatropha curcas
gb|AFK39957.1|  unknown                                                 192   1e-55   Lotus japonicus
ref|XP_010465880.1|  PREDICTED: uncharacterized GPI-anchored prot...    192   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002883104.1|  hypothetical protein ARALYDRAFT_898158             191   3e-55   Arabidopsis lyrata subsp. lyrata
gb|ACU18611.1|  unknown                                                 191   5e-55   Glycine max [soybeans]
gb|KHN00170.1|  Putative GPI-anchored protein                           190   6e-55   Glycine soja [wild soybean]
ref|XP_003525199.1|  PREDICTED: uncharacterized GPI-anchored prot...    191   6e-55   
ref|XP_010549074.1|  PREDICTED: uncharacterized GPI-anchored prot...    190   6e-55   Tarenaya hassleriana [spider flower]
ref|XP_010487719.1|  PREDICTED: uncharacterized GPI-anchored prot...    190   7e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006297874.1|  hypothetical protein CARUB_v10013914mg             191   8e-55   
ref|XP_010506313.1|  PREDICTED: uncharacterized GPI-anchored prot...    189   2e-54   Camelina sativa [gold-of-pleasure]
ref|NP_566596.1|  uncharacterized protein                               189   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010260827.1|  PREDICTED: uncharacterized GPI-anchored prot...    188   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010274672.1|  PREDICTED: uncharacterized GPI-anchored prot...    188   4e-54   Nelumbo nucifera [Indian lotus]
gb|KHN21661.1|  Putative GPI-anchored protein                           188   5e-54   Glycine soja [wild soybean]
ref|XP_007160509.1|  hypothetical protein PHAVU_002G327800g             187   7e-54   Phaseolus vulgaris [French bean]
ref|XP_004503298.1|  PREDICTED: uncharacterized GPI-anchored prot...    187   9e-54   Cicer arietinum [garbanzo]
gb|KFK39131.1|  hypothetical protein AALP_AA3G204900                    187   1e-53   Arabis alpina [alpine rockcress]
ref|XP_007152699.1|  hypothetical protein PHAVU_004G151900g             186   2e-53   Phaseolus vulgaris [French bean]
ref|XP_009145938.1|  PREDICTED: uncharacterized GPI-anchored prot...    186   3e-53   Brassica rapa
ref|XP_007209408.1|  hypothetical protein PRUPE_ppa009266mg             184   4e-53   
ref|XP_008240173.1|  PREDICTED: uncharacterized GPI-anchored prot...    185   5e-53   Prunus mume [ume]
emb|CDX92191.1|  BnaA05g22160D                                          184   9e-53   
ref|XP_003637786.1|  GPI-anchored protein, putative                     183   4e-52   
emb|CDY49619.1|  BnaCnng17710D                                          182   5e-52   Brassica napus [oilseed rape]
ref|XP_006406660.1|  hypothetical protein EUTSA_v10021078mg             182   8e-52   Eutrema salsugineum [saltwater cress]
emb|CDX75958.1|  BnaC03g40410D                                          181   2e-51   
gb|ACU18006.1|  unknown                                                 179   2e-50   Glycine max [soybeans]
ref|XP_003528967.1|  PREDICTED: uncharacterized GPI-anchored prot...    179   2e-50   Glycine max [soybeans]
ref|XP_010678117.1|  PREDICTED: uncharacterized GPI-anchored prot...    179   2e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003534147.1|  PREDICTED: uncharacterized GPI-anchored prot...    178   2e-50   Glycine max [soybeans]
ref|XP_009135567.1|  PREDICTED: uncharacterized GPI-anchored prot...    178   3e-50   Brassica rapa
ref|XP_003631077.1|  GPI-anchored protein, putative                     178   3e-50   Medicago truncatula
emb|CDY51932.1|  BnaAnng11090D                                          178   3e-50   Brassica napus [oilseed rape]
emb|CAN82280.1|  hypothetical protein VITISV_044064                     176   2e-49   Vitis vinifera
gb|KHN44610.1|  Putative GPI-anchored protein                           175   6e-49   Glycine soja [wild soybean]
ref|XP_004512737.1|  PREDICTED: uncharacterized GPI-anchored prot...    172   3e-48   Cicer arietinum [garbanzo]
ref|XP_010035649.1|  PREDICTED: uncharacterized GPI-anchored prot...    147   7e-39   Eucalyptus grandis [rose gum]
ref|XP_008782391.1|  PREDICTED: uncharacterized GPI-anchored prot...    147   1e-38   Phoenix dactylifera
emb|CBI18008.3|  unnamed protein product                                146   1e-38   Vitis vinifera
ref|XP_002276552.1|  PREDICTED: uncharacterized GPI-anchored prot...    147   1e-38   
gb|AFG68066.1|  hypothetical protein 0_13494_01                         140   5e-38   Pinus taeda
ref|XP_009353209.1|  PREDICTED: uncharacterized GPI-anchored prot...    145   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_010277906.1|  PREDICTED: uncharacterized GPI-anchored prot...    144   3e-37   Nelumbo nucifera [Indian lotus]
gb|AEW07870.1|  hypothetical protein 0_13494_01                         139   3e-37   Pinus radiata
gb|KDP24204.1|  hypothetical protein JCGZ_25861                         142   5e-37   Jatropha curcas
ref|XP_009777833.1|  PREDICTED: uncharacterized GPI-anchored prot...    142   8e-37   Nicotiana sylvestris
ref|XP_008341934.1|  PREDICTED: uncharacterized GPI-anchored prot...    142   1e-36   Malus domestica [apple tree]
ref|XP_004243303.1|  PREDICTED: uncharacterized GPI-anchored prot...    142   1e-36   Solanum lycopersicum
ref|XP_007215670.1|  hypothetical protein PRUPE_ppa008626mg             142   1e-36   Prunus persica
ref|XP_006366939.1|  PREDICTED: uncharacterized GPI-anchored prot...    141   2e-36   Solanum tuberosum [potatoes]
ref|XP_008379580.1|  PREDICTED: uncharacterized GPI-anchored prot...    141   2e-36   Malus domestica [apple tree]
ref|XP_002518003.1|  conserved hypothetical protein                     140   3e-36   Ricinus communis
ref|XP_010268888.1|  PREDICTED: uncharacterized GPI-anchored prot...    140   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_008230199.1|  PREDICTED: uncharacterized GPI-anchored prot...    140   4e-36   Prunus mume [ume]
ref|XP_009596251.1|  PREDICTED: uncharacterized GPI-anchored prot...    140   5e-36   Nicotiana tomentosiformis
ref|XP_011047484.1|  PREDICTED: uncharacterized GPI-anchored prot...    140   5e-36   Populus euphratica
ref|XP_010448030.1|  PREDICTED: uncharacterized GPI-anchored prot...    140   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002326107.1|  hypothetical protein POPTR_0019s14080g             140   6e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010438502.1|  PREDICTED: uncharacterized GPI-anchored prot...    139   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006412993.1|  hypothetical protein EUTSA_v10025835mg             139   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010540855.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_007149909.1|  hypothetical protein PHAVU_005G109200g             137   3e-35   Phaseolus vulgaris [French bean]
emb|CDP11898.1|  unnamed protein product                                138   3e-35   Coffea canephora [robusta coffee]
ref|XP_010095855.1|  hypothetical protein L484_022212                   137   6e-35   Morus notabilis
gb|KFK29337.1|  hypothetical protein AALP_AA7G120700                    137   6e-35   Arabis alpina [alpine rockcress]
ref|XP_010924042.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   6e-35   
ref|XP_010051489.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   7e-35   Eucalyptus grandis [rose gum]
ref|NP_567797.1|  uncharacterized protein                               137   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433261.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   7e-35   Camelina sativa [gold-of-pleasure]
gb|AAM65702.1|  unknown                                                 137   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010689311.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   1e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002867466.1|  hypothetical protein ARALYDRAFT_491965             136   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_006284191.1|  hypothetical protein CARUB_v10005339mg             135   2e-34   Capsella rubella
ref|XP_004136804.1|  PREDICTED: uncharacterized GPI-anchored prot...    136   2e-34   Cucumis sativus [cucumbers]
ref|XP_004293470.1|  PREDICTED: uncharacterized GPI-anchored prot...    136   2e-34   Fragaria vesca subsp. vesca
gb|KDO55799.1|  hypothetical protein CISIN_1g020738mg                   135   2e-34   Citrus sinensis [apfelsine]
ref|XP_002319388.2|  hypothetical protein POPTR_0013s14490g             135   3e-34   
gb|KHG07118.1|  hypothetical protein F383_33082                         135   3e-34   Gossypium arboreum [tree cotton]
ref|XP_009144190.1|  PREDICTED: uncharacterized GPI-anchored prot...    135   4e-34   Brassica rapa
emb|CDY19004.1|  BnaC01g20640D                                          135   4e-34   Brassica napus [oilseed rape]
gb|KJB31741.1|  hypothetical protein B456_005G206400                    135   5e-34   Gossypium raimondii
ref|XP_007043448.1|  Uncharacterized protein TCM_007897                 135   5e-34   Theobroma cacao [chocolate]
gb|EPS66167.1|  hypothetical protein M569_08604                         133   8e-34   Genlisea aurea
gb|KDO55798.1|  hypothetical protein CISIN_1g020738mg                   134   1e-33   Citrus sinensis [apfelsine]
ref|XP_006447405.1|  hypothetical protein CICLE_v10015940mg             134   1e-33   Citrus clementina [clementine]
ref|XP_011048474.1|  PREDICTED: uncharacterized GPI-anchored prot...    134   1e-33   Populus euphratica
ref|XP_003597088.1|  GPI-anchored protein, putative                     132   2e-33   Medicago truncatula
ref|XP_003540881.1|  PREDICTED: uncharacterized GPI-anchored prot...    133   2e-33   Glycine max [soybeans]
gb|KEH37810.1|  transmembrane protein, putative                         133   3e-33   Medicago truncatula
ref|XP_009390209.1|  PREDICTED: uncharacterized GPI-anchored prot...    134   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006841867.1|  hypothetical protein AMTR_s00003p00271650          132   4e-33   Amborella trichopoda
ref|XP_006592832.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   5e-33   Glycine max [soybeans]
ref|XP_009350468.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   5e-33   Pyrus x bretschneideri [bai li]
ref|XP_004507229.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   5e-33   Cicer arietinum [garbanzo]
ref|XP_008800404.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   7e-33   Phoenix dactylifera
ref|XP_010904780.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   8e-33   Elaeis guineensis
ref|XP_004139964.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   8e-33   Cucumis sativus [cucumbers]
ref|XP_008448226.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   9e-33   Cucumis melo [Oriental melon]
ref|XP_007132620.1|  hypothetical protein PHAVU_011G110300g             131   9e-33   Phaseolus vulgaris [French bean]
ref|XP_008455363.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   9e-33   Cucumis melo [Oriental melon]
ref|XP_008810973.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   2e-32   Phoenix dactylifera
ref|XP_006849743.1|  hypothetical protein AMTR_s00024p00248910          130   2e-32   Amborella trichopoda
ref|XP_003526297.1|  PREDICTED: uncharacterized GPI-anchored prot...    130   3e-32   Glycine max [soybeans]
ref|XP_008813347.1|  PREDICTED: uncharacterized GPI-anchored prot...    128   2e-31   Phoenix dactylifera
gb|KJB50064.1|  hypothetical protein B456_008G151300                    127   5e-31   Gossypium raimondii
ref|XP_008787927.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   7e-31   Phoenix dactylifera
ref|XP_009418751.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG17779.1|  hypothetical protein F383_20781                         125   3e-30   Gossypium arboreum [tree cotton]
ref|XP_009417269.1|  PREDICTED: uncharacterized GPI-anchored prot...    125   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412443.1|  PREDICTED: uncharacterized GPI-anchored prot...    124   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ91757.1|  predicted protein                                      122   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05878.1|  predicted protein                                      122   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009373629.1|  PREDICTED: uncharacterized GPI-anchored prot...    120   4e-29   
ref|XP_004953652.1|  PREDICTED: uncharacterized GPI-anchored prot...    119   9e-28   Setaria italica
ref|XP_009403933.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380337.1|  PREDICTED: uncharacterized GPI-anchored prot...    115   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410258.1|  PREDICTED: uncharacterized GPI-anchored prot...    113   7e-26   
tpg|DAA63100.1|  TPA: hypothetical protein ZEAMMB73_460549              111   3e-25   
ref|XP_008653219.1|  PREDICTED: uncharacterized GPI-anchored prot...    111   5e-25   Zea mays [maize]
gb|EAY87253.1|  hypothetical protein OsI_08655                          108   4e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001047896.1|  Os02g0710700                                       108   5e-24   
gb|AFW73063.1|  hypothetical protein ZEAMMB73_382585                    104   8e-23   
ref|XP_003570217.2|  PREDICTED: uncharacterized GPI-anchored prot...    104   1e-22   
ref|NP_001144450.1|  uncharacterized protein LOC100277413 precursor     100   2e-21   
ref|XP_003560098.1|  PREDICTED: uncharacterized GPI-anchored prot...    100   3e-21   Brachypodium distachyon [annual false brome]
ref|XP_004958008.1|  PREDICTED: uncharacterized GPI-anchored prot...  95.9    7e-20   Setaria italica
ref|NP_001059970.1|  Os07g0557700                                     95.1    1e-19   
gb|EAZ04317.1|  hypothetical protein OsI_26458                        95.1    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002987778.1|  hypothetical protein SELMODRAFT_183423           94.7    2e-19   Selaginella moellendorffii
ref|XP_002993750.1|  hypothetical protein SELMODRAFT_431796           94.4    3e-19   
ref|XP_004965364.1|  PREDICTED: uncharacterized GPI-anchored prot...  94.0    4e-19   Setaria italica
ref|XP_010936812.1|  PREDICTED: uncharacterized GPI-anchored prot...  93.2    7e-19   Elaeis guineensis
ref|NP_001142782.1|  uncharacterized protein LOC100275144             92.4    1e-18   Zea mays [maize]
gb|AFW86539.1|  hypothetical protein ZEAMMB73_536074                  92.4    1e-18   
tpg|DAA35957.1|  TPA: hypothetical protein ZEAMMB73_447066            89.0    7e-18   
tpg|DAA35956.1|  TPA: hypothetical protein ZEAMMB73_447066            89.4    1e-17   
ref|XP_002463014.1|  hypothetical protein SORBIDRAFT_02g036230        89.4    1e-17   Sorghum bicolor [broomcorn]
ref|NP_001144341.1|  uncharacterized protein LOC100277244 precursor   84.7    7e-16   
ref|XP_009400645.1|  PREDICTED: uncharacterized GPI-anchored prot...  84.0    9e-16   
ref|XP_008677003.1|  PREDICTED: uncharacterized protein LOC100277...  84.3    1e-15   
ref|XP_008670488.1|  PREDICTED: uncharacterized GPI-anchored prot...  83.6    1e-15   Zea mays [maize]
ref|XP_008670487.1|  PREDICTED: uncharacterized GPI-anchored prot...  83.6    2e-15   
ref|XP_010911481.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.0    7e-15   
dbj|BAJ99254.1|  predicted protein                                    74.7    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN00049.1|  hypothetical protein glysoja_035611                   72.8    3e-12   Glycine soja [wild soybean]
gb|KGN63863.1|  hypothetical protein Csa_1G024950                     71.6    4e-12   Cucumis sativus [cucumbers]
gb|EAZ37101.1|  hypothetical protein OsJ_21441                        70.1    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057696.1|  Os06g0497400                                     68.9    8e-11   
ref|NP_001183921.1|  uncharacterized protein LOC100502514             68.6    9e-11   
dbj|BAD45779.1|  hypothetical protein                                 67.8    6e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EYU24846.1|  hypothetical protein MIMGU_mgv1a013501mg              65.9    7e-10   Erythranthe guttata [common monkey flower]
ref|XP_003563886.1|  PREDICTED: uncharacterized GPI-anchored prot...  58.5    8e-07   Brachypodium distachyon [annual false brome]
ref|XP_011100330.1|  PREDICTED: uncharacterized GPI-anchored prot...  55.5    8e-06   Sesamum indicum [beniseed]



>ref|XP_009621089.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nicotiana tomentosiformis]
Length=330

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 137/166 (83%), Gaps = 6/166 (4%)
 Frame = +2

Query  212  ANPDLPDPEPVSFST------PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND  373
            A P LP+P+P    +      PS PATIPAFPEQSN A CPLDL +EL+  IKS+CGS  
Sbjct  22   ALPVLPEPDPAEVHSQTFLPSPSPPATIPAFPEQSNVAGCPLDLPDELYHSIKSSCGSRS  81

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKAL  553
             SG +HRTRCCPVLAAWLYSAYS TAL RA +K+P++T+ DMPVLPDDSETCVDSLEKAL
Sbjct  82   NSGQVHRTRCCPVLAAWLYSAYSETALHRAVTKLPQSTSVDMPVLPDDSETCVDSLEKAL  141

Query  554  GNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            GN+GIELVKPN+TCDVVYCYCGIRLHPLSCPEAF++NS G+ VG +
Sbjct  142  GNRGIELVKPNETCDVVYCYCGIRLHPLSCPEAFAVNSQGKLVGDK  187



>ref|XP_010318632.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Solanum 
lycopersicum]
Length=330

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 142/172 (83%), Gaps = 6/172 (3%)
 Frame = +2

Query  194  CIPVSIANPDLPDPEPVSFST----PST--PATIPAFPEQSNTAACPLDLTEELFRGIKS  355
            C P  ++ P LP+P+PV   +    PS+  PATIPAFPEQSN A CPLDL E+L+  +KS
Sbjct  16   CPPELLSMPVLPEPDPVEVRSQTFLPSSAPPATIPAFPEQSNVAGCPLDLPEDLYHSVKS  75

Query  356  ACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVD  535
            ACGS+ YSG +H+TRCCPVLAAWLYSAYS TAL RA +K+P++T+ DMPVLPDDSETCVD
Sbjct  76   ACGSHGYSGQVHQTRCCPVLAAWLYSAYSRTALHRAVTKLPQSTSIDMPVLPDDSETCVD  135

Query  536  SLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            S+EKAL N+GIELVKPN+TCDV YCYCGIRLHPLSCPEAFS++S G+ VG +
Sbjct  136  SIEKALANRGIELVKPNKTCDVFYCYCGIRLHPLSCPEAFSVDSKGKLVGDK  187



>ref|XP_006341566.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Solanum tuberosum]
Length=330

 Score =   246 bits (629),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 141/170 (83%), Gaps = 6/170 (4%)
 Frame = +2

Query  200  PVSIANPDLPDPEPVSFST----PST--PATIPAFPEQSNTAACPLDLTEELFRGIKSAC  361
            P  ++ P LP+P+P    +    PS+  PATIPAFPEQSN A CPLDL E+L+  +KSAC
Sbjct  18   PELLSMPVLPEPDPFEVRSQTFLPSSAPPATIPAFPEQSNVAGCPLDLPEDLYHSVKSAC  77

Query  362  GSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSL  541
            GS+ YSG +H+TRCCPVLAAWLYSAYS TAL RA +K+P++T+ DMPVLPDDSETCVDS+
Sbjct  78   GSHGYSGQVHQTRCCPVLAAWLYSAYSRTALHRAVTKLPQSTSVDMPVLPDDSETCVDSI  137

Query  542  EKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            EKALGN+GIELVKPN+TCDV YCYCGIRLHPLSCPEAFS++S G+ VG +
Sbjct  138  EKALGNRGIELVKPNKTCDVFYCYCGIRLHPLSCPEAFSVDSKGKLVGDK  187



>ref|XP_006365405.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Solanum tuberosum]
Length=328

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +2

Query  209  IANPDLPDPEPVSFS-TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGP  385
            I  PD  +P P  FS  PS PATIPAFPEQSN  +C LD+ EEL++GIKS+C SND+SG 
Sbjct  28   IPEPDPTEPNPHPFSPAPSLPATIPAFPEQSNFDSCSLDIPEELYKGIKSSCRSNDHSGQ  87

Query  386  LHRTRCCPVLAAWLYSAYSTTALQRATSKIPR-TTTFDMPVLPDDSETCVDSLEKALGNK  562
            ++ TRCCPVLAAWLY+AYS TAL RA +K P+ +T+ +MPVLPDDSETCVDS  KAL N+
Sbjct  88   INPTRCCPVLAAWLYAAYSRTALHRAIAKFPQYSTSVEMPVLPDDSETCVDSFGKALENR  147

Query  563  GIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            GIELVKPN+TCDVVYCYCGIRLHPLSCPE F++NS GE VG +
Sbjct  148  GIELVKPNETCDVVYCYCGIRLHPLSCPENFAVNSRGELVGGE  190



>emb|CDO98373.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 136/186 (73%), Gaps = 27/186 (15%)
 Frame = +2

Query  212  ANPDLPDP-------EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS-  367
            A P LP+P       +P++  TPS PATIPAFPE+SN   CPLDL ++LF G+KSACGS 
Sbjct  24   ALPQLPNPDPAPVQTQPLALPTPSPPATIPAFPEESNVDGCPLDLPDDLFSGVKSACGSG  83

Query  368  ----------NDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT--------F  493
                      N YSG LHRTRCCPVLAAWLY+AYS TALQRAT  I +TTT         
Sbjct  84   AKHHHAMADPNSYSGQLHRTRCCPVLAAWLYAAYSATALQRATG-IDKTTTPQTASAREV  142

Query  494  DMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHG  673
            DMP+LPDDSETCVDSLEKALGNKG+ L KPN+TCD VYCYCGIRLHPLSCPEAF +NS G
Sbjct  143  DMPLLPDDSETCVDSLEKALGNKGVNLAKPNETCDFVYCYCGIRLHPLSCPEAFYVNSLG  202

Query  674  EXVGHQ  691
            + VG +
Sbjct  203  KLVGGE  208



>ref|XP_009793934.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Nicotiana 
sylvestris]
Length=330

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 138/166 (83%), Gaps = 6/166 (4%)
 Frame = +2

Query  212  ANPDLPDPEPVSFST------PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND  373
            A P LP+P+P    +      PS PATIPAFPEQSN A CPLDL +EL+  IKS+CGS+ 
Sbjct  22   ALPVLPEPDPAEVHSQTFLPSPSPPATIPAFPEQSNVAGCPLDLPDELYHSIKSSCGSSS  81

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKAL  553
             SG +HRTRCCPVLAAWLYSAYS TAL RA +K+P++T+ DMPVLPDDSETCVDSLEKAL
Sbjct  82   NSGQVHRTRCCPVLAAWLYSAYSETALHRAVTKLPQSTSVDMPVLPDDSETCVDSLEKAL  141

Query  554  GNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            GN+GIELVKPN+TCD+VYCYCGIRLHPLSCPEAFS+NS G+ VG +
Sbjct  142  GNRGIELVKPNETCDLVYCYCGIRLHPLSCPEAFSVNSQGKLVGDK  187



>ref|XP_007036757.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY21258.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=270

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 128/169 (76%), Gaps = 8/169 (5%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS---NDY  376
            SI+NPD  + +P+   T S PATIPAFPEQSN   CPLDL EELF GIKSACG+   N  
Sbjct  26   SISNPDPANRQPLPI-TASPPATIPAFPEQSNVVGCPLDLPEELFHGIKSACGTKNENGI  84

Query  377  SGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIP----RTTTFDMPVLPDDSETCVDSLE  544
            +G LHR+RCCPVLA WLY+AYS TAL  A   +P    RT ++DMP+LPDDSETCVD L 
Sbjct  85   TGQLHRSRCCPVLATWLYAAYSATALSGAGRVVPAVAGRTPSYDMPLLPDDSETCVDDLG  144

Query  545  KALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            KAL  KGIEL KPN+TCDVVYCYCGIRLHPLSCPEAFS++  G  VG +
Sbjct  145  KALRQKGIELAKPNETCDVVYCYCGIRLHPLSCPEAFSVDQSGNLVGDE  193



>ref|XP_007036758.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY21259.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=236

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 128/169 (76%), Gaps = 8/169 (5%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS---NDY  376
            SI+NPD  + +P+   T S PATIPAFPEQSN   CPLDL EELF GIKSACG+   N  
Sbjct  26   SISNPDPANRQPLPI-TASPPATIPAFPEQSNVVGCPLDLPEELFHGIKSACGTKNENGI  84

Query  377  SGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIP----RTTTFDMPVLPDDSETCVDSLE  544
            +G LHR+RCCPVLA WLY+AYS TAL  A   +P    RT ++DMP+LPDDSETCVD L 
Sbjct  85   TGQLHRSRCCPVLATWLYAAYSATALSGAGRVVPAVAGRTPSYDMPLLPDDSETCVDDLG  144

Query  545  KALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            KAL  KGIEL KPN+TCDVVYCYCGIRLHPLSCPEAFS++  G  VG +
Sbjct  145  KALRQKGIELAKPNETCDVVYCYCGIRLHPLSCPEAFSVDQSGNLVGDE  193



>ref|XP_011039109.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Populus euphratica]
Length=334

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 128/166 (77%), Gaps = 10/166 (6%)
 Frame = +2

Query  224  LPDPEPVS---FST-PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSN-DYSGPL  388
            LP+P+P +   F T P+ PATIPA PEQSN A CPL+L  ELF GIKSACGS    +G L
Sbjct  22   LPNPDPATIQPFKTGPTPPATIPASPEQSNLAGCPLELPNELFHGIKSACGSGFSANGHL  81

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT-----FDMPVLPDDSETCVDSLEKAL  553
            HRTRCCPVLAAWLYSAYS TAL R    IP +TT     +DMP+LPDDSETCVD+L K L
Sbjct  82   HRTRCCPVLAAWLYSAYSATALSRVNEVIPASTTGRSPSYDMPLLPDDSETCVDALSKGL  141

Query  554  GNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
              KGIELVKPN+TCDVVYCYCGIRLHPLSCPEAFSMN  G+ VG +
Sbjct  142  KEKGIELVKPNETCDVVYCYCGIRLHPLSCPEAFSMNRKGKLVGDK  187



>gb|EYU24115.1| hypothetical protein MIMGU_mgv1a009301mg [Erythranthe guttata]
Length=346

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 135/183 (74%), Gaps = 21/183 (11%)
 Frame = +2

Query  197  IPVSIANPDLPDPEPVSFST------PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSA  358
            +P+S A P LPDP+P +  T      P+ PATIPAFPEQS  +ACPLDL E+LF GIKSA
Sbjct  22   LPLS-ALPVLPDPDPATVQTQTQTLHPAPPATIPAFPEQSAASACPLDLPEDLFHGIKSA  80

Query  359  CGS--------NDYSGPLHRTRCCPVLAAWLYSAYSTTALQRAT------SKIPRTTTFD  496
            CGS        N Y+G LHR+RCCPVLAAWLYSAYS T L+             +T  +D
Sbjct  81   CGSKPHHRPDPNSYAGQLHRSRCCPVLAAWLYSAYSKTGLRTTAAATTTKGSATQTAPYD  140

Query  497  MPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGE  676
            MPVLPDDSETCVD+LEKALGN+GIEL +PN+TCDVVYCYCGIRLHP +CPEAF++N+ G+
Sbjct  141  MPVLPDDSETCVDTLEKALGNRGIELKRPNETCDVVYCYCGIRLHPFTCPEAFTVNTRGK  200

Query  677  XVG  685
             VG
Sbjct  201  LVG  203



>ref|XP_007036756.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY21257.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=341

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 128/169 (76%), Gaps = 8/169 (5%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS---NDY  376
            SI+NPD  + +P+   T S PATIPAFPEQSN   CPLDL EELF GIKSACG+   N  
Sbjct  26   SISNPDPANRQPLPI-TASPPATIPAFPEQSNVVGCPLDLPEELFHGIKSACGTKNENGI  84

Query  377  SGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIP----RTTTFDMPVLPDDSETCVDSLE  544
            +G LHR+RCCPVLA WLY+AYS TAL  A   +P    RT ++DMP+LPDDSETCVD L 
Sbjct  85   TGQLHRSRCCPVLATWLYAAYSATALSGAGRVVPAVAGRTPSYDMPLLPDDSETCVDDLG  144

Query  545  KALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            KAL  KGIEL KPN+TCDVVYCYCGIRLHPLSCPEAFS++  G  VG +
Sbjct  145  KALRQKGIELAKPNETCDVVYCYCGIRLHPLSCPEAFSVDQSGNLVGDE  193



>ref|XP_011084420.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Sesamum 
indicum]
Length=342

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 130/175 (74%), Gaps = 17/175 (10%)
 Frame = +2

Query  212  ANPDLPDPEPVSFSTPS---------TPATIPAFPEQSNTAACPLDLTEELFRGIKSACG  364
            A P LPDP+P +  T +          PATIPAFPEQS  + CPLDL+E+LF G+KSACG
Sbjct  22   ALPILPDPDPATVQTQTQTLHHPPPSPPATIPAFPEQSELSGCPLDLSEDLFHGVKSACG  81

Query  365  SNDYSGP--------LHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDS  520
            S  +  P        LHR+RCCPVLAAWLYSAYS T L+  T   P+TT +DMPVLPDDS
Sbjct  82   SKSHHKPDPSSYADQLHRSRCCPVLAAWLYSAYSKTGLRATTKAPPQTTPYDMPVLPDDS  141

Query  521  ETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            ETCVD+LEKALGN+GI+L +PN+TCDVVYCYCGIRLHP SCPEAF +NS G+ VG
Sbjct  142  ETCVDTLEKALGNRGIQLGRPNETCDVVYCYCGIRLHPFSCPEAFWVNSRGKLVG  196



>ref|XP_011000468.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Populus 
euphratica]
Length=418

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 125/168 (74%), Gaps = 10/168 (6%)
 Frame = +2

Query  218  PDLPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS-NDYSG  382
            P LP+P+  +       PS PATIPAFPEQSN A CPLDL  ELF GI SAC S +  +G
Sbjct  104  PGLPNPDTAAIQPFKPNPSPPATIPAFPEQSNLAGCPLDLPNELFHGINSACASGSSVTG  163

Query  383  PLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT-----FDMPVLPDDSETCVDSLEK  547
             LHRTRCCPVLAAWLYSAYS TAL RA   IP T T     +DMP+LPDDSETCVD L K
Sbjct  164  NLHRTRCCPVLAAWLYSAYSATALSRANKVIPATDTGRSPSYDMPLLPDDSETCVDGLSK  223

Query  548  ALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
             L  KGIEL KPN+TCDVVYCYCGIRLHPLSCPEAFS+N +G+ VG +
Sbjct  224  GLKEKGIELFKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGKLVGDK  271



>ref|XP_002322090.1| hypothetical protein POPTR_0015s04320g [Populus trichocarpa]
 gb|EEF06217.1| hypothetical protein POPTR_0015s04320g [Populus trichocarpa]
Length=334

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 118/152 (78%), Gaps = 6/152 (4%)
 Frame = +2

Query  254  TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS-NDYSGPLHRTRCCPVLAAWLY  430
             PS PA IPAFPEQSN A CPLDL  ELF GI SACGS +  +G LHRTRCCPVLAAWLY
Sbjct  36   NPSPPAIIPAFPEQSNLAGCPLDLPNELFHGINSACGSGSSATGHLHRTRCCPVLAAWLY  95

Query  431  SAYSTTALQRATSKIPRTTT-----FDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTC  595
            SAYS TAL RA   IP T T     +DMP+LPDDSETCVD L K L  KGIEL KPN+TC
Sbjct  96   SAYSATALSRANKVIPATDTGRSPSYDMPLLPDDSETCVDGLSKGLKEKGIELFKPNETC  155

Query  596  DVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            DVVYCYCGIRLHPLSCPEAFS+N +G+ VG +
Sbjct  156  DVVYCYCGIRLHPLSCPEAFSLNQNGKLVGDK  187



>gb|ABK95654.1| unknown [Populus trichocarpa]
Length=334

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 118/152 (78%), Gaps = 6/152 (4%)
 Frame = +2

Query  254  TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS-NDYSGPLHRTRCCPVLAAWLY  430
             PS PA IPAFPEQSN A CPLDL  ELF GI SACGS +  +G LHRTRCCPVLAAWLY
Sbjct  36   NPSPPAIIPAFPEQSNLAGCPLDLPNELFHGINSACGSGSSATGHLHRTRCCPVLAAWLY  95

Query  431  SAYSTTALQRATSKIPRTTT-----FDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTC  595
            SAYS TAL RA   IP T T     +DMP+LPDDSETCVD L K L  KGIEL KPN+TC
Sbjct  96   SAYSATALSRANRVIPATDTGRSPSYDMPLLPDDSETCVDGLSKGLKEKGIELFKPNETC  155

Query  596  DVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            DVVYCYCGIRLHPLSCPEAFS+N +G+ VG +
Sbjct  156  DVVYCYCGIRLHPLSCPEAFSLNQNGKLVGDK  187



>ref|XP_009611061.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nicotiana tomentosiformis]
Length=331

 Score =   221 bits (562),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 134/167 (80%), Gaps = 7/167 (4%)
 Frame = +2

Query  212  ANPDLPDPEPVSFS------TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND  373
            A P LP+P+P          +PS P+TIPAFPEQSN  +CPLD+ EEL++GI+SAC SND
Sbjct  24   AYPVLPEPDPTELDPQILSPSPSPPSTIPAFPEQSNIDSCPLDMPEELYKGIRSACRSND  83

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPR-TTTFDMPVLPDDSETCVDSLEKA  550
            +SG ++ TRCCPVLAAWLYSAYS TAL +A +K P+ +T+ +MPVLPDDSETCV+S  KA
Sbjct  84   HSGQINPTRCCPVLAAWLYSAYSRTALHKAIAKFPQYSTSVNMPVLPDDSETCVNSFGKA  143

Query  551  LGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            L N+GIELVKPN+TCDVVYCYCGIRLHPLSCPEAF +NS  E VG +
Sbjct  144  LENRGIELVKPNETCDVVYCYCGIRLHPLSCPEAFFVNSRRELVGGE  190



>ref|XP_010322619.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Solanum lycopersicum]
Length=328

 Score =   219 bits (557),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 132/167 (79%), Gaps = 7/167 (4%)
 Frame = +2

Query  212  ANPDLPDPEPV-----SFS-TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND  373
            A P +P+P+P      SFS  PS PATIPAFPEQSN  +C LD+ E+L++GI S+C SND
Sbjct  24   AFPVIPEPDPTETNPHSFSPAPSLPATIPAFPEQSNFDSCSLDIPEDLYKGITSSCRSND  83

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPR-TTTFDMPVLPDDSETCVDSLEKA  550
            +SG ++ T CCPVLAAWLY+AYS TAL RA +K P+ + + +MPVLPDDSETCV S  KA
Sbjct  84   HSGQINPTSCCPVLAAWLYAAYSRTALHRAIAKFPQYSMSAEMPVLPDDSETCVVSFGKA  143

Query  551  LGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            L N+GIELVKPN+TCDVVYCYCGIRLHPLSCPE F++NS GE VG +
Sbjct  144  LENRGIELVKPNETCDVVYCYCGIRLHPLSCPEKFTLNSSGEIVGGE  190



>ref|XP_009780115.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nicotiana sylvestris]
Length=330

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 134/167 (80%), Gaps = 7/167 (4%)
 Frame = +2

Query  212  ANPDLPDPEPVSFS------TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND  373
            A P LP+P+P          +PS P+TIPAFPEQSN  +CPLD+ EEL++GI+SAC SND
Sbjct  23   AFPVLPEPDPTELDPQILSPSPSPPSTIPAFPEQSNIDSCPLDIPEELYKGIRSACRSND  82

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPR-TTTFDMPVLPDDSETCVDSLEKA  550
            +SG ++ TRCCPVLAAWLY+AYS TAL +A +K P+ +T+ +MPVLPDDSETCV+S  KA
Sbjct  83   HSGQINPTRCCPVLAAWLYTAYSRTALHKAIAKFPQYSTSVNMPVLPDDSETCVNSFGKA  142

Query  551  LGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            L N+GIELVKPN+TCD+VYCYCGIRLHPLSCPEAF +NS  E VG +
Sbjct  143  LENRGIELVKPNETCDMVYCYCGIRLHPLSCPEAFFVNSRRELVGGE  189



>ref|XP_003634199.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Vitis 
vinifera]
Length=327

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 6/162 (4%)
 Frame = +2

Query  224  LPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND-YSGPL  388
            LP+P+PV        PS P TIPAFPEQS+ A CPL+L +ELF GIK+AC +    SG L
Sbjct  20   LPEPDPVKIHPFHPNPSPPETIPAFPEQSDVAGCPLNLPDELFHGIKTACSAGKGASGEL  79

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKI-PRTTTFDMPVLPDDSETCVDSLEKALGNKG  565
             R+RCCPVLAAWLYSAYS TAL RA   + P  T +D+P+LPDDSETCV+ LEK+L ++G
Sbjct  80   RRSRCCPVLAAWLYSAYSGTALGRAKRGLAPEATPYDLPLLPDDSETCVNDLEKSLKSRG  139

Query  566  IELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            +ELVKPN+TCDVVYC+CGIRLHPLSCPEAFS++S G+ VG +
Sbjct  140  VELVKPNETCDVVYCFCGIRLHPLSCPEAFSVSSKGKLVGDE  181



>ref|XP_006451658.1| hypothetical protein CICLE_v10008811mg [Citrus clementina]
 ref|XP_006490745.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Citrus sinensis]
 gb|ESR64898.1| hypothetical protein CICLE_v10008811mg [Citrus clementina]
Length=347

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 15/170 (9%)
 Frame = +2

Query  224  LPDPEP-------VSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACG-----S  367
            LPDP+P       VS ++PS PATIPAFPEQSN A CPLDL EELF  +KSAC      +
Sbjct  31   LPDPDPETIQPLVVSTTSPSPPATIPAFPEQSNVAGCPLDLPEELFHSVKSACTGGHLTT  90

Query  368  NDYSGPLHRTRCCPVLAAWLYSAYSTTALQRA---TSKIPRTTTFDMPVLPDDSETCVDS  538
               S  L R+RCCPVLA WLY+AYSTTAL RA   T+K P T + D+P+LPDDSETCVD 
Sbjct  91   TQASSQLTRSRCCPVLATWLYAAYSTTALGRAATETAKTPATRSVDLPLLPDDSETCVDD  150

Query  539  LEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGH  688
            L KA+  +GI+L +PN+TCDVVYCYCGIRLHPL+CPEAFS+N  G+ VG+
Sbjct  151  LGKAMKQRGIDLPRPNETCDVVYCYCGIRLHPLTCPEAFSLNPRGKLVGN  200



>emb|CBI15549.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 6/162 (4%)
 Frame = +2

Query  224  LPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND-YSGPL  388
            LP+P+PV        PS P TIPAFPEQS+ A CPL+L +ELF GIK+AC +    SG L
Sbjct  20   LPEPDPVKIHPFHPNPSPPETIPAFPEQSDVAGCPLNLPDELFHGIKTACSAGKGASGEL  79

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKI-PRTTTFDMPVLPDDSETCVDSLEKALGNKG  565
             R+RCCPVLAAWLYSAYS TAL RA   + P  T +D+P+LPDDSETCV+ LEK+L ++G
Sbjct  80   RRSRCCPVLAAWLYSAYSGTALGRAKRGLAPEATPYDLPLLPDDSETCVNDLEKSLKSRG  139

Query  566  IELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            +ELVKPN+TCDVVYC+CGIRLHPLSCPEAFS++S G+ VG +
Sbjct  140  VELVKPNETCDVVYCFCGIRLHPLSCPEAFSVSSKGKLVGDE  181



>ref|XP_002533130.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29257.1| conserved hypothetical protein [Ricinus communis]
Length=330

 Score =   211 bits (536),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 121/160 (76%), Gaps = 8/160 (5%)
 Frame = +2

Query  230  DPEPVSFST----PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRT  397
            +P+PV+  +    PS PATIPAFPEQSN A CPLD+ +ELF  +KSACG+      LH++
Sbjct  26   NPDPVTIQSFLPNPSPPATIPAFPEQSNIAGCPLDIPDELFHSVKSACGNGQQQ--LHKS  83

Query  398  RCCPVLAAWLYSAYSTTALQRATSKIPRTTT--FDMPVLPDDSETCVDSLEKALGNKGIE  571
            RCCPVLAAWLY+AYS TAL RA    P T    +DMP+LPDDSETCVD L KAL  KG+E
Sbjct  84   RCCPVLAAWLYAAYSATALGRAARVAPATVAGAYDMPLLPDDSETCVDDLGKALSQKGVE  143

Query  572  LVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            LV+PN+TCD+VYCYCGIRLHPLSC EAFS N  G+ VG +
Sbjct  144  LVRPNETCDLVYCYCGIRLHPLSCSEAFSTNQEGKLVGDK  183



>gb|KDO62890.1| hypothetical protein CISIN_1g038515mg, partial [Citrus sinensis]
Length=320

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 126/170 (74%), Gaps = 15/170 (9%)
 Frame = +2

Query  224  LPDPEP-------VSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACG-----S  367
            LPDP+P       VS ++PS PATIPAFPEQSN A CPLDL EELF  +KSAC      +
Sbjct  4    LPDPDPETIQPLVVSTTSPSPPATIPAFPEQSNVAGCPLDLPEELFHSVKSACTGGHLTT  63

Query  368  NDYSGPLHRTRCCPVLAAWLYSAYSTTALQRA---TSKIPRTTTFDMPVLPDDSETCVDS  538
               S  L R+RCCPVLA WLY+AYS TAL RA   T+K P T + D+P+LPDDSETCVD 
Sbjct  64   TQASSQLTRSRCCPVLATWLYAAYSATALGRAATETAKTPATRSVDLPLLPDDSETCVDD  123

Query  539  LEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGH  688
            L KA+  +GI+L +PN+TCDVVYCYCGIRLHPL+CPEAFS+N  G+ VG+
Sbjct  124  LGKAMKQRGIDLPRPNETCDVVYCYCGIRLHPLTCPEAFSLNPRGKLVGN  173



>ref|XP_008453468.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Cucumis 
melo]
Length=334

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 127/166 (77%), Gaps = 10/166 (6%)
 Frame = +2

Query  224  LPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACG--SNDYSGP  385
            LP P+P++        S PATIPAFPEQS+   CPLDL +ELF GIK+ACG      SG 
Sbjct  24   LPHPDPLTIRPLQVNQSPPATIPAFPEQSDVQGCPLDLPDELFHGIKTACGPSKGGISGQ  83

Query  386  LHRTRCCPVLAAWLYSAYSTTALQRATSK--IPRTT--TFDMPVLPDDSETCVDSLEKAL  553
            LHR+RCCPVLAAWLY+AYS TALQRA     +P  T  ++D+P+LPDDSETCV +L++AL
Sbjct  84   LHRSRCCPVLAAWLYAAYSATALQRAGRGGVVPGHTAPSYDLPLLPDDSETCVSNLDQAL  143

Query  554  GNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
              +GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS+N +G   G++
Sbjct  144  NQRGIELMKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGILEGNR  189



>ref|XP_002317884.2| hypothetical protein POPTR_0012s04630g [Populus trichocarpa]
 gb|EEE96104.2| hypothetical protein POPTR_0012s04630g [Populus trichocarpa]
Length=334

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 125/166 (75%), Gaps = 10/166 (6%)
 Frame = +2

Query  224  LPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGP-L  388
            +P+P+P +       P+ PATIPA PEQSN A CPL+L  ELF GIKSACGS   +   L
Sbjct  22   MPNPDPATIQPFKPGPTPPATIPASPEQSNLAGCPLELPNELFNGIKSACGSGSSASGHL  81

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT-----FDMPVLPDDSETCVDSLEKAL  553
            HRTRCCPVLAAWLYSAYS TAL RA   IP TTT     +DMP+LPDDSETCVD L K L
Sbjct  82   HRTRCCPVLAAWLYSAYSATALSRANKVIPATTTGRSPSYDMPLLPDDSETCVDGLSKGL  141

Query  554  GNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
              KGIELVKPN+TCDVVYCYCGIRLHPLSCPEAFS+N  G+ VG +
Sbjct  142  KEKGIELVKPNETCDVVYCYCGIRLHPLSCPEAFSLNRKGKLVGDK  187



>gb|KCW83996.1| hypothetical protein EUGRSUZ_B00868 [Eucalyptus grandis]
Length=303

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 119/174 (68%), Gaps = 12/174 (7%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND  373
            +++  D P+PEP         PS  ATIPAFPEQS  A CPLDL +ELFRG++SACG   
Sbjct  22   ALSTADHPEPEPAIVQPLHVNPSPAATIPAFPEQSAAAGCPLDLPDELFRGVRSACGGGG  81

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTAL--------QRATSKIPRTTTFDMPVLPDDSETC  529
              G L RTRCCPVLAAWLYSAYS+TAL                RT  +DMP+LPDDSETC
Sbjct  82   SWGDLQRTRCCPVLAAWLYSAYSSTALGSAAAAAGAGGGGAGGRTPAYDMPLLPDDSETC  141

Query  530  VDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            VD L KA   +G+ L +PN+TCDVVYCYCGIRLHPLSCP AFS+N  G+ VG +
Sbjct  142  VDGLGKAFRERGVALARPNETCDVVYCYCGIRLHPLSCPAAFSVNRRGKLVGDE  195



>ref|XP_004160422.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis sativus]
Length=334

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 125/163 (77%), Gaps = 10/163 (6%)
 Frame = +2

Query  233  PEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACG--SNDYSGPLHR  394
            P+P++        S PATIPAFPEQS+   CPLDL +ELF GIK+ACG      SG LHR
Sbjct  27   PDPLTIRPFQVNQSPPATIPAFPEQSDVQGCPLDLPDELFHGIKTACGPSKGGVSGQLHR  86

Query  395  TRCCPVLAAWLYSAYSTTALQRATSK--IPRTT--TFDMPVLPDDSETCVDSLEKALGNK  562
            +RCCPVLAAWLY+AYS TALQRA     +P  T  ++D+P+LPDDSETCV +L++AL  +
Sbjct  87   SRCCPVLAAWLYAAYSATALQRAGRGGVVPGHTAPSYDLPLLPDDSETCVSNLDQALNQR  146

Query  563  GIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS+N +G   G++
Sbjct  147  GIELMKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGILEGNR  189



>ref|XP_010032707.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Eucalyptus 
grandis]
 gb|KCW83995.1| hypothetical protein EUGRSUZ_B00868 [Eucalyptus grandis]
Length=345

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 119/174 (68%), Gaps = 12/174 (7%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND  373
            +++  D P+PEP         PS  ATIPAFPEQS  A CPLDL +ELFRG++SACG   
Sbjct  22   ALSTADHPEPEPAIVQPLHVNPSPAATIPAFPEQSAAAGCPLDLPDELFRGVRSACGGGG  81

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTAL--------QRATSKIPRTTTFDMPVLPDDSETC  529
              G L RTRCCPVLAAWLYSAYS+TAL                RT  +DMP+LPDDSETC
Sbjct  82   SWGDLQRTRCCPVLAAWLYSAYSSTALGSAAAAAGAGGGGAGGRTPAYDMPLLPDDSETC  141

Query  530  VDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            VD L KA   +G+ L +PN+TCDVVYCYCGIRLHPLSCP AFS+N  G+ VG +
Sbjct  142  VDGLGKAFRERGVALARPNETCDVVYCYCGIRLHPLSCPAAFSVNRRGKLVGDE  195



>ref|XP_008374829.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Malus domestica]
 ref|XP_008374831.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Malus domestica]
Length=330

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 120/168 (71%), Gaps = 10/168 (6%)
 Frame = +2

Query  212  ANPDLPDPEPVSFS------TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS--  367
            A P LP+P+P S        TPS  ATIPAFPEQS+ A CPLDL  ELF GIKSAC +  
Sbjct  14   AFPGLPNPDPASIQSFHPARTPSPSATIPAFPEQSDLAGCPLDLPNELFHGIKSACSATK  73

Query  368  NDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT--FDMPVLPDDSETCVDSL  541
             D S  L R+RCCP LAAWLYSAYS TAL R     P  +   +D+P+LPDDSETCV+ L
Sbjct  74   GDSSDHLQRSRCCPALAAWLYSAYSATALGRVGRVSPAVSGQPYDLPLLPDDSETCVEDL  133

Query  542  EKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
             +AL  +GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAF  N  G+ VG
Sbjct  134  GQALKTRGIELIKPNETCDVVYCYCGIRLHPLSCPEAFWENERGKLVG  181



>gb|KJB77262.1| hypothetical protein B456_012G128400 [Gossypium raimondii]
Length=241

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 123/167 (74%), Gaps = 8/167 (5%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS---NDY  376
            +I++PD  + + +  ST S PATIPAFPEQSN   CPLDL E+LF  + +ACG+   N  
Sbjct  23   TISSPDALNVQSLPLST-SPPATIPAFPEQSNVVGCPLDLPEQLFHSVTNACGTKRNNGV  81

Query  377  SGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIP----RTTTFDMPVLPDDSETCVDSLE  544
            +  LHR+RCCPVLAAWLY+AYS TAL      +P    RT ++DMP+LPDDSETCVD L 
Sbjct  82   ASELHRSRCCPVLAAWLYAAYSATALGGVGRVVPAVAGRTPSYDMPLLPDDSETCVDDLG  141

Query  545  KALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            KAL  +G+EL KPN+TCD VYCYCGIRLHPL+CP+AFS++  G  VG
Sbjct  142  KALKQRGVELAKPNETCDAVYCYCGIRLHPLTCPDAFSVDQKGNLVG  188



>gb|KHG14842.1| hypothetical protein F383_16641 [Gossypium arboreum]
Length=338

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 124/167 (74%), Gaps = 8/167 (5%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS---NDY  376
            ++++PD  + + +  ST S PATIPAFPEQSN   CPLDL E+LF  +K+ACG+   N  
Sbjct  23   TMSSPDALNVQSLPLST-SPPATIPAFPEQSNVVGCPLDLPEQLFHSVKNACGTKRNNGV  81

Query  377  SGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIP----RTTTFDMPVLPDDSETCVDSLE  544
            +  LHR+RCCPVLAAWLY+AYS TAL      +P    RT ++DMP+LPDDSETCVD L 
Sbjct  82   ASELHRSRCCPVLAAWLYAAYSATALGGVGRVVPAVAGRTPSYDMPLLPDDSETCVDDLG  141

Query  545  KALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            KAL  +G+EL KPN+TCD VYCYCGIRLHPL+CP+AFS++  G  VG
Sbjct  142  KALKQRGVELAKPNETCDAVYCYCGIRLHPLTCPDAFSVDQKGNLVG  188



>gb|KJB77261.1| hypothetical protein B456_012G128400 [Gossypium raimondii]
Length=338

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 123/167 (74%), Gaps = 8/167 (5%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS---NDY  376
            +I++PD  + + +  ST S PATIPAFPEQSN   CPLDL E+LF  + +ACG+   N  
Sbjct  23   TISSPDALNVQSLPLST-SPPATIPAFPEQSNVVGCPLDLPEQLFHSVTNACGTKRNNGV  81

Query  377  SGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIP----RTTTFDMPVLPDDSETCVDSLE  544
            +  LHR+RCCPVLAAWLY+AYS TAL      +P    RT ++DMP+LPDDSETCVD L 
Sbjct  82   ASELHRSRCCPVLAAWLYAAYSATALGGVGRVVPAVAGRTPSYDMPLLPDDSETCVDDLG  141

Query  545  KALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            KAL  +G+EL KPN+TCD VYCYCGIRLHPL+CP+AFS++  G  VG
Sbjct  142  KALKQRGVELAKPNETCDAVYCYCGIRLHPLTCPDAFSVDQKGNLVG  188



>ref|XP_009356061.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Pyrus x bretschneideri]
Length=330

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 120/168 (71%), Gaps = 10/168 (6%)
 Frame = +2

Query  212  ANPDLPDPEPV---SF---STPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS--  367
            A P LP+P+P    SF    T S PATIPAFPEQS+ A CPLDL  ELF GIKSAC +  
Sbjct  14   AFPGLPNPDPAPIQSFHPARTSSPPATIPAFPEQSDLAGCPLDLPNELFHGIKSACSATK  73

Query  368  NDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT--FDMPVLPDDSETCVDSL  541
             D S  L R+RCCP LAAWLYSAYS TAL R     P      +D+P+LPDDSETCV+ L
Sbjct  74   GDSSDHLQRSRCCPALAAWLYSAYSATALGRVGRVSPAVAGQPYDLPLLPDDSETCVEDL  133

Query  542  EKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
             +AL  +GI+L+KPN+TCDVVYCYCGIRLHPLSCPEAF  N  G+ VG
Sbjct  134  GQALKTRGIDLIKPNETCDVVYCYCGIRLHPLSCPEAFWENERGKLVG  181



>ref|XP_008393412.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Malus domestica]
Length=333

 Score =   200 bits (508),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 119/170 (70%), Gaps = 10/170 (6%)
 Frame = +2

Query  212  ANPDLPDPEPV---SF---STPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS--  367
            A P LP+P      SF    TPS P TIPAFPEQS+   CPL L  ELF GIKSAC +  
Sbjct  15   AFPGLPNPGAAPTQSFLPNRTPSPPTTIPAFPEQSDLVGCPLHLPNELFHGIKSACSATK  74

Query  368  NDYSGPLHRTRCCPVLAAWLYSAYSTTALQRA--TSKIPRTTTFDMPVLPDDSETCVDSL  541
             D SG L R+RCCP LA+WLYSAYS TAL R           ++D+P+LPDD+ETCV  L
Sbjct  75   GDASGHLQRSRCCPALASWLYSAYSDTALGRVGRVGSAVAGQSYDLPLLPDDTETCVQDL  134

Query  542  EKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
             KAL N+GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS N  G+ VG +
Sbjct  135  GKALKNRGIELIKPNETCDVVYCYCGIRLHPLSCPEAFSENERGKLVGDE  184



>ref|XP_009360091.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Pyrus 
x bretschneideri]
Length=330

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 119/170 (70%), Gaps = 10/170 (6%)
 Frame = +2

Query  212  ANPDLPDPEPV---SF---STPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS--  367
            A P LP+P+     SF    TPS PATIPAFPEQS+   CPL L  ELF GIKSAC +  
Sbjct  15   AFPGLPNPDAAPTQSFLPNRTPSPPATIPAFPEQSDLVGCPLHLPNELFHGIKSACSATK  74

Query  368  NDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT--FDMPVLPDDSETCVDSL  541
             D SG L R+RCCP LA+WLY AYS TAL R     P      +D P+LPDD+ETCV  L
Sbjct  75   GDASGHLQRSRCCPALASWLYFAYSDTALGRVGRVGPAVAGQPYDPPLLPDDTETCVQDL  134

Query  542  EKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
             KAL N+GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS N  G+ VG +
Sbjct  135  GKALKNRGIELIKPNETCDVVYCYCGIRLHPLSCPEAFSENERGKLVGDE  184



>gb|EPS70389.1| hypothetical protein M569_04371 [Genlisea aurea]
Length=327

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 120/159 (75%), Gaps = 11/159 (7%)
 Frame = +2

Query  230  DPEPVSFST-----PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS----NDYSG  382
            DP P +  T      S+ ATIPAFPEQ++ ++CPLDL EELF  +KSACG     + YS 
Sbjct  24   DPFPATVETQTLQPASSAATIPAFPEQTDASSCPLDLPEELFHSVKSACGGSVEQDPYSR  83

Query  383  PLHRTRCCPVLAAWLYSAYSTTALQRATS--KIPRTTTFDMPVLPDDSETCVDSLEKALG  556
             LHR+RCCPVLAAWLYSAYS TAL+      + P+  ++DMPVLPDDSETCV++LEKALG
Sbjct  84   ELHRSRCCPVLAAWLYSAYSRTALRAGAGDGRPPQAASYDMPVLPDDSETCVETLEKALG  143

Query  557  NKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHG  673
            ++ I L +PN+TCDVVYCYCGIRLHP SCPEAF ++S G
Sbjct  144  DRDILLRRPNETCDVVYCYCGIRLHPFSCPEAFRVSSPG  182



>ref|XP_010097582.1| hypothetical protein L484_017392 [Morus notabilis]
 gb|EXB69114.1| hypothetical protein L484_017392 [Morus notabilis]
Length=333

 Score =   195 bits (495),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 117/168 (70%), Gaps = 16/168 (10%)
 Frame = +2

Query  212  ANPDLPDPEPVSFSTPSTP----ATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYS  379
            A P LPDP+ VS           ATIPAFPEQS+ A C LDL E+ F G+KSACG+    
Sbjct  18   AFPGLPDPDAVSIQPLLPSPSPPATIPAFPEQSDVAGCQLDLPEQFFHGVKSACGAE---  74

Query  380  GPLHRTRCCPVLAAWLYSAYSTTALQRAT-------SKIPRTTTFDMPVLPDDSETCVDS  538
              L R RCCPVLA+WLY+AYS TAL RA        +    TT +DMP+LPDDSETCV  
Sbjct  75   --LRRGRCCPVLASWLYAAYSATALGRAGRVAGPTPASAHNTTAYDMPLLPDDSETCVAD  132

Query  539  LEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXV  682
            ++KAL  +GIEL +PN+TCDVVYCYCGIRLHPLSCPEAFS++  G+ V
Sbjct  133  VDKALRGRGIELKRPNETCDVVYCYCGIRLHPLSCPEAFSVSQEGKVV  180



>ref|XP_004299540.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Fragaria 
vesca subsp. vesca]
Length=337

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 125/177 (71%), Gaps = 13/177 (7%)
 Frame = +2

Query  197  IPVSIANPDLPDPEPVSFSTP--STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSN  370
            +P S+A  + PDP  V    P  S PATIPAFPEQS+ A CPL L +ELF G+K+AC + 
Sbjct  19   LPSSLALTN-PDPAAVQPFLPKSSPPATIPAFPEQSDIAGCPLQLPDELFHGVKAACSAK  77

Query  371  --DYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPR--------TTTFDMPVLPDDS  520
              D +G L  +RCCPVLAAWLYSAYS TAL R+    P         TT +D P+LPDDS
Sbjct  78   KGDPAGHLQHSRCCPVLAAWLYSAYSATALGRSGRVGPAVTGHGSNTTTAYDPPLLPDDS  137

Query  521  ETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            ETCV  L KAL  KGIEL++PN+TCD+VYC CGIRLHPLSCPEAFS+N +G+ +G +
Sbjct  138  ETCVQDLGKALSAKGIELMRPNETCDMVYCNCGIRLHPLSCPEAFSVNQNGKLIGDK  194



>gb|KDP41131.1| hypothetical protein JCGZ_03622 [Jatropha curcas]
Length=331

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 123/161 (76%), Gaps = 7/161 (4%)
 Frame = +2

Query  227  PDPEPVSFSTPST--PATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTR  400
            PDPE +    P+T  P TIPAFPEQSN A CPLDL +ELF GIK+ACGS   +G LH++R
Sbjct  25   PDPETIQPFHPNTSPPTTIPAFPEQSNVAGCPLDLPDELFHGIKTACGSGS-TGQLHKSR  83

Query  401  CCPVLAAWLYSAYSTTALQRATSKIP----RTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
            CCPVLAAW Y+AYS TAL  A    P     T ++D+P+LPDDSETCVD L KAL  KGI
Sbjct  84   CCPVLAAWAYAAYSATALGGAVRVAPAMSGHTPSYDLPLLPDDSETCVDDLGKALEEKGI  143

Query  569  ELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            ELVKPN+TCDVVYCYCGIRLHPLSCPEAFSMN  G+ VG +
Sbjct  144  ELVKPNETCDVVYCYCGIRLHPLSCPEAFSMNQKGQLVGDK  184



>gb|AFK39957.1| unknown [Lotus japonicus]
Length=335

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 116/155 (75%), Gaps = 7/155 (5%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSG---PLHRTRCC  406
             P+S + P++  TIPAFPEQ+++A CPL L+E+ + GIKSACG+N + G    LH +RCC
Sbjct  39   RPIS-TNPTSQGTIPAFPEQADSAGCPLSLSEDHYEGIKSACGNNKHGGGDEKLHHSRCC  97

Query  407  PVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPN  586
            PVLAAWLYSAYS TAL       P   ++DMP+LPDDSETC   L KAL  +GIELV+PN
Sbjct  98   PVLAAWLYSAYSATALGGLVHGSP---SYDMPLLPDDSETCESDLGKALKVRGIELVQPN  154

Query  587  QTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            +TCDVVYCYCGIRLHPLSCPE+FS+   G  VG +
Sbjct  155  ETCDVVYCYCGIRLHPLSCPESFSVTPSGNLVGDE  189



>ref|XP_010465880.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Camelina sativa]
Length=336

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 118/173 (68%), Gaps = 15/173 (9%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFSTP-----STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSN  370
            +I +P  P+PE      P     S PATIPAFPEQS+ + CPLDL E+LF GIKSAC   
Sbjct  20   TILSPVSPNPEETVTVQPFRVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGK  79

Query  371  DYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPR------TTTFDMPVLPDDSETCV  532
                 LH+ RCCPVL AWLYSAYSTTAL R+ S   R       T  DMP+LPDDSETCV
Sbjct  80   K----LHKGRCCPVLGAWLYSAYSTTALSRSISAAARNASSSPMTQEDMPLLPDDSETCV  135

Query  533  DSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            D L K+L  +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G  VG +
Sbjct  136  DGLGKSLRQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNEEGRLVGDE  188



>ref|XP_002883104.1| hypothetical protein ARALYDRAFT_898158 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59363.1| hypothetical protein ARALYDRAFT_898158 [Arabidopsis lyrata subsp. 
lyrata]
Length=330

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 120/177 (68%), Gaps = 18/177 (10%)
 Frame = +2

Query  203  VSIANPDLPDPEPVS---FSTPSTP-ATIPAFPEQSNTAACPLDLTEELFRGIKSACGSN  370
             +I +P  P+ EPV+   F   S+P ATIPAFPEQS+   CPLDL E+LF GIKSAC   
Sbjct  16   FTILSPVSPNQEPVTVQPFRVKSSPPATIPAFPEQSDFFGCPLDLPEDLFHGIKSACSGK  75

Query  371  DYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPR----------TTTFDMPVLPDDS  520
                 LH+ RCCPVL AWLYSAYSTTAL R+ S   R          T   DMP+LPDDS
Sbjct  76   K----LHKGRCCPVLGAWLYSAYSTTALSRSISAAARNASSSSAAITTPEEDMPLLPDDS  131

Query  521  ETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            ETCVD L K+L  +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G  VG +
Sbjct  132  ETCVDGLGKSLRQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNEEGRLVGDE  188



>gb|ACU18611.1| unknown [Glycine max]
Length=360

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 124/171 (73%), Gaps = 8/171 (5%)
 Frame = +2

Query  203  VSIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSG  382
            +++ +PD    +P+  +  S+  TIPAFPEQ++ A CPL L++E + GIKSACGSN ++ 
Sbjct  31   LALPDPDADAVQPIIPNPSSSTGTIPAFPEQADAAGCPLSLSDEHYEGIKSACGSNKHAA  90

Query  383  P----LHRTRCCPVLAAWLYSAYSTTAL----QRATSKIPRTTTFDMPVLPDDSETCVDS  538
                 LHR+RCCPVLAAWLYSAYS TAL    Q   +    TT++DMP+LPDDSETCV  
Sbjct  91   DDDDDLHRSRCCPVLAAWLYSAYSATALSGGMQHERASKGHTTSYDMPLLPDDSETCVSD  150

Query  539  LEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            L KAL  +GI+L +PN+TCD+VYCYCGIRLHPL+CPE+FS+   G  V +Q
Sbjct  151  LGKALKIRGIQLFQPNETCDLVYCYCGIRLHPLTCPESFSVTPSGTLVVNQ  201



>gb|KHN00170.1| Putative GPI-anchored protein [Glycine soja]
Length=327

 Score =   190 bits (482),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 118/161 (73%), Gaps = 9/161 (6%)
 Frame = +2

Query  212  ANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND-YSGPL  388
              P +P+P     S+ ST  TIPAFPEQ++ A CPL+L+++ +  IKSACGSN      L
Sbjct  33   VQPIIPNP-----SSSSTTGTIPAFPEQADAAGCPLNLSDDHYEAIKSACGSNKPDDDDL  87

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
            HR+RCCPVLAAWLYSAYS TAL  +      TT++DMP+LPDDSETCV  L KAL  +GI
Sbjct  88   HRSRCCPVLAAWLYSAYSATALSASQG---HTTSYDMPLLPDDSETCVSDLGKALKVRGI  144

Query  569  ELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            +L +PN+TCDVVYCYCGIRLHPL+CPE+FS+   G  V +Q
Sbjct  145  QLFQPNETCDVVYCYCGIRLHPLTCPESFSVTPSGSLVVNQ  185



>ref|XP_003525199.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Glycine 
max]
Length=360

 Score =   191 bits (485),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 124/171 (73%), Gaps = 8/171 (5%)
 Frame = +2

Query  203  VSIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSG  382
            +++ +PD    +P+  +  S+  TIPAFPEQ++ A CPL L++E + GIKSACGSN ++ 
Sbjct  31   LALPDPDADAVQPIIPNPSSSTGTIPAFPEQADAAGCPLSLSDEHYEGIKSACGSNKHAA  90

Query  383  P----LHRTRCCPVLAAWLYSAYSTTAL----QRATSKIPRTTTFDMPVLPDDSETCVDS  538
                 LHR+RCCPVLAAWLYSAYS TAL    Q   +    TT++DMP+LPDDSETCV  
Sbjct  91   DDDDDLHRSRCCPVLAAWLYSAYSATALSGGMQHERASKGHTTSYDMPLLPDDSETCVSD  150

Query  539  LEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            L KAL  +GI+L +PN+TCD+VYCYCGIRLHPL+CPE+FS+   G  V +Q
Sbjct  151  LGKALKIRGIQLFQPNETCDLVYCYCGIRLHPLTCPESFSVTPSGTLVVNQ  201



>ref|XP_010549074.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Tarenaya 
hassleriana]
Length=337

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = +2

Query  230  DPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRT  397
            DP+P+S        S PATIPAFPEQS+ + CPLDL +EL   I S+CG       L R 
Sbjct  30   DPDPLSVQPFRVNSSPPATIPAFPEQSDFSGCPLDLPDELLHSIASSCGGGGRR-QLSRG  88

Query  398  RCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELV  577
            RCCPVL AWLY+AYS TAL R T+    ++  D+PVLPDDSETCVD L KA+  +GIEL 
Sbjct  89   RCCPVLGAWLYAAYSATALGRGTAGRNVSSADDLPVLPDDSETCVDGLGKAMRRRGIELA  148

Query  578  KPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            +PN+TCDVV CYCGIRLHPLSCPEAF +N  G+ VG+ 
Sbjct  149  RPNETCDVVSCYCGIRLHPLSCPEAFEVNEEGKLVGND  186



>ref|XP_010487719.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Camelina sativa]
Length=337

 Score =   190 bits (482),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 114/166 (69%), Gaps = 15/166 (9%)
 Frame = +2

Query  227  PDPEPVSFSTP-----STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLH  391
            P+PE      P     S PATIPAFPEQS+ + CPLDL E+LF GIKSAC        LH
Sbjct  27   PNPEDTVTVQPFRVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGKK----LH  82

Query  392  RTRCCPVLAAWLYSAYSTTALQRATSKIPRT------TTFDMPVLPDDSETCVDSLEKAL  553
            + RCCPVL AWLYSAYSTTAL R+ S   R       T  DMP+LPDDSETCVD L K+L
Sbjct  83   KGRCCPVLGAWLYSAYSTTALSRSISAAARNASSSPMTQEDMPLLPDDSETCVDGLGKSL  142

Query  554  GNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
              +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G  VG +
Sbjct  143  RQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNEEGRLVGDE  188



>ref|XP_006297874.1| hypothetical protein CARUB_v10013914mg, partial [Capsella rubella]
 gb|EOA30772.1| hypothetical protein CARUB_v10013914mg, partial [Capsella rubella]
Length=387

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 114/166 (69%), Gaps = 15/166 (9%)
 Frame = +2

Query  227  PDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHR  394
            P+PE V+        S PATIPAFPEQS+ + CPLDL E+LF GIKSAC        LH+
Sbjct  78   PNPETVTVQPFLVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGKK----LHK  133

Query  395  TRCCPVLAAWLYSAYSTTALQRATSKIPRT-------TTFDMPVLPDDSETCVDSLEKAL  553
             RCCPVL AWLYSAYSTTAL R+ S            T  DMP+LPDDSETCVD L K+L
Sbjct  134  GRCCPVLGAWLYSAYSTTALSRSISAAAARNASSSPMTQEDMPLLPDDSETCVDGLGKSL  193

Query  554  GNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
              +GIEL +PN+TCDVVYCYCGIRLHPLSC +AF +N  G  VG +
Sbjct  194  RQRGIELTRPNETCDVVYCYCGIRLHPLSCSDAFRVNDEGRLVGDE  239



>ref|XP_010506313.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Camelina sativa]
Length=336

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 118/172 (69%), Gaps = 14/172 (8%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND  373
            +I +P  P+P+ V+        S PATIPAFPEQS+ + CPLDL E+LF GIKSAC    
Sbjct  20   TILSPVSPNPDTVTVQPFRVKLSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGKK  79

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRT------TTFDMPVLPDDSETCVD  535
                LH+ RCCPVL AWLYSAYSTTAL R+ S   R       T  DMP+LPDDSETCVD
Sbjct  80   ----LHKGRCCPVLGAWLYSAYSTTALSRSISAAARNASSSPMTQEDMPLLPDDSETCVD  135

Query  536  SLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
             L K+L  +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G   G +
Sbjct  136  GLGKSLRQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNEEGRLGGDE  187



>ref|NP_566596.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02017.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK96874.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN15376.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE76040.1| uncharacterized protein AT3G18050 [Arabidopsis thaliana]
Length=335

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 116/167 (69%), Gaps = 18/167 (11%)
 Frame = +2

Query  233  PEPVS---FSTPSTP-ATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTR  400
            PEPV+   F   S+P ATIPAFPEQS+ + CPLDL E+LF GIKSAC        LH+ +
Sbjct  25   PEPVTVQPFRVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACSGKK----LHKGK  80

Query  401  CCPVLAAWLYSAYSTTALQRATSKIPR----------TTTFDMPVLPDDSETCVDSLEKA  550
            CCPVL AWLYSAYSTTAL R+ S   R          T   DMP+LPDDSETCVD L K+
Sbjct  81   CCPVLGAWLYSAYSTTALSRSISAAARNSSSSSAAVTTPEEDMPLLPDDSETCVDGLGKS  140

Query  551  LGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            L  +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G  VG +
Sbjct  141  LRQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNDEGRLVGDE  187



>ref|XP_010260827.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nelumbo nucifera]
Length=334

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 117/166 (70%), Gaps = 10/166 (6%)
 Frame = +2

Query  212  ANPDLPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDY-  376
            A P LP P+  S        + P+TIPAFPEQS+ A CPLDL +ELF+ I  ACG +D  
Sbjct  23   AVPALPQPDSSSIQPFLPIKAPPSTIPAFPEQSDVAGCPLDLPDELFQSISKACGGSDNK  82

Query  377  ---SGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEK  547
               S  L R+RCCPVLAAWLYSAYS TAL RA +++P    +D+P+LPDDSETCV SLE 
Sbjct  83   VHPSAGLKRSRCCPVLAAWLYSAYSVTALGRA-ARMP-AQPYDLPMLPDDSETCVGSLEN  140

Query  548  ALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            AL  KGIEL +PN TCD+VYCYCGIRL P SCP AFS++  G  +G
Sbjct  141  ALKGKGIELFRPNATCDLVYCYCGIRLRPWSCPNAFSVSKEGNLLG  186



>ref|XP_010274672.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nelumbo nucifera]
Length=330

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 116/156 (74%), Gaps = 7/156 (4%)
 Frame = +2

Query  230  DPEPVSFSTP--STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSG---PLHR  394
            DP P+    P  + P+TIPAFPEQS+ A CPLDL +ELF G+++ACG N  +G    L R
Sbjct  30   DPSPIQPFLPIQAPPSTIPAFPEQSDLAGCPLDLPDELFHGVRTACGGNANNGHPSGLKR  89

Query  395  TRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIEL  574
            +RCCPVLAAWLY  YS TAL RA +++P    +D+P+LPDDSETCV +LE A   KGIEL
Sbjct  90   SRCCPVLAAWLYFGYSATALGRA-ARMP-AERYDLPLLPDDSETCVGNLENAFKGKGIEL  147

Query  575  VKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXV  682
             +PN+TCD+VYCYCGIRL P SCPEAFS++  G+ V
Sbjct  148  FRPNETCDLVYCYCGIRLRPWSCPEAFSVSKEGKLV  183



>gb|KHN21661.1| Putative GPI-anchored protein [Glycine soja]
Length=342

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 123/171 (72%), Gaps = 8/171 (5%)
 Frame = +2

Query  203  VSIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSG  382
            +++ +PD    +P+  +  S+  TIPAFPEQ++ A CPL L++E + GIKSACGSN ++ 
Sbjct  31   LALPDPDADAVQPIIPNPSSSTGTIPAFPEQADAAGCPLSLSDEHYEGIKSACGSNKHAA  90

Query  383  P----LHRTRCCPVLAAWLYSAYSTTAL----QRATSKIPRTTTFDMPVLPDDSETCVDS  538
                 LHR+RCCPVLAAWLYSAYS TAL    Q   +    TT++DMP+LPDDSETCV  
Sbjct  91   DDDDDLHRSRCCPVLAAWLYSAYSATALSGGMQHERASKGHTTSYDMPLLPDDSETCVSD  150

Query  539  LEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            L KAL  + I+L +PN+TCD+VYCYCGIRLHPL+CPE+FS+   G  V +Q
Sbjct  151  LGKALKIREIQLFQPNETCDLVYCYCGIRLHPLTCPESFSVTPSGTLVVNQ  201



>ref|XP_007160509.1| hypothetical protein PHAVU_002G327800g [Phaseolus vulgaris]
 gb|ESW32503.1| hypothetical protein PHAVU_002G327800g [Phaseolus vulgaris]
Length=337

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 111/148 (75%), Gaps = 6/148 (4%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGP--LHRTRCCPVLAAWLY  430
            PS+  TIPAFPEQ++   CPL+L++E + GIKSACGS+  +    LHR+RCCPVLAAWLY
Sbjct  47   PSSTGTIPAFPEQADVEGCPLNLSDEHYEGIKSACGSSKDAADKDLHRSRCCPVLAAWLY  106

Query  431  SAYSTTAL----QRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCD  598
            SAYS TAL    Q   S    TT++DMP+LPDDSETCV  L KAL  +GI LV+PN+TCD
Sbjct  107  SAYSATALSGGMQHERSSQGHTTSYDMPLLPDDSETCVSDLGKALKVRGIHLVQPNETCD  166

Query  599  VVYCYCGIRLHPLSCPEAFSMNSHGEXV  682
            VVYCYCGIRLHPL+C E+FS+   G  V
Sbjct  167  VVYCYCGIRLHPLTCTESFSVTPSGGLV  194



>ref|XP_004503298.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cicer arietinum]
Length=343

 Score =   187 bits (475),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = +2

Query  224  LPDPEPVSFSTP--STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS-------NDY  376
            +PD   V   TP  S+  TIPAFPEQ++ + CPL+L++E F  IK++C S       +D 
Sbjct  33   IPDAATVQQLTPNPSSQGTIPAFPEQADVSRCPLNLSDEHFNAIKNSCSSKSNKNHASDN  92

Query  377  SGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALG  556
            +  LHR+RCCPVLAAWLYSAYS TAL   TS    TT++DMP+LPDDSETC  +L KAL 
Sbjct  93   NNELHRSRCCPVLAAWLYSAYSATALGTVTSS-RHTTSYDMPLLPDDSETCEGNLGKALK  151

Query  557  NKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
             +GIEL +PN+TCDVVYCYCGIRLHPLSC E+F +   G  VG +
Sbjct  152  LRGIELFQPNETCDVVYCYCGIRLHPLSCAESFKLTKSGNLVGDE  196



>gb|KFK39131.1| hypothetical protein AALP_AA3G204900 [Arabis alpina]
Length=340

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 117/167 (70%), Gaps = 17/167 (10%)
 Frame = +2

Query  230  DPEPVS---FSTPSTP-ATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRT  397
            +PEPV+   F   S+P ATIPAFPEQS+ + CPLDL E+LF GIKSAC        LH+ 
Sbjct  30   NPEPVTVQPFRVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGKK----LHKG  85

Query  398  RCCPVLAAWLYSAYSTTALQRATSKIPR---------TTTFDMPVLPDDSETCVDSLEKA  550
            +CCPVL AWLYSAYSTTAL R+ S             T   DMP+LPDDSETCVD L K+
Sbjct  86   KCCPVLGAWLYSAYSTTALSRSISSAAARNASSSAVVTPEEDMPLLPDDSETCVDGLGKS  145

Query  551  LGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            L  +GIEL +PN+TCDVVYCYCGIRLH LSC +AFS+N  G+ VG +
Sbjct  146  LKRRGIELSRPNETCDVVYCYCGIRLHHLSCSDAFSVNEQGKLVGDE  192



>ref|XP_007152699.1| hypothetical protein PHAVU_004G151900g [Phaseolus vulgaris]
 gb|ESW24693.1| hypothetical protein PHAVU_004G151900g [Phaseolus vulgaris]
Length=332

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 9/153 (6%)
 Frame = +2

Query  254  TPSTPAT-IPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSG--PLHRTRCCPVLAAW  424
            TP+ P+T IPAFPE+S+ A CPL L++ELF GIKSACG     G   LHR+RCCPVLAAW
Sbjct  34   TPAKPSTTIPAFPEESDVAGCPLTLSDELFDGIKSACGGAKSGGDMELHRSRCCPVLAAW  93

Query  425  LYSAYSTTAL-----QRATSKIPRTTTFDM-PVLPDDSETCVDSLEKALGNKGIELVKPN  586
            LYSAYS+TAL     + +      T+ +DM P+LPDDSETCV+ L KAL  +GIEL KPN
Sbjct  94   LYSAYSSTALGMLGHRHSNVHGHSTSVYDMMPLLPDDSETCVNELGKALEVRGIELTKPN  153

Query  587  QTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
             TCDVVYC+CGIRLH L+CP+AFS++ +GE VG
Sbjct  154  DTCDVVYCFCGIRLHHLTCPDAFSVSQNGELVG  186



>ref|XP_009145938.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Brassica 
rapa]
Length=333

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 120/175 (69%), Gaps = 16/175 (9%)
 Frame = +2

Query  203  VSIANPDLPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSN  370
            ++I +P  P+ +P++        S PATIPAFPEQS+ + CPLDL E+LF GIKSAC   
Sbjct  15   LTILSPVSPNQDPITVQPFLVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGK  74

Query  371  DYSGPLHRTRCCPVLAAWLYSAYSTTALQRA--TSKIPRTTTF------DMPVLPDDSET  526
                 LH+ +CCPVL AWLYSAYSTTAL R+  +S +   T+       DMP+LPDDSET
Sbjct  75   K----LHKGKCCPVLGAWLYSAYSTTALSRSIPSSAVRNATSAATTPEEDMPLLPDDSET  130

Query  527  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            CVD LEK+L  +GIEL  PN+TC VV CYCGIRLH LSC EAFS+N  G  VG +
Sbjct  131  CVDGLEKSLRRRGIELASPNETCGVVDCYCGIRLHHLSCSEAFSVNGEGRLVGDE  185



>ref|XP_007209408.1| hypothetical protein PRUPE_ppa009266mg [Prunus persica]
 gb|EMJ10607.1| hypothetical protein PRUPE_ppa009266mg [Prunus persica]
Length=299

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 111/162 (69%), Gaps = 15/162 (9%)
 Frame = +2

Query  224  LPDPEPV----SFSTPSTP----ATIPAFPEQSNTAACPLDLTEELFRGIKSACGS--ND  373
            +PDP P     SF    TP    ATIPAFPEQS+ A CPL L  ELF GIKSAC +   D
Sbjct  27   IPDPAPSPVQSSFLPTRTPYPPAATIPAFPEQSDIAGCPLHLPNELFHGIKSACSATKGD  86

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIP-----RTTTFDMPVLPDDSETCVDS  538
              G L  +RCCPVLAAWLY AYS TAL       P       TT+D P+LPDDSETCV  
Sbjct  87   SLGKLQHSRCCPVLAAWLYDAYSATALGGGGRVGPAAAGNSNTTYDPPLLPDDSETCVQD  146

Query  539  LEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMN  664
            L +AL  +GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS+N
Sbjct  147  LGEALKTRGIELIKPNETCDVVYCYCGIRLHPLSCPEAFSLN  188



>ref|XP_008240173.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Prunus 
mume]
Length=338

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 104/146 (71%), Gaps = 7/146 (5%)
 Frame = +2

Query  269  ATIPAFPEQSNTAACPLDLTEELFRGIKSACGS--NDYSGPLHRTRCCPVLAAWLYSAYS  442
            ATIPAFPEQS+ A CPL L  ELF GIKSAC +   D  G L  +RCCPVLAAWLY AYS
Sbjct  48   ATIPAFPEQSDIAGCPLHLPNELFHGIKSACSATKGDSLGKLQHSRCCPVLAAWLYDAYS  107

Query  443  TTALQRATSKIPRT-----TTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVY  607
             TAL       P       T  D P+LPDDSETCV  L +AL  +GIEL+KPN+TCDVVY
Sbjct  108  ATALGGGGKVGPAAAGHTQTHIDPPLLPDDSETCVQDLGEALKTRGIELIKPNETCDVVY  167

Query  608  CYCGIRLHPLSCPEAFSMNSHGEXVG  685
            CYCGIRLHPLSCPEAFS+N  G+ VG
Sbjct  168  CYCGIRLHPLSCPEAFSVNQRGKLVG  193



>emb|CDX92191.1| BnaA05g22160D [Brassica napus]
Length=325

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 120/175 (69%), Gaps = 16/175 (9%)
 Frame = +2

Query  203  VSIANPDLPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSN  370
            ++I +P  P+ +PV+        S PATIPAFPEQS+ + CPLDL E+LF GIKSAC   
Sbjct  15   LTILSPVSPNQDPVTVQPFLVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGK  74

Query  371  DYSGPLHRTRCCPVLAAWLYSAYSTTALQRA--TSKIPRTTTF------DMPVLPDDSET  526
                 LH+ +CCPVL AWLYSAYSTTAL R+  +S +   T+       DMP+LPDDSET
Sbjct  75   K----LHKGKCCPVLGAWLYSAYSTTALSRSIPSSAVRNATSAATTPEEDMPLLPDDSET  130

Query  527  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            CVD LEK+L  +GIEL  PN+TC VV CYCGIRLH LSC EAFS++  G  VG +
Sbjct  131  CVDGLEKSLRRRGIELASPNETCGVVDCYCGIRLHHLSCSEAFSVDGEGRLVGDE  185



>ref|XP_003637786.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|KEH16704.1| transmembrane protein, putative [Medicago truncatula]
Length=336

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 111/145 (77%), Gaps = 4/145 (3%)
 Frame = +2

Query  263  TPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDY--SGPLHRTRCCPVLAAWLYSA  436
            T  TIP+F EQS    CPL L+ ELF GI+SAC S+ +  +  L R+RCCP+LAAWLYS+
Sbjct  44   TTLTIPSFQEQSYVKGCPLSLSNELFNGIESACSSSKHGSNSKLDRSRCCPILAAWLYSS  103

Query  437  YSTTAL--QRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYC  610
            YS+TAL    ++S     ++FDMP++PDDSETCVD LEKAL  +GIEL+KPN++CD+VYC
Sbjct  104  YSSTALGNHSSSSSSSSRSSFDMPLVPDDSETCVDGLEKALKVRGIELIKPNESCDLVYC  163

Query  611  YCGIRLHPLSCPEAFSMNSHGEXVG  685
            YCGIRLHP +CP+AFS+   GE VG
Sbjct  164  YCGIRLHPFNCPDAFSVTKSGELVG  188



>emb|CDY49619.1| BnaCnng17710D [Brassica napus]
Length=325

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 115/167 (69%), Gaps = 16/167 (10%)
 Frame = +2

Query  227  PDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHR  394
            P+ +PV+        S PATIPAFPEQS+ + CPLDL ++LF GIKSAC        LH+
Sbjct  23   PNKDPVTVQPFLVKSSPPATIPAFPEQSDFSGCPLDLPDDLFHGIKSACTGKK----LHK  78

Query  395  TRCCPVLAAWLYSAYSTTALQRA--TSKIPRTTTF------DMPVLPDDSETCVDSLEKA  550
             +CCPVL AWLYSAYSTTAL R+  +S +   T+       DMP+LPDDSETCVD LEK+
Sbjct  79   GKCCPVLGAWLYSAYSTTALSRSIPSSAVRNATSAATTPEEDMPLLPDDSETCVDGLEKS  138

Query  551  LGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            L  +GIEL  PN+TC VV CYCGIRLH LSC EAFS+N  G  VG +
Sbjct  139  LRRRGIELASPNETCGVVDCYCGIRLHHLSCSEAFSVNGEGMLVGDE  185



>ref|XP_006406660.1| hypothetical protein EUTSA_v10021078mg [Eutrema salsugineum]
 gb|ESQ48113.1| hypothetical protein EUTSA_v10021078mg [Eutrema salsugineum]
Length=340

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 120/178 (67%), Gaps = 17/178 (10%)
 Frame = +2

Query  197  IPVSIANPDLPDPEPVS-FSTPSTP-ATIPAFPEQSNTAACPLDLTEELFRGIKSACGSN  370
            +PVS      PDP  V  F   S+P ATIPAFPEQS+ + CPLDL E+LF GIKSAC   
Sbjct  19   LPVSPNPTQNPDPVTVQPFRVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGK  78

Query  371  DYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPR-------TTT----FDMPVLPDD  517
                 LH+ RCCPVL AWLYSAYS+TAL R+ S   R       TTT     DMP+LPDD
Sbjct  79   K----LHKGRCCPVLGAWLYSAYSSTALSRSISAAARNASSSAVTTTPPAEEDMPLLPDD  134

Query  518  SETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            SETCVD L K+L  +GIEL +PN+TCDVVYCYCGIRLH LSC +AF ++  G  VG +
Sbjct  135  SETCVDGLGKSLRRRGIELARPNETCDVVYCYCGIRLHHLSCSDAFRVDEQGRLVGDE  192



>emb|CDX75958.1| BnaC03g40410D [Brassica napus]
Length=338

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 118/178 (66%), Gaps = 17/178 (10%)
 Frame = +2

Query  197  IPVSIANPDLPDPEPVSFS----TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACG  364
            + ++I +P  P+ +PV+       PS P TIPAFPEQS+ + CPLDL E+LF GIKSAC 
Sbjct  13   VFLTILSPVSPNSDPVTVQPFRVKPSPPDTIPAFPEQSDFSGCPLDLPEDLFHGIKSACT  72

Query  365  SNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTF---------DMPVLPDD  517
                   LHR +CCPVL AWLYSAYSTTAL R+      +            DMP+LPDD
Sbjct  73   GKK----LHRAKCCPVLGAWLYSAYSTTALSRSLPSSSSSAASRNATTPEEEDMPLLPDD  128

Query  518  SETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            SETCVD LEK+L  +GIEL + N+TCDV YCYCGIRLH LSC EAFS+N  G  VG +
Sbjct  129  SETCVDGLEKSLRRRGIELQRQNETCDVAYCYCGIRLHHLSCSEAFSVNEEGRLVGDE  186



>gb|ACU18006.1| unknown [Glycine max]
Length=342

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 113/160 (71%), Gaps = 17/160 (11%)
 Frame = +2

Query  254  TPSTPAT-IPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGP---LHRTRCCPVLAA  421
            TPS PAT IPAFPEQS+ + CPL L++ELF GIKSAC S   SG    LH +RCCPVLAA
Sbjct  36   TPSKPATTIPAFPEQSDVSGCPLTLSDELFDGIKSAC-SGAKSGADMELHHSRCCPVLAA  94

Query  422  WLYSAYSTTAL-----------QRATSKIPRTTTFDM-PVLPDDSETCVDSLEKALGNKG  565
            WLYSAYS TAL             A      T+ +DM P+LPDDSETCV+ L KAL  +G
Sbjct  95   WLYSAYSATALGSMAGHSHSHSNNAHGHGHATSAYDMMPLLPDDSETCVNELGKALVVRG  154

Query  566  IELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            +EL KPN+TCDVVYC+CGIRLH L+CP++FS+   GE VG
Sbjct  155  VELTKPNETCDVVYCFCGIRLHHLACPDSFSVGQSGELVG  194



>ref|XP_003528967.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Glycine max]
Length=342

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 113/160 (71%), Gaps = 17/160 (11%)
 Frame = +2

Query  254  TPSTPAT-IPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGP---LHRTRCCPVLAA  421
            TPS PAT IPAFPEQS+ + CPL L++ELF GIKSAC S   SG    LH +RCCPVLAA
Sbjct  36   TPSKPATTIPAFPEQSDVSGCPLTLSDELFDGIKSAC-SGAKSGADMELHHSRCCPVLAA  94

Query  422  WLYSAYSTTAL-----------QRATSKIPRTTTFDM-PVLPDDSETCVDSLEKALGNKG  565
            WLYSAYS TAL             A      T+ +DM P+LPDDSETCV+ L KAL  +G
Sbjct  95   WLYSAYSATALGSMAGHSHSHSNNAHGHGHATSAYDMMPLLPDDSETCVNELGKALVVRG  154

Query  566  IELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            +EL KPN+TCDVVYC+CGIRLH L+CP++FS+   GE VG
Sbjct  155  VELTKPNETCDVVYCFCGIRLHHLTCPDSFSVGQSGELVG  194



>ref|XP_010678117.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Beta 
vulgaris subsp. vulgaris]
Length=339

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 117/168 (70%), Gaps = 13/168 (8%)
 Frame = +2

Query  212  ANPDLPDPEPVSFS-------TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSN  370
            A P LP+P+P S         TPS PATIP+FPEQS  AACP  L + +F  +K++C S+
Sbjct  24   ALPALPNPDPSSIQQQQTFLPTPSPPATIPSFPEQSAVAACPTTLPDGIFSAVKNSCASD  83

Query  371  DYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT---FDMPVLPDDSETCVDSL  541
               G L R +CCPVLAAWLYSAYS TAL R +S     ++   +D+P+LPDDSETCVD L
Sbjct  84   ---GHLRRGKCCPVLAAWLYSAYSNTALGRGSSSSSSRSSTTSYDLPMLPDDSETCVDGL  140

Query  542  EKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            EKA+ +KG+ LV+PN +CDVVYCYCGIRLH LSC +AF +   G  VG
Sbjct  141  EKAMRDKGVNLVRPNSSCDVVYCYCGIRLHQLSCNQAFRVLEDGRLVG  188



>ref|XP_003534147.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Glycine max]
 gb|KHN23729.1| Putative GPI-anchored protein [Glycine soja]
Length=343

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 114/176 (65%), Gaps = 22/176 (13%)
 Frame = +2

Query  224  LPDPEPVS-----FSTPSTPAT-IPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSG-  382
            LPD E  +       TPS PAT IPAFPEQS  + CPL L++ELF GIKSACG       
Sbjct  20   LPDSETTTTLNPILLTPSKPATTIPAFPEQSEVSGCPLTLSDELFDGIKSACGGAKSGAD  79

Query  383  -PLHRTRCCPVLAAWLYSAYSTTALQRATSKIPR------------TTTFDM--PVLPDD  517
              LH +RCCPVLAAWLYSAYS TAL                     T+ +DM  P+LPDD
Sbjct  80   MELHHSRCCPVLAAWLYSAYSATALGSMAGHSHSHSNNGHGHDGHATSAYDMIMPLLPDD  139

Query  518  SETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            SETCV+ L KAL  +G+EL KPN+TCDVVYC+CGIRLH L+CP++FS+   GE VG
Sbjct  140  SETCVNELGKALELRGVELTKPNETCDVVYCFCGIRLHHLTCPDSFSVGQSGELVG  195



>ref|XP_009135567.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Brassica rapa]
Length=338

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 106/153 (69%), Gaps = 12/153 (8%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            PS P TIPAFPEQS+ + CPLDL E+LF GIKSAC        LHR +CCPVL AWLYSA
Sbjct  41   PSPPDTIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGKK----LHRAKCCPVLGAWLYSA  96

Query  437  YSTTALQRATSKIPRTTTF--------DMPVLPDDSETCVDSLEKALGNKGIELVKPNQT  592
            YSTTAL R+        +         DMP+LPDDSETCVD LEK+L  +GIEL + N+T
Sbjct  97   YSTTALSRSLPSSSSAASRNATTPEEEDMPLLPDDSETCVDGLEKSLRRRGIELQRQNET  156

Query  593  CDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            CDV YCYCGIRLH LSC EAFS+N  G  VG +
Sbjct  157  CDVAYCYCGIRLHHLSCSEAFSVNEEGRLVGDE  189



>ref|XP_003631077.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|ABE80139.1| hypothetical protein MtrDRAFT_AC139526g8v2 [Medicago truncatula]
 gb|AET05553.1| transmembrane protein, putative [Medicago truncatula]
Length=335

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 119/172 (69%), Gaps = 9/172 (5%)
 Frame = +2

Query  197  IPVSIANPDLPDPEPVSFS-TPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGS--  367
            +P+ I  PD    +P++ + + S   TIPAFPEQ++ A CPL L++E   GIK+AC S  
Sbjct  23   LPIPIPIPDAATVQPLTPNPSSSLQGTIPAFPEQADVARCPLSLSDEHLNGIKNACSSKS  82

Query  368  NDYSGP---LHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDS  538
            N +      LHR+RCCP LAAWLYSAYS TAL     +   TT++DMP+LPDDSETC   
Sbjct  83   NKHDAADDELHRSRCCPALAAWLYSAYSATAL--GGFEHGHTTSYDMPLLPDDSETCESD  140

Query  539  LEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSH-GEXVGHQ  691
            L KAL  +GIEL +PN+TCDVVYCYCGIRLHPLSC E+F + +H G  VG +
Sbjct  141  LGKALKVRGIELFQPNETCDVVYCYCGIRLHPLSCSESFKLTAHNGNLVGDE  192



>emb|CDY51932.1| BnaAnng11090D [Brassica napus]
Length=338

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 106/153 (69%), Gaps = 12/153 (8%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            PS P TIPAFPEQS+ + CPLDL E+LF GIKSAC        LHR +CCPVL AWLYSA
Sbjct  41   PSPPDTIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGKK----LHRAKCCPVLGAWLYSA  96

Query  437  YSTTALQRATSKIPRTTTF--------DMPVLPDDSETCVDSLEKALGNKGIELVKPNQT  592
            YSTTAL R+        +         DMP+LPDDSETCVD LEK+L  +GIEL + N+T
Sbjct  97   YSTTALSRSLPSSSSAASRNATTPEEEDMPLLPDDSETCVDGLEKSLRRRGIELQRQNET  156

Query  593  CDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            CDV YCYCGIRLH LSC EAFS+N  G  VG +
Sbjct  157  CDVAYCYCGIRLHHLSCSEAFSVNEEGRLVGDE  189



>emb|CAN82280.1| hypothetical protein VITISV_044064 [Vitis vinifera]
Length=328

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 100/122 (82%), Gaps = 2/122 (2%)
 Frame = +2

Query  332  ELFRGIKSACGSND-YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKI-PRTTTFDMPV  505
            ELF GIK+AC +    SG L R+RCCPVLAAWLYSAYS TAL RA   + P  T +D+P+
Sbjct  61   ELFHGIKTACSAGKGASGELRRSRCCPVLAAWLYSAYSGTALGRAKRGLAPEATPYDLPL  120

Query  506  LPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            LPDDSETCVD LEK+L ++G+ELVKPN+TCDVVYC+CGIRLHPLSCPEAFS++S G+ VG
Sbjct  121  LPDDSETCVDDLEKSLKSRGVELVKPNETCDVVYCFCGIRLHPLSCPEAFSVSSKGKLVG  180

Query  686  HQ  691
             +
Sbjct  181  DE  182



>gb|KHN44610.1| Putative GPI-anchored protein [Glycine soja]
Length=343

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 111/159 (70%), Gaps = 17/159 (11%)
 Frame = +2

Query  257  PSTPAT-IPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGP---LHRTRCCPVLAAW  424
            PS PAT IPAFPEQS+ + CPL L++ELF GIKSAC S   SG    LH +RCCPVLAAW
Sbjct  38   PSKPATTIPAFPEQSDVSGCPLTLSDELFDGIKSAC-SGAKSGADMELHHSRCCPVLAAW  96

Query  425  LYSAYSTTALQRATSKIPR-----------TTTFDM-PVLPDDSETCVDSLEKALGNKGI  568
            LYSAYS TAL                    T+ +DM P+LPDDSETCV+ L KAL  +G+
Sbjct  97   LYSAYSATALGSMAGHSHSHSSNAHGHGHATSAYDMMPLLPDDSETCVNELGKALVVRGV  156

Query  569  ELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVG  685
            EL KPN+TCDVVYC+CGIRLH L+CP++FS+   GE VG
Sbjct  157  ELTKPNETCDVVYCFCGIRLHHLTCPDSFSVGQSGELVG  195



>ref|XP_004512737.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cicer arietinum]
Length=328

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 107/151 (71%), Gaps = 3/151 (2%)
 Frame = +2

Query  239  PVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLA  418
            P   S P+T  TIP+F +QS    CPL L+ +LF GIKSAC S       HR  CCPVLA
Sbjct  35   PTQSSHPTT-LTIPSFQDQSFVKGCPLSLSNDLFDGIKSACSSTK--DEFHRRHCCPVLA  91

Query  419  AWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCD  598
            AWLYS+YS+ AL      +  +++ D+P++PDDSETCV+ LEKAL  +GIE++KPN++CD
Sbjct  92   AWLYSSYSSIALGELGHSLSWSSSSDLPLVPDDSETCVNGLEKALKLRGIEMIKPNESCD  151

Query  599  VVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            +VYCYCGIRLHP SC +AFS+   GE VG +
Sbjct  152  LVYCYCGIRLHPFSCSDAFSVTKSGELVGDE  182



>ref|XP_010035649.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Eucalyptus grandis]
 gb|KCW47091.1| hypothetical protein EUGRSUZ_K00897 [Eucalyptus grandis]
Length=313

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 99/147 (67%), Gaps = 10/147 (7%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVL  415
            EPVS      P T+PAFP Q +T  C LDL+ ELF G++ ACG N     L R+RCCPVL
Sbjct  31   EPVS--GHDQPYTVPAFPSQGDTQICKLDLSAELFGGVRQACGRN-----LDRSRCCPVL  83

Query  416  AAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTC  595
            AAWL++A++ +ALQ   S  P     D P++P+DS+ CVDSL+ AL +K + L +PN +C
Sbjct  84   AAWLFAAHARSALQITPSASPAPAGDDSPMMPNDSQKCVDSLQSALESKNVRLQQPNASC  143

Query  596  DVVYCYCGIRLH---PLSCPEAFSMNS  667
            D V C+CGIRLH    LSCP AF+++S
Sbjct  144  DAVLCFCGIRLHQIGSLSCPAAFNVSS  170



>ref|XP_008782391.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
 ref|XP_008782392.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
Length=333

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 98/150 (65%), Gaps = 10/150 (7%)
 Frame = +2

Query  218  PDLPDPEPVS------FSTPSTPATIPAFPEQSNTA--ACPLDLTEELFRGIKSACGSND  373
            P +PDP+P +      F T S PATIPAFPEQS+ A  ACPLDL ++    + + C ++ 
Sbjct  27   PVMPDPDPAAIQPSLLFPTSSPPATIPAFPEQSDVAGAACPLDLPDDFLPAVSATCSTSA  86

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKAL  553
                  R+RCCPVLAAWLY+AYS TAL  +   +P     D+P+LPDDSE C+  +E+AL
Sbjct  87   AGRLPSRSRCCPVLAAWLYAAYSATAL--SARPLPAPPALDLPILPDDSEACIGGVERAL  144

Query  554  GNKGIELVKPNQTCDVVYCYCGIRLHPLSC  643
             ++G+ L + N TCD  YCYCGIRL  L+C
Sbjct  145  RDRGVRLPRVNGTCDAAYCYCGIRLRRLTC  174



>emb|CBI18008.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 99/140 (71%), Gaps = 11/140 (8%)
 Frame = +2

Query  260  STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAY  439
            STP T+PAFP Q+ T  C LDL+ ELF G+  ACG N     L R+RCCPVLAAWL++A+
Sbjct  7    STPNTVPAFPVQTETQTCRLDLSAELFGGVNDACGRN-----LDRSRCCPVLAAWLFAAH  61

Query  440  STTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCG  619
            + +ALQ A    P   + D+P++PDDS+ CV+SL+ +L ++ I + +PN TCD + C+CG
Sbjct  62   ARSALQVAA---PAPASSDLPMMPDDSQKCVNSLQSSLQSRNIHIPQPNATCDAILCFCG  118

Query  620  IRLH---PLSCPEAFSMNSH  670
            IRLH    LSCP AF+++S+
Sbjct  119  IRLHQITSLSCPAAFNISSY  138



>ref|XP_002276552.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Vitis 
vinifera]
 ref|XP_010657383.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Vitis 
vinifera]
 ref|XP_010657384.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Vitis 
vinifera]
Length=324

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (67%), Gaps = 11/157 (7%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     +P+     STP T+PAFP Q+ T  C LDL+ ELF G+  ACG N     L
Sbjct  28   LAEPADSHQQPMKPGDYSTPNTVPAFPVQTETQTCRLDLSAELFGGVNDACGRN-----L  82

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++ +ALQ A    P   + D+P++PDDS+ CV+SL+ +L ++ I
Sbjct  83   DRSRCCPVLAAWLFAAHARSALQVAA---PAPASSDLPMMPDDSQKCVNSLQSSLQSRNI  139

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSH  670
             + +PN TCD + C+CGIRLH    LSCP AF+++S+
Sbjct  140  HIPQPNATCDAILCFCGIRLHQITSLSCPAAFNISSY  176



>gb|AFG68066.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68067.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68068.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68069.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68070.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68071.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68072.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68073.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68074.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68075.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68076.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68077.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68078.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68079.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
Length=148

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 96/136 (71%), Gaps = 11/136 (8%)
 Frame = +2

Query  275  IPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTAL  454
            +PA P QS    CPLDL +ELF GIK+ACG  +    L+R RCCPVLAAWLY+A++  AL
Sbjct  21   VPAIPLQSEIETCPLDLPDELFSGIKAACGGQE----LNRYRCCPVLAAWLYAAHARAAL  76

Query  455  QRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHP  634
            +  + K+P   + D PVLPDDS+TCV++L+ +L  +G+ + +PN TCD V C+CGIRLH 
Sbjct  77   R--SLKMP--VSDDSPVLPDDSQTCVNNLQSSLQRRGVRIPQPNDTCDPVQCFCGIRLHS  132

Query  635  LS---CPEAFSMNSHG  673
            LS   CP+AF++   G
Sbjct  133  LSLVTCPQAFNVTVSG  148



>ref|XP_009353209.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Pyrus x bretschneideri]
Length=327

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 104/155 (67%), Gaps = 8/155 (5%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P   +P+P+     STP T+PAFP Q+ T  C LDL+ ELF G+  ACG N     L
Sbjct  31   LAEPVTGNPQPLKPGENSTPNTVPAFPTQNPTQTCHLDLSAELFGGVSQACGRN-----L  85

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++ +AL+  +S    +   D P++PDDS+ CV+SL+ +L ++ I
Sbjct  86   DRSRCCPVLAAWLFAAHARSALELPSSAPDPSAVPDQPMMPDDSQKCVNSLQSSLVSRNI  145

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN  664
             + +PN +CD V C+CGIRLH    LSCP AF+++
Sbjct  146  RIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNVS  180



>ref|XP_010277906.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nelumbo nucifera]
Length=322

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 100/148 (68%), Gaps = 11/148 (7%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVL  415
            +P+     S   T+PAFP Q+    C LDL+EELF G+  ACG N     L R+RCCPVL
Sbjct  36   QPIKPGDFSDTNTVPAFPVQTQAQTCHLDLSEELFGGVSEACGRN-----LDRSRCCPVL  90

Query  416  AAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTC  595
            AAWL++A++ +ALQ   S +P  T+ D PV+PDDS+ CV+SL+ +L ++ I + +PN TC
Sbjct  91   AAWLFAAHAKSALQ-VPSAVP--TSSDGPVVPDDSQKCVNSLQSSLQSRHINIPQPNSTC  147

Query  596  DVVYCYCGIRLH---PLSCPEAFSMNSH  670
            D + C+CGIRLH    LSCP AF++ SH
Sbjct  148  DAILCFCGIRLHQITSLSCPAAFNLTSH  175



>gb|AEW07870.1| hypothetical protein 0_13494_01, partial [Pinus radiata]
Length=148

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 95/136 (70%), Gaps = 11/136 (8%)
 Frame = +2

Query  275  IPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTAL  454
            +PA P QS    CPLDL +ELF GIK+ACG  +    L+R RCCPVLAAWLY+A++  AL
Sbjct  21   VPAIPLQSEIETCPLDLPDELFSGIKAACGGRE----LNRYRCCPVLAAWLYAAHARAAL  76

Query  455  QRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHP  634
            +  + K+P   + D PVLPDDS+TC ++L+ +L  +G+ + +PN TCD V C+CGIRLH 
Sbjct  77   R--SLKMP--VSDDSPVLPDDSQTCANNLQSSLQRRGVRIPQPNDTCDPVQCFCGIRLHS  132

Query  635  LS---CPEAFSMNSHG  673
            LS   CP+AF++   G
Sbjct  133  LSLVTCPQAFNVTVSG  148



>gb|KDP24204.1| hypothetical protein JCGZ_25861 [Jatropha curcas]
Length=316

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 106/161 (66%), Gaps = 9/161 (6%)
 Frame = +2

Query  194  CIPVSIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSND  373
            C+   +A P     +P+     S+P T+PAFP Q+ +  C LDLT ELF G+  ACG + 
Sbjct  21   CLAGLLAQPVSGQNQPLKPGDYSSPNTVPAFPVQTESQTCRLDLTAELFGGVNDACGRD-  79

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKAL  553
                L R+RCCPVLAAWL++A++  ALQ   +  P +   D+P++PDDS+ CV+SL+ AL
Sbjct  80   ----LDRSRCCPVLAAWLFAAHARYALQ-VPAPAPASAESDLPMMPDDSQKCVNSLQSAL  134

Query  554  GNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS  667
             NK +++ +PN +CD + C+CGIRLH    LSCP AF+++S
Sbjct  135  LNKNVKIPQPNASCDPILCFCGIRLHQISSLSCPAAFNVSS  175



>ref|XP_009777833.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Nicotiana 
sylvestris]
Length=318

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 102/145 (70%), Gaps = 10/145 (7%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVL  415
            +P+     S   T+PAFP Q+ +  C LDL++ELF G+ +ACG N     L R+RCCPVL
Sbjct  29   QPLKPGDYSNSNTVPAFPVQTESQTCRLDLSDELFGGVSAACGQN-----LDRSRCCPVL  83

Query  416  AAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTC  595
            AAWL++A++ +ALQ +T+  P ++  D+P++PDDS+ CV++L+ +L ++ I L +PN +C
Sbjct  84   AAWLFAAHARSALQVSTAVAPASS--DLPMMPDDSQKCVNTLQNSLQSRNIHLPQPNGSC  141

Query  596  DVVYCYCGIRLH---PLSCPEAFSM  661
            D V C+CGIRLH    LSCP AF++
Sbjct  142  DAVLCFCGIRLHQITSLSCPAAFNL  166



>ref|XP_008341934.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Malus domestica]
Length=326

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 102/155 (66%), Gaps = 8/155 (5%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P    P+P+     S+P TIPA P Q+ T  C LDL+ ELF G+  ACG +     L
Sbjct  30   LAEPVTGHPQPLKPGEYSSPNTIPALPSQTQTQTCHLDLSAELFGGVSQACGRD-----L  84

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++ +AL+  +S    +   D P++PDDS+ CV+SL+ +L ++ I
Sbjct  85   DRSRCCPVLAAWLFAAHARSALELPSSDTAPSAVPDQPMMPDDSQKCVNSLQSSLVSRNI  144

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN  664
             + +PN +CD V C+CGIRLH    LSCP AF+++
Sbjct  145  RIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNVS  179



>ref|XP_004243303.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Solanum 
lycopersicum]
Length=318

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 97/133 (73%), Gaps = 10/133 (8%)
 Frame = +2

Query  272  TIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTA  451
            T+PAFP Q+ +  C LDL++ELF G+ +ACG N     L R+RCCPVLAAWL++A++ +A
Sbjct  44   TVPAFPVQTESQICRLDLSDELFGGVSAACGQN-----LDRSRCCPVLAAWLFAAHARSA  98

Query  452  LQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH  631
            LQ + S  P ++  D+P++PDDS+ CV++L+ +L ++ I L +PN TCD V C+CGIRLH
Sbjct  99   LQVSGSAAPASS--DLPMMPDDSQKCVNTLQNSLQSRNIHLPQPNGTCDAVLCFCGIRLH  156

Query  632  ---PLSCPEAFSM  661
                LSCP AF++
Sbjct  157  QITSLSCPAAFNL  169



>ref|XP_007215670.1| hypothetical protein PRUPE_ppa008626mg [Prunus persica]
 gb|EMJ16869.1| hypothetical protein PRUPE_ppa008626mg [Prunus persica]
Length=324

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 102/155 (66%), Gaps = 8/155 (5%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P    P+P+     S+P T+PA P Q+ T  C LDL++ELF G+  ACG +     L
Sbjct  29   LAQPITGHPQPLKPGEYSSPNTVPALPSQTPTQTCHLDLSDELFGGVSQACGRD-----L  83

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++ +AL+  +S    +   D P++PDDS+ CV+SL+ +L  + I
Sbjct  84   DRSRCCPVLAAWLFAAHARSALELPSSAPAPSAGLDQPMMPDDSQKCVNSLQSSLVGRNI  143

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN  664
             + +PN +CD V C+CGIRLH    LSCP AF+++
Sbjct  144  RIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNLS  178



>ref|XP_006366939.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Solanum tuberosum]
Length=318

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 97/133 (73%), Gaps = 10/133 (8%)
 Frame = +2

Query  272  TIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTA  451
            T+PAFP Q+ +  C LDL++ELF G+ +ACG N     L R+RCCPVLAAWL++A++ +A
Sbjct  44   TVPAFPVQTESQICRLDLSDELFGGVSAACGQN-----LDRSRCCPVLAAWLFAAHARSA  98

Query  452  LQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH  631
            LQ + +  P ++  D+P++PDDS+ CV++L+ +L ++ I L +PN TCD V C+CGIRLH
Sbjct  99   LQVSGAAAPASS--DLPMMPDDSQKCVNTLQNSLQSRNIHLPQPNGTCDAVLCFCGIRLH  156

Query  632  ---PLSCPEAFSM  661
                LSCP AF++
Sbjct  157  QITSLSCPAAFNL  169



>ref|XP_008379580.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Malus domestica]
Length=330

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 102/158 (65%), Gaps = 12/158 (8%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTA----ACPLDLTEELFRGIKSACGSNDY  376
            +A P   +P+P+     STP T+PA P Q+ T      C LDL+ ELF G+  ACG N  
Sbjct  30   LAEPVTGNPQPLKPGENSTPNTVPALPTQNPTQNPIQTCHLDLSAELFGGVSQACGRN--  87

Query  377  SGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALG  556
               L R+RCCPVLAAWL++A++ +AL+  +S    +   D P++PDDS+ CV+SL+ +L 
Sbjct  88   ---LDRSRCCPVLAAWLFAAHARSALELPSSAPAPSAVLDQPMMPDDSQKCVNSLQSSLV  144

Query  557  NKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSM  661
            N+ I + +PN +CD V C+CGIRLH    LSCP AF++
Sbjct  145  NRNIRIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNV  182



>ref|XP_002518003.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44521.1| conserved hypothetical protein [Ricinus communis]
Length=318

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 104/156 (67%), Gaps = 9/156 (6%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     +P+     S+P T+PAFP Q+ +  C LDL+ ELF G+  ACG       L
Sbjct  22   LAEPVSGSNQPLKPGDYSSPNTVPAFPVQTESQVCRLDLSAELFGGVNDACGRE-----L  76

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++  ALQ + S  P +   D+P++PDDS+ CV+SL+ AL ++ +
Sbjct  77   DRSRCCPVLAAWLFAAHARYALQVSASA-PASAEEDLPMMPDDSQKCVNSLQSALLSRNV  135

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS  667
            ++ +PN +CD + C+CGIRLH    LSCP AF+++S
Sbjct  136  KIPQPNASCDAILCFCGIRLHQITSLSCPAAFNVSS  171



>ref|XP_010268888.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nelumbo nucifera]
 ref|XP_010268889.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nelumbo nucifera]
Length=323

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 96/140 (69%), Gaps = 11/140 (8%)
 Frame = +2

Query  260  STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAY  439
            ST  T+PAFP Q+    C LDL++ELF G+  ACG N     L R+RCCPVLAAWL++A+
Sbjct  41   STTNTVPAFPVQTQAQICHLDLSDELFGGVSEACGHN-----LDRSRCCPVLAAWLFAAH  95

Query  440  STTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCG  619
            + +ALQ + +     T+ D P++PDDS+ CV+SL+ +  N+ I + +PN TCD + C+CG
Sbjct  96   ARSALQVSAAA---PTSSDGPMMPDDSQKCVNSLQSSFQNRNIHIPQPNSTCDAILCFCG  152

Query  620  IRLH---PLSCPEAFSMNSH  670
            IRLH    LSCP AF++ S+
Sbjct  153  IRLHQISSLSCPAAFNVTSY  172



>ref|XP_008230199.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Prunus 
mume]
Length=324

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 102/155 (66%), Gaps = 8/155 (5%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P    P+P+     S+P T+PA P Q+ T  C LDL+ ELF G+  ACG +     L
Sbjct  29   LAQPITGHPQPLKPGEYSSPNTVPALPAQTPTQTCHLDLSNELFGGVSQACGRD-----L  83

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++ +AL+  +S    +   D P++PDDS+ CV+SL+ +L ++ I
Sbjct  84   DRSRCCPVLAAWLFAAHARSALELPSSAPAPSAGLDQPMMPDDSQKCVNSLQSSLVSRNI  143

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN  664
             + +PN +CD V C+CGIRLH    LSCP AF+++
Sbjct  144  RIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNVS  178



>ref|XP_009596251.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Nicotiana 
tomentosiformis]
Length=318

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 101/145 (70%), Gaps = 10/145 (7%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVL  415
            +P+     S   T+PAFP Q+ +  C LDL++ELF G+ +ACG N     L R+RCCPVL
Sbjct  29   QPLKPGDYSNSNTVPAFPVQTESQICRLDLSDELFGGVSAACGQN-----LDRSRCCPVL  83

Query  416  AAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTC  595
            AAWL++A++ +ALQ + +  P ++  D+P++PDDS+ CV++L+ +L ++ I L +PN +C
Sbjct  84   AAWLFAAHARSALQVSAAIAPASS--DLPMMPDDSQKCVNTLQSSLQSRNIHLPQPNTSC  141

Query  596  DVVYCYCGIRLH---PLSCPEAFSM  661
            D V C+CGIRLH    LSCP AF++
Sbjct  142  DAVLCFCGIRLHQITSLSCPAAFNL  166



>ref|XP_011047484.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Populus euphratica]
 ref|XP_011047485.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Populus euphratica]
Length=322

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 99/139 (71%), Gaps = 10/139 (7%)
 Frame = +2

Query  260  STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAY  439
            S P T+PAFP Q+ +  C LDL+ ELF G+  ACG +     L R+RCCPVLAAWL++A+
Sbjct  39   SNPNTVPAFPVQTESQICQLDLSAELFGGVNDACGRD-----LDRSRCCPVLAAWLFAAH  93

Query  440  STTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCG  619
            + +ALQ   +  P T+  D+P++PDDS+ CV+SL+ AL +K ++L +PN +CD + C+CG
Sbjct  94   ARSALQ-VQAPAP-TSAPDLPMMPDDSQKCVNSLQSALLSKNVKLAQPNASCDAILCFCG  151

Query  620  IRLH---PLSCPEAFSMNS  667
            IRLH    LSCP AF+++S
Sbjct  152  IRLHQISSLSCPAAFNVSS  170



>ref|XP_010448030.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Camelina sativa]
Length=305

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 99/141 (70%), Gaps = 9/141 (6%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P  P T+PAFP ++   +C LDL++ELF G+K ACG N     L R+RCCPVLAAWL++A
Sbjct  29   PVQPNTVPAFPVETQAQSCRLDLSDELFGGVKEACGRN-----LDRSRCCPVLAAWLFAA  83

Query  437  YSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY  613
            ++ +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K I++ +PN +CD + C+
Sbjct  84   HARSALQLPAPAPTPESSDPDEPMKPDDSQKCVNTLQTALLTKQIKIPQPNSSCDAILCF  143

Query  614  CGIRLH---PLSCPEAFSMNS  667
            CGIRLH    LSCP AF+++S
Sbjct  144  CGIRLHQISSLSCPAAFNVSS  164



>ref|XP_002326107.1| hypothetical protein POPTR_0019s14080g [Populus trichocarpa]
 gb|ABK95869.1| unknown [Populus trichocarpa]
 gb|EEF00489.1| hypothetical protein POPTR_0019s14080g [Populus trichocarpa]
Length=322

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 99/139 (71%), Gaps = 10/139 (7%)
 Frame = +2

Query  260  STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAY  439
            S P T+PAFP Q+ +  C LDL+ ELF G+  ACG +     L R+RCCPVLAAWL++A+
Sbjct  39   SNPNTVPAFPVQTESQICHLDLSAELFGGVNDACGRD-----LDRSRCCPVLAAWLFAAH  93

Query  440  STTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCG  619
            + +ALQ   +  P T+  D+P++PDDS+ CV+SL+ AL +K ++L +PN +CD + C+CG
Sbjct  94   ARSALQ-VQAPAP-TSAPDLPMMPDDSQKCVNSLQSALLSKNVKLAQPNASCDAILCFCG  151

Query  620  IRLH---PLSCPEAFSMNS  667
            IRLH    LSCP AF+++S
Sbjct  152  IRLHQISSLSCPAAFNVSS  170



>ref|XP_010438502.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
isoform X1 [Camelina sativa]
 ref|XP_010438503.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
isoform X2 [Camelina sativa]
Length=305

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 99/141 (70%), Gaps = 9/141 (6%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P  P T+PAFP ++   +C LDL++ELF G+K ACG N     L R+RCCPVLAAWL++A
Sbjct  28   PVQPNTVPAFPVETQAQSCRLDLSDELFGGVKEACGRN-----LDRSRCCPVLAAWLFAA  82

Query  437  YSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY  613
            ++ +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K I++ +PN +CD + C+
Sbjct  83   HARSALQLPAPAPTPESSDPDEPMKPDDSQKCVNTLQTALLTKQIKIPQPNSSCDAILCF  142

Query  614  CGIRLH---PLSCPEAFSMNS  667
            CGIRLH    LSCP AF+++S
Sbjct  143  CGIRLHQISSLSCPAAFNVSS  163



>ref|XP_006412993.1| hypothetical protein EUTSA_v10025835mg [Eutrema salsugineum]
 gb|ESQ54446.1| hypothetical protein EUTSA_v10025835mg [Eutrema salsugineum]
Length=301

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 98/141 (70%), Gaps = 9/141 (6%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P  P T+PAFP ++   +C LDL++ELF G+  ACG N     L R+RCCPVLAAWL++A
Sbjct  27   PVQPNTVPAFPVETQAQSCRLDLSDELFGGVNEACGRN-----LDRSRCCPVLAAWLFAA  81

Query  437  YSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY  613
            +S +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K +++ +PN TCD + C+
Sbjct  82   HSRSALQLPAPAPTPESSDPDEPMKPDDSQKCVNTLQSALLTKHVKIPQPNSTCDAILCF  141

Query  614  CGIRLH---PLSCPEAFSMNS  667
            CGIRLH    LSCP AF+++S
Sbjct  142  CGIRLHQISSLSCPAAFNVSS  162



>ref|XP_010540855.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Tarenaya 
hassleriana]
Length=290

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 98/144 (68%), Gaps = 12/144 (8%)
 Frame = +2

Query  248  FSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWL  427
             + P  P T+PAFP Q+   +C LDL++ELF G+  ACG N     L R+RCCPVLAAWL
Sbjct  24   LAQPVQPNTVPAFPVQNEAQSCRLDLSDELFGGVNEACGRN-----LDRSRCCPVLAAWL  78

Query  428  YSAYSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVV  604
            ++A++ +ALQ  A++  P     D P++PDDS+ CV+SL+ AL  K +++ +PN +CD +
Sbjct  79   FAAHARSALQLPASAPSPEP---DEPMMPDDSQKCVNSLQSALLTKQVKIPQPNSSCDAI  135

Query  605  YCYCGIRLH---PLSCPEAFSMNS  667
             C+CGIRLH    LSCP AF+ N+
Sbjct  136  LCFCGIRLHQISSLSCPAAFNHNA  159



>ref|XP_007149909.1| hypothetical protein PHAVU_005G109200g [Phaseolus vulgaris]
 gb|ESW21903.1| hypothetical protein PHAVU_005G109200g [Phaseolus vulgaris]
Length=303

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 96/143 (67%), Gaps = 10/143 (7%)
 Frame = +2

Query  272  TIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTA  451
            T+PA+P Q+    C LDL+ ELF G+  ACG+      L R+RCCPVLAAWL++A++ TA
Sbjct  36   TVPAYPTQTRYQICRLDLSNELFGGVNHACGTT-----LDRSRCCPVLAAWLFAAHARTA  90

Query  452  LQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH  631
            L+ + +  P +   D+P++PDDS+ CV+SL+ +L N+ I + +PN TCD + C+CGIRLH
Sbjct  91   LEVSAAAQPPSA--DLPMMPDDSQNCVNSLQDSLRNRSIRIPQPNGTCDAILCFCGIRLH  148

Query  632  ---PLSCPEAFSMNSHGEXVGHQ  691
                LSCP AF++ +     G Q
Sbjct  149  QITSLSCPNAFNITAVQNVSGTQ  171



>emb|CDP11898.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 102/145 (70%), Gaps = 10/145 (7%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVL  415
            +P+     S+  T+PAFP Q+    C LDL++ELF G+ +ACG +     L R+RCCPVL
Sbjct  42   QPLKPGEYSSSNTVPAFPVQTQAQTCRLDLSDELFGGVSAACGRD-----LDRSRCCPVL  96

Query  416  AAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTC  595
            AAWL++A++ +ALQ  TS  P T++ DMP++PDDS+ CV+SL+ +L ++ I + +PN +C
Sbjct  97   AAWLFAAHARSALQ-VTSAAPPTSS-DMPMMPDDSQKCVNSLQSSLLSRNIHIPQPNGSC  154

Query  596  DVVYCYCGIRLH---PLSCPEAFSM  661
            D V C+CGIRLH    LSCP AF++
Sbjct  155  DPVLCFCGIRLHQITSLSCPAAFNL  179



>ref|XP_010095855.1| hypothetical protein L484_022212 [Morus notabilis]
 gb|EXB62323.1| hypothetical protein L484_022212 [Morus notabilis]
Length=325

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 105/159 (66%), Gaps = 12/159 (8%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     +P+     ++P T+PAFP Q+    C LDL++ELF G+K ACG +     L
Sbjct  30   LAEPATGQNQPLKPGEYASPNTVPAFPVQTQAQICRLDLSDELFGGVKEACGRD-----L  84

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTF----DMPVLPDDSETCVDSLEKALG  556
             R+RCCPVLAAWL++A++ +AL+ + +  P  +      D+P++PDDS+ CV+SL+ +L 
Sbjct  85   DRSRCCPVLAAWLFAAHARSALEVSPAAAPSPSVSEGGGDLPMMPDDSQKCVNSLQSSLL  144

Query  557  NKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN  664
            ++ I + +PN +CD + C+CGIRLH    LSCP AF+++
Sbjct  145  SRNIRIPQPNASCDAILCFCGIRLHQITSLSCPAAFNVS  183



>gb|KFK29337.1| hypothetical protein AALP_AA7G120700 [Arabis alpina]
Length=302

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 96/140 (69%), Gaps = 11/140 (8%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P  P T+PAFP ++   +C LDL+EELF G+  ACG N     L R+RCCPVLAAWL++A
Sbjct  29   PVQPNTVPAFPVETEAQSCRLDLSEELFGGVNEACGRN-----LDRSRCCPVLAAWLFAA  83

Query  437  YSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYC  616
            ++ +ALQ      P ++  D P+ PDDS+ CV++L+ AL  K +++ +PN +CD + C+C
Sbjct  84   HARSALQLPA---PESSDPDQPMKPDDSQKCVNTLQSALLTKHVKIPQPNSSCDAILCFC  140

Query  617  GIRLH---PLSCPEAFSMNS  667
            GIRLH    LSCP AF+++S
Sbjct  141  GIRLHQISSLSCPAAFNVSS  160



>ref|XP_010924042.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Elaeis guineensis]
Length=339

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 98/148 (66%), Gaps = 9/148 (6%)
 Frame = +2

Query  233  PEPVSFSTPSTPATIPAFPE-QSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCP  409
            P+P  FS+ +T  T+PAFP  QS    C LDL++ELF G+  ACG +     L R+RCCP
Sbjct  40   PDPRDFSSTTTTNTVPAFPVVQSAKQTCRLDLSDELFGGVGEACGRS-----LDRSRCCP  94

Query  410  VLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQ  589
            VLAAWL++A++ +AL+            D P++PDD++ CVDSL+++L  + I L +PN 
Sbjct  95   VLAAWLFAAHARSALEVGQPPSATAEAADGPLMPDDNQKCVDSLQRSLERRDIHLPRPNA  154

Query  590  TCDVVYCYCGIRLHPLS---CPEAFSMN  664
            TCD V C+CGIRLH +S   CP AF+++
Sbjct  155  TCDTVLCFCGIRLHQISSLRCPAAFNVS  182



>ref|XP_010051489.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Eucalyptus grandis]
 gb|KCW89474.1| hypothetical protein EUGRSUZ_A01771 [Eucalyptus grandis]
Length=314

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 95/142 (67%), Gaps = 9/142 (6%)
 Frame = +2

Query  266  PATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYST  445
            P T+PAFP  S    C LDL+ ELF G+  ACG N     L R+RCCPVLAAWL++A++ 
Sbjct  40   PYTVPAFPVDSAGQICKLDLSAELFGGVSEACGRN-----LDRSRCCPVLAAWLFAAHAR  94

Query  446  TALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIR  625
             ALQ A +  P +   ++P++PDDS+ CV+SL+ AL +K + L +PN +CD V C+CGIR
Sbjct  95   YALQVAPAAAPSSGE-ELPMIPDDSQKCVNSLQSALVSKNVHLPQPNASCDAVLCFCGIR  153

Query  626  LH---PLSCPEAFSMNSHGEXV  682
            +H    LSCP AF+++S    V
Sbjct  154  VHQISSLSCPAAFNVSSASRNV  175



>ref|NP_567797.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SUC9.1|UGPI7_ARATH RecName: Full=Uncharacterized GPI-anchored protein At4g28100; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB36779.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79612.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43037.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 dbj|BAD43484.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|AEE85441.1| uncharacterized protein AT4G28100 [Arabidopsis thaliana]
Length=304

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 97/141 (69%), Gaps = 9/141 (6%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P  P T+PAFP ++   +C LDL+ ELF G+  ACG N     L R+RCCPVLAAWL++A
Sbjct  28   PVQPNTVPAFPVETQAQSCRLDLSNELFGGVNEACGRN-----LDRSRCCPVLAAWLFAA  82

Query  437  YSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY  613
            ++ +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K I++ +PN +CD + C+
Sbjct  83   HARSALQLPAPAPTPESSDPDEPMKPDDSQKCVNTLQSALLTKQIKIPQPNSSCDAILCF  142

Query  614  CGIRLH---PLSCPEAFSMNS  667
            CGIRLH    LSCP AF+++S
Sbjct  143  CGIRLHQISSLSCPAAFNVSS  163



>ref|XP_010433261.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Camelina 
sativa]
Length=304

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 98/141 (70%), Gaps = 9/141 (6%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P    T+PAFP ++   +C LDL++ELF G+K ACG N     L R+RCCPVLAAWL++A
Sbjct  28   PVQSNTVPAFPVETQAQSCRLDLSDELFGGVKEACGRN-----LDRSRCCPVLAAWLFAA  82

Query  437  YSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY  613
            ++ +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K I++ +PN +CD + C+
Sbjct  83   HARSALQLPAPAPTPESSDPDEPMKPDDSQKCVNTLQTALLTKQIKIPQPNSSCDAILCF  142

Query  614  CGIRLH---PLSCPEAFSMNS  667
            CGIRLH    LSCP AF+++S
Sbjct  143  CGIRLHQISSLSCPAAFNVSS  163



>gb|AAM65702.1| unknown [Arabidopsis thaliana]
Length=304

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 97/141 (69%), Gaps = 9/141 (6%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P  P T+PAFP ++   +C LDL+ ELF G+  ACG N     L R+RCCPVLAAWL++A
Sbjct  28   PVQPNTVPAFPVETQAQSCRLDLSNELFGGVNEACGRN-----LDRSRCCPVLAAWLFAA  82

Query  437  YSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY  613
            ++ +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K I++ +PN +CD + C+
Sbjct  83   HARSALQLPAPAPTPESSDPDEPMKPDDSQKCVNTLQSALLTKQIKIPQPNSSCDAILCF  142

Query  614  CGIRLHP---LSCPEAFSMNS  667
            CGIRLH    LSCP AF+++S
Sbjct  143  CGIRLHQISSLSCPAAFNVSS  163



>ref|XP_010689311.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Beta 
vulgaris subsp. vulgaris]
Length=327

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 99/141 (70%), Gaps = 11/141 (8%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P+TP T+PAFP Q+++  C LDL++ELF G+  ACG N     L R+RCCPVLAAWLY+A
Sbjct  40   PTTPNTVPAFPVQTDSQTCHLDLSDELFGGVNEACGHN-----LDRSRCCPVLAAWLYAA  94

Query  437  YSTTALQRATSKIPRTTTFD--MPVLPD-DSETCVDSLEKALGNKGIELVKPNQTCDVVY  607
            ++ +AL+   ++ P +   D  +P++P+ DS+ CV+SL+ +L  + I L +PN TCD V 
Sbjct  95   HARSALEIPPARPPVSPDSDSELPMMPESDSQKCVNSLQNSLSKRNITLPQPNNTCDTVL  154

Query  608  CYCGIRLH---PLSCPEAFSM  661
            C+CGIRLH    LSCP AF++
Sbjct  155  CFCGIRLHQIASLSCPAAFNL  175



>ref|XP_002867466.1| hypothetical protein ARALYDRAFT_491965 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43725.1| hypothetical protein ARALYDRAFT_491965 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 98/144 (68%), Gaps = 9/144 (6%)
 Frame = +2

Query  248  FSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWL  427
             + P  P T+PAFP ++   +C LDL+ ELF G+  ACG N     L R+RCCPVLAAWL
Sbjct  25   LAEPVQPNTVPAFPVETQAQSCRLDLSNELFGGVNEACGRN-----LDRSRCCPVLAAWL  79

Query  428  YSAYSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVV  604
            ++A++ +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K I++ +PN +CD +
Sbjct  80   FAAHARSALQLPAPAPTPESSDPDEPMKPDDSQKCVNTLQSALLIKQIKIPQPNSSCDAI  139

Query  605  YCYCGIRLH---PLSCPEAFSMNS  667
             C+CGIRLH    LSCP AF+++S
Sbjct  140  LCFCGIRLHQISSLSCPAAFNVSS  163



>ref|XP_006284191.1| hypothetical protein CARUB_v10005339mg [Capsella rubella]
 gb|EOA17089.1| hypothetical protein CARUB_v10005339mg [Capsella rubella]
Length=304

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 97/141 (69%), Gaps = 9/141 (6%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P  P T+PAFP ++   +C LDL++ELF G+K ACG N     L R+RCCPVLAAWL++A
Sbjct  28   PVEPNTVPAFPVETQAQSCRLDLSDELFGGVKEACGRN-----LVRSRCCPVLAAWLFAA  82

Query  437  YSTTALQ-RATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY  613
            ++ +ALQ  A +  P     D P+ PDDS+ CV++L+ AL  K I++ +PN +CD + C+
Sbjct  83   HARSALQLPAPAPTPEPADPDEPMKPDDSQKCVNTLQSALLTKQIKIPQPNSSCDAILCF  142

Query  614  CGIRLH---PLSCPEAFSMNS  667
            CGIRLH    LSCP AF+++S
Sbjct  143  CGIRLHQISSLSCPAAFNVSS  163



>ref|XP_004136804.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis sativus]
 gb|KGN43572.1| hypothetical protein Csa_7G046110 [Cucumis sativus]
Length=322

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 101/150 (67%), Gaps = 10/150 (7%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVL  415
            +P++    S+P T+PAFP Q+    C LDL++ELF G++ ACG +     L R+RCCPVL
Sbjct  39   QPLNPGQYSSPNTVPAFPVQTQMQICHLDLSDELFGGVREACGRD-----LDRSRCCPVL  93

Query  416  AAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTC  595
            AAWL++A++  AL+   +     +  D+P++PDDS+ CV+SL+ +L ++ I + +PN +C
Sbjct  94   AAWLFAAHARAALK--IAAPAPASAADLPMMPDDSQKCVNSLQTSLLSRNIRIPQPNASC  151

Query  596  DVVYCYCGIRLH---PLSCPEAFSMNSHGE  676
            D V C+CGIRLH    LSCP AF+++  G 
Sbjct  152  DAVLCFCGIRLHQISSLSCPAAFNVSGGGN  181



>ref|XP_004293470.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Fragaria 
vesca subsp. vesca]
Length=324

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 102/154 (66%), Gaps = 9/154 (6%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     +P+     S+P T+PA+P Q+    C LDL+ ELF G+  ACG +     L
Sbjct  24   LAEPVTGHGQPLKPGEYSSPNTVPAYPVQTQAQTCRLDLSAELFGGVNEACGRD-----L  78

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++ +AL+ +++  P +   D P++PDDS+ CV+SL+ +L ++ I
Sbjct  79   DRSRCCPVLAAWLFAAHARSALEISSAPEP-SAVGDQPMMPDDSQKCVNSLQTSLLSRNI  137

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSM  661
             + +PN TCD + C+CGIRLH    LSCP AF++
Sbjct  138  RIPQPNATCDAILCFCGIRLHQISSLSCPAAFNV  171



>gb|KDO55799.1| hypothetical protein CISIN_1g020738mg [Citrus sinensis]
Length=275

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     +P+     ++  T+PAFP Q+  A C LDL+ ELF G+  ACG +     L
Sbjct  25   LAEPASGHDQPLKPGEYASTNTVPAFPAQTQAATCRLDLSAELFGGVNEACGRD-----L  79

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A+S  ALQ            D P++PDDS+ CV+SL+ AL +K +
Sbjct  80   DRSRCCPVLAAWLFAAHSRYALQ--VPAAAPAAEPDQPMMPDDSQKCVNSLQSALVSKNV  137

Query  569  ELVKPNQTCDVVYCYCGIRLHP---LSCPEAFSMNS  667
            ++ +PN +CD + C+CGIRLH    LSCP AF++ +
Sbjct  138  KIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVTA  173



>ref|XP_002319388.2| hypothetical protein POPTR_0013s14490g [Populus trichocarpa]
 gb|EEE95311.2| hypothetical protein POPTR_0013s14490g [Populus trichocarpa]
Length=316

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 102/156 (65%), Gaps = 10/156 (6%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     +P+     S P T+PA P Q+ +  C LDL+ ELF G+  ACG +     L
Sbjct  22   LAEPVSGQNQPLKPGDYSNPNTVPAIPVQTESQICHLDLSAELFGGVNDACGRD-----L  76

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++ +ALQ   S    T + D P++PDDS+ CV+SL+ AL +K +
Sbjct  77   DRSRCCPVLAAWLFAAHARSALQVHASA--PTPSPDFPMMPDDSQKCVNSLQSALLSKNV  134

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS  667
            +L +PN +CD + C+CGIRLH    LSCP AF+++S
Sbjct  135  KLPQPNASCDAILCFCGIRLHHISSLSCPAAFNVSS  170



>gb|KHG07118.1| hypothetical protein F383_33082 [Gossypium arboreum]
Length=325

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 8/157 (5%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     EP+     S+P T+PAFP Q+    C LDL+ ELF G+  ACG N     +
Sbjct  27   LAQPVPGSDEPLKPGGYSSPNTVPAFPAQTQAQICRLDLSAELFGGVNDACGHN-----M  81

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++  AL+        +   + P+ PDDS+ CV+SL+ AL +K +
Sbjct  82   DRSRCCPVLAAWLFAAHARYALEVTAPAPAESELPEQPMRPDDSQKCVNSLQDALLSKRV  141

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSH  670
             + +PN +CD + C+CGIRLH    LSCP AF+++ H
Sbjct  142  RIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVSGH  178



>ref|XP_009144190.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Brassica 
rapa]
Length=302

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 97/141 (69%), Gaps = 9/141 (6%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P TP T+PAFP ++    C LDL++ELF G+  ACG N     L R+RCCPVLAAWL++A
Sbjct  28   PVTPNTVPAFPVETQAQTCRLDLSDELFGGVNEACGRN-----LDRSRCCPVLAAWLFAA  82

Query  437  YSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY  613
            ++ +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K I++ +P+  CD + C+
Sbjct  83   HARSALQLPAPAPTPASSDPDEPMRPDDSQKCVNTLQSALLTKHIKIPQPSPNCDAILCF  142

Query  614  CGIRLH---PLSCPEAFSMNS  667
            CGIRLH    LSCP AF+++S
Sbjct  143  CGIRLHQISSLSCPAAFNVSS  163



>emb|CDY19004.1| BnaC01g20640D [Brassica napus]
Length=302

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 97/141 (69%), Gaps = 9/141 (6%)
 Frame = +2

Query  257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA  436
            P TP T+PAFP ++    C LDL++ELF G+  ACG N     L R+RCCPVLAAWL++A
Sbjct  28   PVTPNTVPAFPVETQAQTCRLDLSDELFGGVNEACGRN-----LDRSRCCPVLAAWLFAA  82

Query  437  YSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY  613
            ++ +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K I++ +P+  CD + C+
Sbjct  83   HARSALQLPAPAPTPASSDPDEPMRPDDSQKCVNTLQSALLTKHIKIPQPSPNCDAILCF  142

Query  614  CGIRLH---PLSCPEAFSMNS  667
            CGIRLH    LSCP AF+++S
Sbjct  143  CGIRLHQISSLSCPAAFNVSS  163



>gb|KJB31741.1| hypothetical protein B456_005G206400 [Gossypium raimondii]
Length=325

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 8/157 (5%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     EP+     S+P T+PAFP Q+    C LDL+ ELF G+  ACG N     L
Sbjct  27   LAQPVPGSDEPLKPGGYSSPNTVPAFPAQTQAQICRLDLSAELFGGVNDACGHN-----L  81

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++  AL+        +   + P+ PDDS+ CV+SL+ +L +K +
Sbjct  82   DRSRCCPVLAAWLFAAHARYALEVTAPAPAESELPEQPMRPDDSQKCVNSLQDSLLSKRV  141

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSH  670
             + +PN +CD + C+CGIRLH    LSCP AF+++ H
Sbjct  142  RIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVSGH  178



>ref|XP_007043448.1| Uncharacterized protein TCM_007897 [Theobroma cacao]
 gb|EOX99279.1| Uncharacterized protein TCM_007897 [Theobroma cacao]
Length=323

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 99/155 (64%), Gaps = 8/155 (5%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     +P+     S+P T+PAFP Q+    C LDL+ ELF G+  ACG N     L
Sbjct  27   LAQPVSGHDQPLKPGDYSSPNTVPAFPVQTEAQVCRLDLSAELFGGVSDACGHN-----L  81

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++  AL+ +      +   + P++PDDS+ CV+SL+ AL +K +
Sbjct  82   DRSRCCPVLAAWLFAAHARYALEVSAPAPAESEQPEQPMMPDDSQKCVNSLQNALLSKRV  141

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN  664
             + +PN +CD + C+CGIRLH    LSCP AF+++
Sbjct  142  RIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVS  176



>gb|EPS66167.1| hypothetical protein M569_08604, partial [Genlisea aurea]
Length=269

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 95/139 (68%), Gaps = 10/139 (7%)
 Frame = +2

Query  269  ATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTT  448
            +T+P+ P Q+ +  C LDL+ ELF G+ +ACG N     L R+RCCPVLAAWL++A++  
Sbjct  4    STVPSLPLQAESQTCRLDLSAELFGGVSAACGRN-----LDRSRCCPVLAAWLFAAHARA  58

Query  449  ALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRL  628
            AL+ A +  P  +  D+P++PDDS+ CV+SL+ +L ++ I + +PN +CD V C+CGIRL
Sbjct  59   ALEVAPNSPPAGS--DLPMMPDDSQKCVNSLQSSLASRNIHIPQPNASCDTVLCFCGIRL  116

Query  629  H---PLSCPEAFSMNSHGE  676
            H    LSCP AF++  +  
Sbjct  117  HQIASLSCPAAFNLTGNSR  135



>gb|KDO55798.1| hypothetical protein CISIN_1g020738mg [Citrus sinensis]
Length=322

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     +P+     ++  T+PAFP Q+  A C LDL+ ELF G+  ACG +     L
Sbjct  25   LAEPASGHDQPLKPGEYASTNTVPAFPAQTQAATCRLDLSAELFGGVNEACGRD-----L  79

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A+S  ALQ            D P++PDDS+ CV+SL+ AL +K +
Sbjct  80   DRSRCCPVLAAWLFAAHSRYALQ--VPAAAPAAEPDQPMMPDDSQKCVNSLQSALVSKNV  137

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS  667
            ++ +PN +CD + C+CGIRLH    LSCP AF++ +
Sbjct  138  KIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVTA  173



>ref|XP_006447405.1| hypothetical protein CICLE_v10015940mg [Citrus clementina]
 ref|XP_006469818.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Citrus sinensis]
 gb|ESR60645.1| hypothetical protein CICLE_v10015940mg [Citrus clementina]
Length=322

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     +P+     ++  T+PAFP Q+  A C LDL+ ELF G+  ACG +     L
Sbjct  25   LAEPASGHDQPLKPGEYASTNTVPAFPAQTQAATCRLDLSAELFGGVNEACGRD-----L  79

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A+S  ALQ            D P++PDDS+ CV+SL+ AL +K +
Sbjct  80   DRSRCCPVLAAWLFAAHSRYALQ--VPAAAPAAEPDQPMMPDDSQKCVNSLQSALVSKNV  137

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS  667
            ++ +PN +CD + C+CGIRLH    LSCP AF++ +
Sbjct  138  KIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVTA  173



>ref|XP_011048474.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Populus euphratica]
Length=318

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 10/156 (6%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P     +P+     S   T+PAFP Q+ +  C LDL+ ELF G+  ACG +     L
Sbjct  22   LAEPVSGQNQPLKPGDYSNTNTVPAFPVQTESQICHLDLSAELFGGVNDACGRD-----L  76

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI  568
             R+RCCPVLAAWL++A++ +ALQ   S    T + D P++PDDS+ CV+SL+ AL  K +
Sbjct  77   DRSRCCPVLAAWLFAAHARSALQVHASA--PTPSPDFPMMPDDSQKCVNSLQSALLTKNV  134

Query  569  ELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS  667
            +L +PN +CD + C+CGIRLH    +SCP AF+++S
Sbjct  135  KLPQPNASCDAILCFCGIRLHHISSISCPAAFNVSS  170



>ref|XP_003597088.1| GPI-anchored protein, putative [Medicago truncatula]
 ref|XP_003606027.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|AES67339.1| hypothetical protein MTR_2g089530 [Medicago truncatula]
 gb|AES88224.1| hypothetical protein MTR_4g051000 [Medicago truncatula]
Length=301

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = +2

Query  245  SFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAW  424
            S S  S   T+P++P  + +  C LDL+ ELF G+  ACG+N     L R+RCCPVLAAW
Sbjct  16   SISNISHSNTLPSYPTPTESQICKLDLSNELFGGVNDACGNN-----LDRSRCCPVLAAW  70

Query  425  LYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVV  604
            L++A++  AL+   S  PR  + D+P++PDDS+ CV+SL+ +L ++ I +  PN +CD +
Sbjct  71   LFAAHARRALE--ISPPPRENSVDLPMMPDDSQKCVNSLQDSLRDRNIIIPTPNASCDAI  128

Query  605  YCYCGIRLHPLS---CPEAFSM  661
             C+CGIRLH +S   CP AF++
Sbjct  129  LCFCGIRLHQISSLNCPNAFNV  150



>ref|XP_003540881.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Glycine 
max]
Length=317

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 94/134 (70%), Gaps = 10/134 (7%)
 Frame = +2

Query  272  TIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTA  451
            T+PAFP Q+    C LDL++ELF G+K ACG +     L R+RCCPVLAAWL++A++ TA
Sbjct  50   TVPAFPVQTQALTCRLDLSDELFGGVKDACGKD-----LDRSRCCPVLAAWLFAAHARTA  104

Query  452  LQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH  631
            L    S  P  ++ D+P++PDDS+ CV+SL+ +L ++ I + +PN TCD + C+CGIRLH
Sbjct  105  LD--VSAAPPPSSADLPMMPDDSQKCVNSLQDSLLSRNIRIPQPNATCDAILCFCGIRLH  162

Query  632  ---PLSCPEAFSMN  664
                L+C  AF+++
Sbjct  163  QITSLTCNAAFNVS  176



>gb|KEH37810.1| transmembrane protein, putative [Medicago truncatula]
Length=316

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 102/160 (64%), Gaps = 15/160 (9%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVL  415
            +PV   +  +  T+PAFP Q+ T  C LDL+ ELF G+K+ACG N     L R+RCCPVL
Sbjct  28   QPVEPGSYPSSNTVPAFPVQTQTQICKLDLSNELFGGVKAACGKN-----LDRSRCCPVL  82

Query  416  AAWLYSAYSTTALQ------RATSKIPRT-TTFDMPVLPDDSETCVDSLEKALGNKGIEL  574
            AAWL++A++ +AL+       A +  P T     +P++PDDS+ CV+SL+ +L ++ I +
Sbjct  83   AAWLFAAHARSALEITPDGAGANASAPSTGEQQQLPMMPDDSQKCVNSLQDSLMSRNIRI  142

Query  575  VKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGEXVG  685
             +PN TCD + C+CGIRLH    LSC  AF+++   + + 
Sbjct  143  PQPNATCDAILCFCGIRLHQISSLSCSAAFNVSGSHKNIA  182



>ref|XP_009390209.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=381

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 95/152 (63%), Gaps = 13/152 (9%)
 Frame = +2

Query  227  PDPEPVSFS-------TPSTPATIPAFPEQSNT--AACPLDLTEELFRGIKSACGSNDYS  379
            PDP+  S           S+P TIPA PEQS    AACPLD   +L   + +AC ++D  
Sbjct  80   PDPDTASIQLIAATATAASSPVTIPASPEQSGVSFAACPLDPPSDLLPSVSAACTASD-G  138

Query  380  GPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGN  559
            GP  R  CCP L AWL +AYS TAL  A   +P +T FD+P LPDDSETC+  +E+AL +
Sbjct  139  GPPSRYSCCPALKAWLLTAYSATAL--AAHPLP-STGFDLPALPDDSETCIGGVERALRH  195

Query  560  KGIELVKPNQTCDVVYCYCGIRLHPLSCPEAF  655
            +G+EL + N TCD  YCYCG+RL  L+C  AF
Sbjct  196  RGVELPRVNATCDAAYCYCGVRLRRLACAGAF  227



>ref|XP_006841867.1| hypothetical protein AMTR_s00003p00271650 [Amborella trichopoda]
 gb|ERN03542.1| hypothetical protein AMTR_s00003p00271650 [Amborella trichopoda]
Length=327

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (68%), Gaps = 11/137 (8%)
 Frame = +2

Query  272  TIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTA  451
            T+PA P QS    C LDL+ ELF G+K AC S   S  L R+RCCPVLAAWLY+A++ +A
Sbjct  44   TVPALPVQSQPHTCHLDLSAELFGGVKEACAS---SPSLDRSRCCPVLAAWLYAAHARSA  100

Query  452  LQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH  631
            L    S  P  +  ++P +PDDS+ CVD+L+ +L  + I + +PN+TCD V C+CGIRLH
Sbjct  101  L---VSHGPLDS--NLPAMPDDSQKCVDTLQTSLIKRDIRIPQPNETCDAVLCFCGIRLH  155

Query  632  ---PLSCPEAFSMNSHG  673
                LSCP+AF++ S G
Sbjct  156  QMSSLSCPKAFNLTSLG  172



>ref|XP_006592832.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Glycine max]
Length=305

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 102/149 (68%), Gaps = 12/149 (8%)
 Frame = +2

Query  242  VSFSTPST--PATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGP-LHRTRCCPV  412
            +S + P T    T+PA+P Q+ +  C LDL+ ELF G+ +ACG     GP L R+RCCPV
Sbjct  17   ISHTVPQTLDSNTVPAYPTQTQSQICRLDLSNELFGGVNAACGG----GPTLDRSRCCPV  72

Query  413  LAAWLYSAYSTTALQRATSKIPRTTTFDMPVLP-DDSETCVDSLEKALGNKGIELVKPNQ  589
            LAAWL++A++ TAL+ + +  P  +  D+P++P DDS+ CV+SL+ +L N+ I + +PN 
Sbjct  73   LAAWLFAAHARTALEVSAASSPPPSG-DLPMMPADDSQKCVNSLQDSLRNRSIRIPQPNA  131

Query  590  TCDVVYCYCGIRLH---PLSCPEAFSMNS  667
            TCD + C+CGIRLH    L+CP AF++ +
Sbjct  132  TCDAILCFCGIRLHHITSLTCPNAFNVTT  160



>ref|XP_009350468.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Pyrus x bretschneideri]
Length=337

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 100/164 (61%), Gaps = 17/164 (10%)
 Frame = +2

Query  209  IANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPL  388
            +A P    P+P+     S+P TIPA P Q+ T  C LDL+ ELF G+  ACG +     L
Sbjct  32   LAEPVTGHPQPLKPGEYSSPNTIPALPSQTQTQTCHLDLSAELFGGVSQACGRD-----L  86

Query  389  HRTRCCPVLAAWLYSAYSTTALQRATSKIP---------RTTTFDMPVLPDDSETCVDSL  541
             R+RCCPVLAAWL++A++ +AL+  +S                   P++PDDS+ CV+SL
Sbjct  87   DRSRCCPVLAAWLFAAHAGSALELPSSDTAPPAGARXXXXXXXXXQPMMPDDSQKCVNSL  146

Query  542  EKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN  664
            + +L ++ I + +PN +CD V C+CGIRLH    LSCP AF+++
Sbjct  147  QSSLVSRNIRIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNVS  190



>ref|XP_004507229.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cicer arietinum]
Length=316

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 94/136 (69%), Gaps = 8/136 (6%)
 Frame = +2

Query  272  TIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTA  451
            T+PAFP Q+    C LDL+ ELF G+ +ACG +     L R+RCCPVLAAWL++A++  A
Sbjct  47   TVPAFPVQTQAQICRLDLSNELFGGVNAACGKD-----LDRSRCCPVLAAWLFAAHARAA  101

Query  452  LQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH  631
            LQ + +    T+  ++P+ PDDS+ CV+SL+++L  + + + +PN TCD + C+CGIRLH
Sbjct  102  LQLSPNASTPTSNGELPMRPDDSQKCVNSLQESLLIRNVRIPQPNATCDAILCFCGIRLH  161

Query  632  ---PLSCPEAFSMNSH  670
                LSCP AF+++ +
Sbjct  162  QISSLSCPAAFNVSGN  177



>ref|XP_008800404.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
Length=341

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 100/159 (63%), Gaps = 11/159 (7%)
 Frame = +2

Query  200  PVSIANPDLPDPEPVSFSTPSTPATIPAFPE-QSNTAACPLDLTEELFRGIKSACGSNDY  376
            P  +++  LP P+P   S+ + P T+PAFP  Q+    C LDL++ELF G+  ACG    
Sbjct  29   PEVLSDEKLP-PDPGDLSS-THPNTVPAFPVVQTAKQTCHLDLSDELFGGVGEACGRT--  84

Query  377  SGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALG  556
               L R+RCCPVLAAWL++A++ +AL           T D P++PDD++ CVDSL+ +L 
Sbjct  85   ---LDRSRCCPVLAAWLFAAHARSALDVRPPPTATAATVDGPLMPDDNQKCVDSLQSSLA  141

Query  557  NKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN  664
             + I L +PN TCD V C+CGIRLH    L CP AF+++
Sbjct  142  RRDIHLPRPNATCDTVLCFCGIRLHQIGSLRCPAAFNVS  180



>ref|XP_010904780.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Elaeis guineensis]
Length=334

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 100/150 (67%), Gaps = 16/150 (11%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPE-QSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPV  412
            +P  FS+ + P T+PAFP  Q+    C LDL++ELF G+  ACG +     L R+RCCPV
Sbjct  40   DPGEFSS-AAPNTVPAFPVVQAENQTCRLDLSDELFGGVGEACGRS-----LDRSRCCPV  93

Query  413  LAAWLYSAYSTTALQRATSKIPRTTTFDM---PVLPDDSETCVDSLEKALGNKGIELVKP  583
            LAAWL++A++ +AL+    + P T T DM   P++PDD++ CVDSL+ +L  + I L +P
Sbjct  94   LAAWLFAAHARSALE---VRPPPTATADMADGPLMPDDNQKCVDSLQSSLERRDIRLPRP  150

Query  584  NQTCDVVYCYCGIRLH---PLSCPEAFSMN  664
            N TCD V C+CGIRLH    L CP AF+++
Sbjct  151  NATCDTVLCFCGIRLHQIGSLRCPAAFNVS  180



>ref|XP_004139964.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis sativus]
 ref|XP_004154532.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis sativus]
 gb|KGN46678.1| hypothetical protein Csa_6G121950 [Cucumis sativus]
Length=304

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 92/134 (69%), Gaps = 10/134 (7%)
 Frame = +2

Query  272  TIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTA  451
            ++PAFP ++   AC LDL++ELF G+  AC  N     L R+RCCPVLAAWL++A++ +A
Sbjct  30   SVPAFPVETENQACRLDLSDELFGGVSQACNGN-----LDRSRCCPVLAAWLFAAHARSA  84

Query  452  LQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH  631
            L+   S    +   D+P++PDDS+ CV+SL+ +L  + I + +PN +CD V C+CGIRLH
Sbjct  85   LE--VSAPAPSAEIDLPLMPDDSQKCVESLQSSLVRRNIRIPQPNSSCDAVLCFCGIRLH  142

Query  632  ---PLSCPEAFSMN  664
                LSCP AF+++
Sbjct  143  QISSLSCPAAFNLS  156



>ref|XP_008448226.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis melo]
Length=303

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 92/134 (69%), Gaps = 10/134 (7%)
 Frame = +2

Query  272  TIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTA  451
            ++PAFP ++   AC LDL++ELF G+  AC  N     L R+RCCPVLAAWL++A++ +A
Sbjct  30   SVPAFPVETENQACRLDLSDELFGGVSQACNGN-----LDRSRCCPVLAAWLFAAHARSA  84

Query  452  LQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH  631
            L+   S    +   D+P++PDDS+ CV+SL+ +L  + I + +PN +CD V C+CGIRLH
Sbjct  85   LE--VSAPAPSAEIDLPLMPDDSQKCVESLQSSLVRRNIRIPQPNSSCDAVLCFCGIRLH  142

Query  632  ---PLSCPEAFSMN  664
                LSCP AF+++
Sbjct  143  QISSLSCPAAFNLS  156



>ref|XP_007132620.1| hypothetical protein PHAVU_011G110300g [Phaseolus vulgaris]
 gb|ESW04614.1| hypothetical protein PHAVU_011G110300g [Phaseolus vulgaris]
Length=320

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 92/134 (69%), Gaps = 10/134 (7%)
 Frame = +2

Query  272  TIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTA  451
            T+PAFP Q+    C LDL+ ELF G+K ACG +     L R+RCCPVLAAWL++A++ +A
Sbjct  51   TVPAFPVQTQAQTCRLDLSNELFGGVKDACGKD-----LDRSRCCPVLAAWLFAAHARSA  105

Query  452  LQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH  631
            L+   S  P   + D+P++PDDS+ CV+SL+ +L  + I + +PN TCD + C+CGIRLH
Sbjct  106  LE--VSGAPPPASGDLPMMPDDSQKCVNSLQDSLLTRNIRIPQPNATCDAILCFCGIRLH  163

Query  632  ---PLSCPEAFSMN  664
                L+C  AF+++
Sbjct  164  QITSLTCNAAFNVS  177



>ref|XP_008455363.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis melo]
Length=322

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 100/150 (67%), Gaps = 10/150 (7%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVL  415
            +P++    S+P T+PAFP Q+    C LDL++ELF G++ ACG +     L R+RCCPVL
Sbjct  39   QPLNPGQYSSPNTVPAFPVQTQMQICHLDLSDELFGGVREACGRD-----LDRSRCCPVL  93

Query  416  AAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTC  595
            AAWL++A++  AL+ A          D+P++PDDS+ CV+SL+ +L ++ I + +PN +C
Sbjct  94   AAWLFAAHARAALKIAAPAP--AAAADLPMMPDDSQKCVNSLQTSLLSRNIRIPQPNASC  151

Query  596  DVVYCYCGIRLH---PLSCPEAFSMNSHGE  676
            D V C+CGIRLH    LSCP AF+++  G 
Sbjct  152  DAVLCFCGIRLHQISSLSCPAAFNVSGGGN  181



>ref|XP_008810973.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
Length=384

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = +2

Query  242  VSFSTPSTPATIPAFPEQSNTAA-CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLA  418
            +S ++  T AT+PAFPEQS TA  CPLDL   L  G+ +AC + +      R RCCP LA
Sbjct  86   LSINSSPTSATVPAFPEQSATAIPCPLDLPPALLHGVSAACSAPENPSLPSRPRCCPALA  145

Query  419  AWLYSAYSTTALQRATSKIPRTTTF---DMPVLPDDSETCVDSLEKALGNKGIELVKPNQ  589
            AWL+SA+ST  L  AT   P +++    D+P+LPDDSE+C  + E AL  +G+ L +PN 
Sbjct  146  AWLFSAHSTAGL--ATGPPPLSSSVSTPDLPILPDDSESCAAAAEAALRAQGVVLPRPND  203

Query  590  TCDVVYCYCGIRLHPLSCPEAFSMN-SHGEXV  682
            TCDV YCYCGIRL PL CP +F+ + S G  V
Sbjct  204  TCDVAYCYCGIRLGPLRCPGSFAASASEGRWV  235



>ref|XP_006849743.1| hypothetical protein AMTR_s00024p00248910 [Amborella trichopoda]
 gb|ERN11324.1| hypothetical protein AMTR_s00024p00248910 [Amborella trichopoda]
Length=324

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 86/132 (65%), Gaps = 5/132 (4%)
 Frame = +2

Query  269  ATIPAFPEQSNTAACPLDLTEELFRGIKSACGS-NDYSGPLHRTRCCPVLAAWLYSAYST  445
            + IPAFPEQS  ++CPLDL +++   I +ACGS        HR RCCPVLAA LY+A++ 
Sbjct  44   SAIPAFPEQSQISSCPLDLPDDISAIIATACGSITAQEDRHHRNRCCPVLAASLYAAHAR  103

Query  446  TALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIR  625
            T L  A    P     +MPVLPDDS TCVD  E  L  KG+E+  P+++CD V CYCGIR
Sbjct  104  TVLLGAEQAPPNEG--NMPVLPDDSRTCVDEFEGLLRAKGVEVKGPDESCDAVICYCGIR  161

Query  626  LH--PLSCPEAF  655
            LH  P SCPE F
Sbjct  162  LHNGPGSCPELF  173



>ref|XP_003526297.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Glycine max]
Length=318

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 93/134 (69%), Gaps = 10/134 (7%)
 Frame = +2

Query  272  TIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTA  451
            T+PAFP Q+    C LDL++ELF G+K ACG +     L R+RCCPVLAAWL++A++ TA
Sbjct  51   TVPAFPVQTQALTCRLDLSDELFGGVKDACGKD-----LDRSRCCPVLAAWLFAAHARTA  105

Query  452  LQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH  631
            L    S  P  ++ D+P++PDDS+ CV+SL+ +L ++ I + + N TCD + C+CGIRLH
Sbjct  106  LD--VSAAPPPSSGDLPMMPDDSQKCVNSLQDSLLSRNIRIPQSNATCDAILCFCGIRLH  163

Query  632  ---PLSCPEAFSMN  664
                L+C  AF+++
Sbjct  164  QITSLTCNAAFNVS  177



>ref|XP_008813347.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
Length=334

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 89/137 (65%), Gaps = 9/137 (7%)
 Frame = +2

Query  266  PATIPAFPE-QSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYS  442
            P T+PAFP  Q+    C LDL++ELF G+  ACG +     L R+RCCPVLAAWL++A++
Sbjct  49   PNTVPAFPVVQAENQTCRLDLSDELFGGVSEACGRS-----LDRSRCCPVLAAWLFAAHA  103

Query  443  TTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGI  622
             +AL+            D P++PDD++ CVDSL+ +L  + I L +PN TCD V C+CGI
Sbjct  104  RSALEVRPPPAATKGVADGPLMPDDNQKCVDSLQSSLEQRDIRLPRPNATCDTVLCFCGI  163

Query  623  RLH---PLSCPEAFSMN  664
            RLH    L CP AF+++
Sbjct  164  RLHQIGSLRCPAAFNVS  180



>gb|KJB50064.1| hypothetical protein B456_008G151300 [Gossypium raimondii]
Length=319

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 91/138 (66%), Gaps = 11/138 (8%)
 Frame = +2

Query  260  STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAY  439
            S+  T+PA P Q     C LDL+ ELF G+  ACG+N     L R+RCCPVLAAWL++A+
Sbjct  43   SSTDTVPAIPAQIQAQVCRLDLSAELFGGVNDACGNN-----LDRSRCCPVLAAWLFAAH  97

Query  440  STTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCG  619
            +  AL+ +    P     + P+ PDDS+ CV+SL+ AL +K +++ +PN +CD + C+CG
Sbjct  98   ARYALEVSA---PAPAGSEQPMRPDDSQKCVNSLQNALLSKRVQIPQPNASCDPILCFCG  154

Query  620  IRLH---PLSCPEAFSMN  664
            IRLH    LSCP AFS++
Sbjct  155  IRLHQISSLSCPAAFSVS  172



>ref|XP_008787927.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
Length=333

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 91/134 (68%), Gaps = 4/134 (3%)
 Frame = +2

Query  248  FSTPSTPATIPAFPEQSN--TAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAA  421
            F T S PATIPAFPEQS+  +AACPLDL ++L   + +AC ++       R+RCCP LAA
Sbjct  42   FPTSSPPATIPAFPEQSDVASAACPLDLPDDLLPAVSAACSTSSAGRLPSRSRCCPALAA  101

Query  422  WLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDV  601
            WLY+ YS TAL  A   +P   T D+PVLPDDSE CV  +E+AL ++G+ L + N TCD 
Sbjct  102  WLYAGYSATAL--AARPLPAPPTLDLPVLPDDSEACVGGVERALRDRGVRLPRVNGTCDA  159

Query  602  VYCYCGIRLHPLSC  643
             +C CGIRL  L+C
Sbjct  160  AFCCCGIRLRRLTC  173



>ref|XP_009418751.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=348

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 90/141 (64%), Gaps = 11/141 (8%)
 Frame = +2

Query  272  TIPAFP--EQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYST  445
            T+PAFP     N +AC LDL++ELF G+  AC      G L + RCCPVLAAWL++A++ 
Sbjct  46   TVPAFPVAGADNQSACHLDLSDELFGGVGEAC----VRGGLDQGRCCPVLAAWLFAAHAR  101

Query  446  TALQRAT--SKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCG  619
            +A++     +        D PV+PDD++ CVDSL+ AL  +GI L +PN TCD V C+CG
Sbjct  102  SAIEVRPPPAAEDGMDGADRPVMPDDNQKCVDSLQSALERRGIRLPRPNATCDTVLCFCG  161

Query  620  IRLH---PLSCPEAFSMNSHG  673
            IRLH    L CP AF+++  G
Sbjct  162  IRLHQIGSLRCPAAFNVSGVG  182



>gb|KHG17779.1| hypothetical protein F383_20781 [Gossypium arboreum]
Length=325

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 92/144 (64%), Gaps = 11/144 (8%)
 Frame = +2

Query  236  EPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVL  415
            +P+     S+  T+PA P Q     C LDL+ ELF G+  ACG+N     L R+RCCPVL
Sbjct  35   QPLKPGDYSSTDTVPAIPAQIQAQVCRLDLSAELFGGVNDACGNN-----LDRSRCCPVL  89

Query  416  AAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTC  595
            AAWL++A++  AL+ +    P     + P+ PDDS+ CV+SL+ AL +K +++ +PN +C
Sbjct  90   AAWLFAAHARYALEVSA---PAPAGSEQPMRPDDSQKCVNSLQNALLSKRVQIPQPNASC  146

Query  596  DVVYCYCGIRLH---PLSCPEAFS  658
            D + C+CGIRLH    LSCP AF+
Sbjct  147  DPILCFCGIRLHQISSLSCPAAFN  170



>ref|XP_009417269.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=348

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 89/138 (64%), Gaps = 11/138 (8%)
 Frame = +2

Query  272  TIPAFP--EQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYST  445
            T+PAFP     N +AC LDL++ELF G+  AC      G L R+RCCPVLAAWL++A++ 
Sbjct  49   TVPAFPLARTDNHSACRLDLSDELFGGVGDAC----VRGGLDRSRCCPVLAAWLFAAHAR  104

Query  446  TALQRAT--SKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCG  619
            +AL+     +        D P++PDD++ CVDSL+ AL  + I L +PN TCD V CYCG
Sbjct  105  SALEIRPPPAAEDGLGGADGPMMPDDNQKCVDSLQSALERRDIRLPRPNATCDTVLCYCG  164

Query  620  IRLH---PLSCPEAFSMN  664
            IRLH    L CP AF+++
Sbjct  165  IRLHQIGSLRCPTAFNVS  182



>ref|XP_009412443.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=345

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 89/138 (64%), Gaps = 11/138 (8%)
 Frame = +2

Query  272  TIPAFP--EQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYST  445
            T+PAFP    +N + C LDL++ELF G+  AC      G L R+RCCPVLAAWL++A++ 
Sbjct  49   TVPAFPVARSNNRSECRLDLSDELFGGVGDAC----IRGGLDRSRCCPVLAAWLFAAHAR  104

Query  446  TAL--QRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCG  619
            +AL  Q   +        D P++PDD++ CVDSL+ AL  + I L +PN TCD V C+CG
Sbjct  105  SALELQPPPATDDGLDGMDGPMMPDDNQKCVDSLQSALERRDIRLPRPNATCDTVLCFCG  164

Query  620  IRLH---PLSCPEAFSMN  664
            IRLH    L CP AF+++
Sbjct  165  IRLHQIGSLRCPAAFNVS  182



>dbj|BAJ91757.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 97/168 (58%), Gaps = 21/168 (13%)
 Frame = +2

Query  194  CIPVSIANPDLPDPEPVS-------FSTPSTP--ATIPAFPEQSN-----TAACPLDLTE  331
            C P   A   LPDP P+         +TP+ P  ATIPAFPEQS+     ++ CPLD + 
Sbjct  22   CSPAYCAIAALPDPAPLDPAGLFMPSATPAQPGSATIPAFPEQSDAVSGASSTCPLDPSP  81

Query  332  ELFRGIKSACGSNDYSGPL-HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVL  508
             L   + S+C   D  G L  R RCCP LAAWL++AY+ TAL    ++       DMPV 
Sbjct  82   RLLPAVVSSC---DADGALPSRLRCCPALAAWLFAAYAPTALAGRPARPVSAAPVDMPVP  138

Query  509  PDDSETCVDSLEKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSC  643
            PDDSE C  + ++AL ++G  L +P   N TCDV +CYCG+RL  L+C
Sbjct  139  PDDSEACAGAADRALRSEGAALPRPPGANGTCDVAFCYCGVRLRRLTC  186



>dbj|BAK05878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 97/168 (58%), Gaps = 21/168 (13%)
 Frame = +2

Query  194  CIPVSIANPDLPDPEPVS-------FSTPSTP--ATIPAFPEQSN-----TAACPLDLTE  331
            C P   A   LPDP P+         +TP+ P  ATIPAFPEQS+     ++ CPLD + 
Sbjct  22   CSPAYCAIAALPDPAPLDPAGLFMPSATPAQPGSATIPAFPEQSDAVSGASSTCPLDPSP  81

Query  332  ELFRGIKSACGSNDYSGPL-HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVL  508
             L   + S+C   D  G L  R RCCP LAAWL++AY+ TAL    ++       DMPV 
Sbjct  82   RLLPAVVSSC---DADGALPSRLRCCPALAAWLFAAYAPTALAGRPARPVSAAPVDMPVP  138

Query  509  PDDSETCVDSLEKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSC  643
            PDDSE C  + ++AL ++G  L +P   N TCDV +CYCG+RL  L+C
Sbjct  139  PDDSEACAGAADRALRSEGAALPRPPGANGTCDVAFCYCGVRLRRLTC  186



>ref|XP_009373629.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Pyrus x bretschneideri]
Length=227

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 8/129 (6%)
 Frame = +2

Query  293  QSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSK  472
            Q+ T  C LDL+ ELF G+  ACG N     L R+RCCPVLAAWL++A++ +AL+  +S 
Sbjct  25   QNPTQTCHLDLSAELFGGVSQACGRN-----LDRSRCCPVLAAWLFAAHARSALELPSSA  79

Query  473  IPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHP---LSC  643
               +   D P++PDDS+ CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    L C
Sbjct  80   PDPSAVPDQPMMPDDSQKCVNSLQSSLVSRNIRIPQPNASCDAVLCFCGIRLHQIGSLRC  139

Query  644  PEAFSMNSH  670
            P   + N H
Sbjct  140  PAFPTRNRH  148



>ref|XP_004953652.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Setaria italica]
Length=370

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 95/162 (59%), Gaps = 23/162 (14%)
 Frame = +2

Query  224  LPDPEPVS------FSTPSTPA------TIPAFPEQSNT-----AACPLDLTEELFRGIK  352
            LPDP P+        +TP  PA      TIPAFPEQS++     A CPL  +  L   ++
Sbjct  38   LPDPAPLDPALIFPSATPVQPAAAIAGGTIPAFPEQSDSLAGSSATCPLAPSPALIPAVR  97

Query  353  SACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTAL-QRATSK-IPRTTTFDMPVLPDDSET  526
            S+C ++D   P  R RCCP LAAWL++AY+ TAL QR  ++  P     DMP+ PDDSE 
Sbjct  98   SSCDADDGKLP-PRLRCCPALAAWLFAAYAPTALSQRPPARSTPAAAAVDMPLPPDDSEA  156

Query  527  CVDSLEKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSC  643
            C  + ++AL   G  L +P   N TCDV +CYCG+RL  L+C
Sbjct  157  CAGAADRALRAGGASLPRPPGGNGTCDVAFCYCGVRLRRLAC  198



>ref|XP_009403933.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=338

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 102/168 (61%), Gaps = 20/168 (12%)
 Frame = +2

Query  212  ANPDLPDPEPVSFS-TPSTPA-------------TIPAFPEQSN--TAACPLDLTEELFR  343
            A P LP+P+  S    PST +             TIPAFPEQS+  TAACPLD   +L  
Sbjct  24   AQPALPEPDAASIQLIPSTSSAAAGGASSSSPPATIPAFPEQSDVSTAACPLDPPSDLLP  83

Query  344  GIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSE  523
             + +AC ++D S P  R+RCCP L AWL +AYS +A     +  P ++ +D+P LPDDSE
Sbjct  84   SVSAACVASDDSLP-SRSRCCPTLNAWLLAAYSASA---LAAHPPPSSGYDLPALPDDSE  139

Query  524  TCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNS  667
             C+  +E+AL + G++L + N TCD  YCYCG+RL  L+C  AF  ++
Sbjct  140  ACIGGVERALRDHGVDLPRVNGTCDAAYCYCGVRLRRLACAGAFVADA  187



>ref|XP_009380337.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=340

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 106/170 (62%), Gaps = 22/170 (13%)
 Frame = +2

Query  212  ANPDLPDPEPVSFS----------------TPSTPATIPAFPEQS--NTAACPLDLTEEL  337
            A P LP+PEP S                  + S PATIPAFPEQS  +TAACPLD   +L
Sbjct  24   AQPVLPEPEPASIQLIPSTSAAAAGGASASSFSPPATIPAFPEQSEVSTAACPLDPPTDL  83

Query  338  FRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDD  517
               + +AC ++D S P  R+RCCP L AWL +AYS +AL  A   +P +  +D+P LPDD
Sbjct  84   LSSVSAACAASDGSFPT-RSRCCPTLNAWLLAAYSASAL--AARPLP-SAGYDLPTLPDD  139

Query  518  SETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNS  667
            SE+C+  +E+AL ++G+EL + N TCD  YC+CG+RL  L+C  AF  N+
Sbjct  140  SESCIGGVERALRDRGVELPRVNGTCDAAYCFCGVRLRRLACAGAFVANA  189



>ref|XP_009410258.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009410268.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 98/158 (62%), Gaps = 17/158 (11%)
 Frame = +2

Query  224  LPDPEPV--------SFSTPSTPATIPAFPEQSNTAA--CPLDLTEELFRGIKSACGSND  373
            +PDP PV        + S+    ATIPAFPEQS+ A+  CPLDL  +L   + +AC S  
Sbjct  29   VPDPAPVQVHPATSTAVSSSLPAATIPAFPEQSDVASATCPLDLPSDLLPSVTAACSSPS  88

Query  374  YSGPL----HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSL  541
             SG       R+RCCP LAAWLY+AYS +AL  A   +P +  +D+P LPDDSE+C   +
Sbjct  89   ASGSHLRLPSRSRCCPALAAWLYAAYSPSAL--AARPLP-SAGYDLPALPDDSESCAAGV  145

Query  542  EKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAF  655
            E+A+ ++G+ L + N TCD  YCYCG+RL  L+C   F
Sbjct  146  ERAMRDRGVALPRANATCDTAYCYCGVRLRRLACAGGF  183



>tpg|DAA63100.1| TPA: hypothetical protein ZEAMMB73_460549 [Zea mays]
Length=338

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 76/123 (62%), Gaps = 11/123 (9%)
 Frame = +2

Query  311  CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT  490
            C LDL+ ELF G+ +ACG++   G L R RCCPVLAAWL++A++ TAL    +  P    
Sbjct  48   CHLDLSAELFGGVAAACGASGGPGSLDRGRCCPVLAAWLFAAHARTALSVPPAPAPSAVA  107

Query  491  F--------DMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PL  637
                     D P++P D++ CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L
Sbjct  108  GEEGLGPGDDGPMVPYDNQRCVDALGAALEKRGVALPRPNATCDTVLCFCGIRLHQIGSL  167

Query  638  SCP  646
             CP
Sbjct  168  RCP  170



>ref|XP_008653219.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Zea mays]
Length=443

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 76/123 (62%), Gaps = 11/123 (9%)
 Frame = +2

Query  311  CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT  490
            C LDL+ ELF G+ +ACG++   G L R RCCPVLAAWL++A++ TAL    +  P    
Sbjct  153  CHLDLSAELFGGVAAACGASGGPGSLDRGRCCPVLAAWLFAAHARTALSVPPAPAPSAVA  212

Query  491  F--------DMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PL  637
                     D P++P D++ CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L
Sbjct  213  GEEGLGPGDDGPMVPYDNQRCVDALGAALEKRGVALPRPNATCDTVLCFCGIRLHQIGSL  272

Query  638  SCP  646
             CP
Sbjct  273  RCP  275



>gb|EAY87253.1| hypothetical protein OsI_08655 [Oryza sativa Indica Group]
Length=351

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 92/157 (59%), Gaps = 19/157 (12%)
 Frame = +2

Query  224  LPDPEPVS------FSTPSTP--ATIPAFPEQSNTAA-----CPLDLTEELFRGIKSACG  364
            LPDP P+        +TP+ P  ATIPAFPEQS+ A+     CPL  +  L   + S+C 
Sbjct  30   LPDPAPLDPALIFPSATPAQPGSATIPAFPEQSDAASGTSSTCPLTPSPSLLPAVTSSC-  88

Query  365  SNDYSGPL-HRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSL  541
              D  G L  R RCCP LAAWL++AY+  AL +  +K       DMPV PDDSE C  + 
Sbjct  89   -VDGGGALTSRLRCCPPLAAWLFAAYAPAALAQRPAKSAAAAAVDMPVPPDDSEACAGAA  147

Query  542  EKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSC  643
            ++AL  +G  L +P   N TCDV +CYCG+RL  L+C
Sbjct  148  DRALRAEGAALPRPPGANGTCDVAFCYCGVRLRRLTC  184



>ref|NP_001047896.1| Os02g0710700 [Oryza sativa Japonica Group]
 dbj|BAD07493.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD07775.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF09810.1| Os02g0710700 [Oryza sativa Japonica Group]
Length=351

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 92/157 (59%), Gaps = 19/157 (12%)
 Frame = +2

Query  224  LPDPEPVS------FSTPSTP--ATIPAFPEQSNTAA-----CPLDLTEELFRGIKSACG  364
            LPDP P+        +TP+ P  ATIPAFPEQS+ A+     CPL  +  L   + S+C 
Sbjct  30   LPDPAPLDPALIFPSATPAQPGSATIPAFPEQSDAASGTSSTCPLTPSPSLLPAVTSSC-  88

Query  365  SNDYSGPLH-RTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSL  541
              D  G L  R RCCP LAAWL++AY+  AL +  +K       DMPV PDDSE C  + 
Sbjct  89   -VDGGGALTTRLRCCPPLAAWLFAAYAPAALAQRPAKSAAAAAVDMPVPPDDSEACAGAA  147

Query  542  EKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSC  643
            ++AL  +G  L +P   N TCDV +CYCG+RL  L+C
Sbjct  148  DRALRAEGAALPRPPGANGTCDVAFCYCGVRLRRLTC  184



>gb|AFW73063.1| hypothetical protein ZEAMMB73_382585 [Zea mays]
Length=367

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 100/175 (57%), Gaps = 26/175 (15%)
 Frame = +2

Query  194  CIPVS-IANPDLPDPEPV--SFSTPSTPA-----------TIPAFPEQSNT-----AACP  316
            C P+   A   LPDP P+  +   PS  +           TIPAFPEQS++     +ACP
Sbjct  25   CAPIQRTAAATLPDPAPLDPALILPSATSVQPTATTIPGGTIPAFPEQSDSLAGSSSACP  84

Query  317  LDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTAL-QRATSKIPRTTTF  493
            L  +  L   ++S+C ++D + P  R RCCP LAAWL++AY+ TAL +R  +      T 
Sbjct  85   LAPSPALLPAVRSSCATDDGALP-PRLRCCPALAAWLFAAYAPTALAERPPAAAAAAATV  143

Query  494  DMPVLPDDSETCVDSLEKALGNKGIELVKP-----NQTCDVVYCYCGIRLHPLSC  643
            DMP+ PDDSETC  + ++AL   G  L +P     N TCDV +CYCG+RL  L+C
Sbjct  144  DMPLPPDDSETCAGAADRALRAAGAALPRPPGAGGNGTCDVAFCYCGVRLRRLAC  198



>ref|XP_003570217.2| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Brachypodium distachyon]
Length=394

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 87/144 (60%), Gaps = 16/144 (11%)
 Frame = +2

Query  251  STPSTP--ATIPAFPEQSNTAA------CPLDLTEELFRGIKSACGSNDYSGPL-HRTRC  403
            +TP+ P  ATIPAFPEQS+ AA      CPL  +  L   + S+C   D  G L  R RC
Sbjct  100  ATPAQPGAATIPAFPEQSDAAAGGASSTCPLAPSPWLLPAVLSSC---DADGALPARLRC  156

Query  404  CPVLAAWLYSAYSTTALQRATSKIPRTTT-FDMPVLPDDSETCVDSLEKALGNKGIELVK  580
            CP LAAWL++AY+  AL     K P +    DMPV PDDSE C  + E+AL ++G  L +
Sbjct  157  CPALAAWLFAAYAPVALAAKPVKPPPSAAPVDMPVPPDDSEACAGAAERALRSEGAALPR  216

Query  581  P---NQTCDVVYCYCGIRLHPLSC  643
            P   N TCDV +CYCG+RL  L+C
Sbjct  217  PPGANGTCDVAFCYCGVRLRRLTC  240



>ref|NP_001144450.1| uncharacterized protein LOC100277413 precursor [Zea mays]
 gb|ACG40625.1| hypothetical protein [Zea mays]
Length=364

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 98/174 (56%), Gaps = 26/174 (15%)
 Frame = +2

Query  194  CIPVS-IANPDLPDPEPV--SFSTPSTPA-----------TIPAFPEQSNT-----AACP  316
            C P+   A   LPDP P+  +   PS  +           TIPAFPEQS++     +ACP
Sbjct  25   CAPIQRTAAATLPDPAPLDPALILPSATSVQPTATTIPGGTIPAFPEQSDSLAGSSSACP  84

Query  317  LDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFD  496
            L  +  L   ++S+C ++D + P  R RCCP LAAWL++AY+ TAL           T D
Sbjct  85   LAPSPVLLPAVRSSCATDDGALP-PRLRCCPALAAWLFAAYAPTALAERPPAA-AAATVD  142

Query  497  MPVLPDDSETCVDSLEKALGNKGIELVKP-----NQTCDVVYCYCGIRLHPLSC  643
            MP+ PDDSETC  ++++AL   G  L +P     N TCDV +CYCG+RL  L+C
Sbjct  143  MPLPPDDSETCAGAVDRALRAAGAALPRPPGAGGNGTCDVAFCYCGVRLRRLAC  196



>ref|XP_003560098.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Brachypodium 
distachyon]
Length=342

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 90/157 (57%), Gaps = 16/157 (10%)
 Frame = +2

Query  230  DPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCP  409
            D   V  +   +PA   A P   ++  C LDL+ ELF G+ +ACG+    G L R RCCP
Sbjct  23   DVSSVPLTQAQSPANTSAGP---SSPPCRLDLSAELFGGVAAACGAGGGPGSLDRGRCCP  79

Query  410  VLAAWLYSAYSTTALQ----------RATSKIPRTTTFDMPVLPDDSETCVDSLEKALGN  559
            VLAAWL++A++ TAL           +    +      + P++P D++ CVDSL  AL  
Sbjct  80   VLAAWLFAAHARTALSVPAPAPALAGQEGLGLGLGGGEEGPMVPYDNQRCVDSLGAALEK  139

Query  560  KGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSM  661
            +G+ + +PN TCD+V C+CGIRLH    L CP AF++
Sbjct  140  RGVAMPRPNATCDMVLCFCGIRLHQIGSLRCPAAFAV  176



>ref|XP_004958008.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Setaria italica]
Length=338

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 76/123 (62%), Gaps = 11/123 (9%)
 Frame = +2

Query  311  CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT  490
            C LDL+ ELF G+ +ACG+    G L R RCCPVLAAWL++A++ TAL    +  P   +
Sbjct  50   CHLDLSAELFGGVAAACGAGGGPGSLDRGRCCPVLAAWLFAAHARTALSVPPAPAPSALS  109

Query  491  F--------DMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PL  637
                     D P++P D++ CVD+L  AL  +G+ L  PN+TCD V C+CGIRLH    L
Sbjct  110  GEEGLGPGDDGPMVPYDNQRCVDALGAALEKRGVALPSPNRTCDTVLCFCGIRLHQIGSL  169

Query  638  SCP  646
             CP
Sbjct  170  RCP  172



>ref|NP_001059970.1| Os07g0557700 [Oryza sativa Japonica Group]
 dbj|BAC84026.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21884.1| Os07g0557700 [Oryza sativa Japonica Group]
Length=335

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 83/144 (58%), Gaps = 13/144 (9%)
 Frame = +2

Query  254  TPSTPATIPAFPEQSNTAA-----CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLA  418
             PS P +    P  +++       C LDL+ ELF G+ +ACG+    G L R RCCPVLA
Sbjct  23   VPSYPLSQAQSPANTSSGGSTSPPCHLDLSAELFGGVAAACGAGGGPGSLDRGRCCPVLA  82

Query  419  AWLYSAYSTTALQR-----ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKP  583
            AWL++A++ TAL       A +        D P++P D++ CVD+L  AL  +G+ L +P
Sbjct  83   AWLFAAHARTALSVPAPAPALAGEGLDGGEDEPMVPYDNQRCVDALGSALERRGVALPRP  142

Query  584  NQTCDVVYCYCGIRLH---PLSCP  646
            N TCD V C+CGIRLH    L CP
Sbjct  143  NATCDTVLCFCGIRLHQIGSLRCP  166



>gb|EAZ04317.1| hypothetical protein OsI_26458 [Oryza sativa Indica Group]
Length=335

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 8/120 (7%)
 Frame = +2

Query  311  CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQR-----ATSKI  475
            C LDL+ ELF G+ +ACG+    G L R RCCPVLAAWL++A++ TAL       A +  
Sbjct  47   CHLDLSAELFGGVAAACGAGGGPGSLDRGRCCPVLAAWLFAAHARTALSVPAPAPALAGE  106

Query  476  PRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCP  646
                  D P++P D++ CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP
Sbjct  107  GLDGREDEPMVPYDNQRCVDALGSALERRGVALPRPNATCDTVLCFCGIRLHQIGSLRCP  166



>ref|XP_002987778.1| hypothetical protein SELMODRAFT_183423 [Selaginella moellendorffii]
 gb|EFJ11081.1| hypothetical protein SELMODRAFT_183423 [Selaginella moellendorffii]
Length=356

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 78/140 (56%), Gaps = 12/140 (9%)
 Frame = +2

Query  269  ATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTT  448
             T+P+ P +    AC L      F G++SAC    +S  L R+RCCPVLA+WL++A + T
Sbjct  48   GTVPSLPVEWQAMACDLHFAGISFGGLRSACEKKHHSQDL-RSRCCPVLASWLFAAQAET  106

Query  449  ALQRATSKIPRTTT--------FDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVV  604
             ++   +    +++         +MPV PDDS  C  SL++   ++GI+L   N +CD+ 
Sbjct  107  TMRAIAAAAATSSSSSSSPSPQVEMPVPPDDSAVCAASLQQGFHSRGIDLPLLNASCDMS  166

Query  605  YCYCGIRLH---PLSCPEAF  655
             CYCGIRL     L+CP  +
Sbjct  167  LCYCGIRLRQMASLNCPVGY  186



>ref|XP_002993750.1| hypothetical protein SELMODRAFT_431796 [Selaginella moellendorffii]
 gb|EFJ05169.1| hypothetical protein SELMODRAFT_431796 [Selaginella moellendorffii]
Length=353

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 78/140 (56%), Gaps = 12/140 (9%)
 Frame = +2

Query  269  ATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTT  448
             T+P+ P +    AC L      F G++SAC    +S  L R+RCCPVLA+WL++A + T
Sbjct  48   GTVPSLPVEWQAMACDLHFAGISFGGLRSACEKKHHSQDL-RSRCCPVLASWLFAAQAET  106

Query  449  ALQRATSKIPRTTT--------FDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVV  604
             ++   +    +++         +MPV PDDS  C  SL++   ++GI+L   N +CD+ 
Sbjct  107  TMRAIAAAAATSSSSSSSPSPQVEMPVPPDDSAVCAASLQQGFHSRGIDLPLLNASCDMS  166

Query  605  YCYCGIRLH---PLSCPEAF  655
             CYCGIRL     L+CP  +
Sbjct  167  LCYCGIRLRQMASLNCPVGY  186



>ref|XP_004965364.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Setaria italica]
Length=353

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 98/193 (51%), Gaps = 43/193 (22%)
 Frame = +2

Query  197  IPVSIANPDLPDP---EP----------VSFSTPSTPA---TIPAFPEQSNTAA----CP  316
            +P+  A+P LPDP   EP           S + P +PA   TIPAFPEQS  AA    C 
Sbjct  21   LPLPAASPALPDPASLEPSLLFPSAGGGASQTQPQSPAGGSTIPAFPEQSEAAATTSVCQ  80

Query  317  LDLTEELFRGIKSACGSN-DYSGPLH--RTRCCPVLAAWLYSAYSTTALQRATSKIPRT-  484
            L  +  L   + ++C +N   SG +   R RCCP LAAW+Y+AY+ TAL    ++ P + 
Sbjct  81   LTPSPPLLPAVLASCNANAGGSGGVLPPRLRCCPALAAWMYAAYAPTALSGRGAREPSSV  140

Query  485  -------TTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQ------------TCDVVY  607
                      DMPVLPDD+E C  + ++AL   G  L +P Q             CDV +
Sbjct  141  AAAAEAAAVVDMPVLPDDAEECAGAADRALRAAGAALPRPQQGGGSTGAGNGTAACDVEF  200

Query  608  CYCGIRLHPLSCP  646
            CYCG+RL    CP
Sbjct  201  CYCGVRLRRPVCP  213



>ref|XP_010936812.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Elaeis guineensis]
Length=329

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 95/150 (63%), Gaps = 10/150 (7%)
 Frame = +2

Query  218  PDLPDPEPVS------FSTPSTPATIPAFPEQSNTA--ACPLDLTEELFRGIKSACGSND  373
            P LPDP+P +      F T S PATIPAFPEQS+ A  ACPLDL ++L   + +AC ++ 
Sbjct  23   PVLPDPDPAAIQPSLIFPTSSPPATIPAFPEQSDVAGAACPLDLPDDLLPAVSAACSASA  82

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKAL  553
                  R+RCCP LAAWLY+AYS TAL             D+P+LPDDSE C+  +E+AL
Sbjct  83   AGRLASRSRCCPALAAWLYAAYSATALAARPMPA--PPALDLPILPDDSEACIGGVERAL  140

Query  554  GNKGIELVKPNQTCDVVYCYCGIRLHPLSC  643
             ++G+ L   N TCD  YCYCGIRL  L+C
Sbjct  141  RDRGVRLPSVNGTCDAAYCYCGIRLRRLTC  170



>ref|NP_001142782.1| uncharacterized protein LOC100275144 [Zea mays]
 gb|ACG26591.1| hypothetical protein [Zea mays]
Length=352

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 83/173 (48%), Gaps = 27/173 (16%)
 Frame = +2

Query  206  SIANPDLPDPEPVSFSTPSTPATIPAFPEQSN------TAACPLDLTEELFRGIKSACGS  367
            S+  P      P    +    +TIPAFPEQS       T+ C L  +  L   + ++C +
Sbjct  40   SLLFPSAGATSPTQTQSAGVASTIPAFPEQSEAAAAAATSVCQLTPSPPLLPAVLASCNA  99

Query  368  NDYSGPLH---RTRCCPVLAAWLYSAYSTTALQRA-------TSKIPRTTTFDMPVLPDD  517
            N     +    R RCCP LAAWLY+AY+ TAL  +        +        D+PVLPDD
Sbjct  100  NAGGSGVTLPPRLRCCPALAAWLYTAYAPTALSGSGVGESSVAASAEAAAVVDLPVLPDD  159

Query  518  SETCVDSLEKALGNKGIELVKPN-----------QTCDVVYCYCGIRLHPLSC  643
            +E C  + ++AL   G+ L +P+             CDV +CYCG+RL   +C
Sbjct  160  AEECAGAADRALRAAGVALPRPHWGESTGTGNGTAACDVAFCYCGVRLRRPAC  212



>gb|AFW86539.1| hypothetical protein ZEAMMB73_536074 [Zea mays]
Length=352

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 80/162 (49%), Gaps = 27/162 (17%)
 Frame = +2

Query  239  PVSFSTPSTPATIPAFPEQSN------TAACPLDLTEELFRGIKSACGSNDYSGPLH---  391
            P    +    +TIPAFPEQS       T+ C L  +  L   + ++C +N     +    
Sbjct  51   PTQTQSAGVASTIPAFPEQSEAAAAAATSVCQLTPSPPLLPAVLASCNANAGGSGVTLPP  110

Query  392  RTRCCPVLAAWLYSAYSTTALQRA-------TSKIPRTTTFDMPVLPDDSETCVDSLEKA  550
            R RCCP LAAWLY+AY+ TAL  +        +        D+PVLPDD+E C  + ++A
Sbjct  111  RLRCCPALAAWLYTAYAPTALSGSGVGEASVAASAEAAAVVDLPVLPDDAEECAGAADRA  170

Query  551  LGNKGIELVKPN-----------QTCDVVYCYCGIRLHPLSC  643
            L   G+ L +P+             CDV +CYCG+RL   +C
Sbjct  171  LRAAGVALPRPHWGESTGTGNGTAACDVAFCYCGVRLRRPAC  212



>tpg|DAA35957.1| TPA: hypothetical protein ZEAMMB73_447066 [Zea mays]
Length=222

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 78/132 (59%), Gaps = 13/132 (10%)
 Frame = +2

Query  311  CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTT----------ALQR  460
            C LDL+ ELF G+ +ACG+    G L R RCCPVLAAWL++A++ T          +   
Sbjct  49   CHLDLSAELFGGVAAACGAGGGPGSLDRGRCCPVLAAWLFAAHARTALSVPPAPPPSALV  108

Query  461  ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---  631
                +      D P++P D++ CVD+L  AL  +G+ L +PN TCD V C+CGIRLH   
Sbjct  109  GDEGMGPDGDDDGPMVPYDNQRCVDTLGAALERRGVALPRPNATCDTVLCFCGIRLHQIG  168

Query  632  PLSCPEAFSMNS  667
             L CP AF++ +
Sbjct  169  SLRCPAAFAVKT  180



>tpg|DAA35956.1| TPA: hypothetical protein ZEAMMB73_447066 [Zea mays]
Length=331

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 78/132 (59%), Gaps = 13/132 (10%)
 Frame = +2

Query  311  CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTT----------ALQR  460
            C LDL+ ELF G+ +ACG+    G L R RCCPVLAAWL++A++ T          +   
Sbjct  49   CHLDLSAELFGGVAAACGAGGGPGSLDRGRCCPVLAAWLFAAHARTALSVPPAPPPSALV  108

Query  461  ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---  631
                +      D P++P D++ CVD+L  AL  +G+ L +PN TCD V C+CGIRLH   
Sbjct  109  GDEGMGPDGDDDGPMVPYDNQRCVDTLGAALERRGVALPRPNATCDTVLCFCGIRLHQIG  168

Query  632  PLSCPEAFSMNS  667
             L CP AF++ +
Sbjct  169  SLRCPAAFAVKT  180



>ref|XP_002463014.1| hypothetical protein SORBIDRAFT_02g036230 [Sorghum bicolor]
 gb|EER99535.1| hypothetical protein SORBIDRAFT_02g036230 [Sorghum bicolor]
Length=343

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 75/124 (60%), Gaps = 12/124 (10%)
 Frame = +2

Query  311  CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQ---------RA  463
            C LDL+ ELF G+ +ACG+    G L R RCCPVLAAWL++A++ TAL           A
Sbjct  49   CHLDLSAELFGGVAAACGAGGGPGSLDRGRCCPVLAAWLFAAHARTALSVPPAPAPSALA  108

Query  464  TSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---P  634
              +       D P++P D++ CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    
Sbjct  109  GEEGLGPGGDDGPMVPYDNQRCVDALGAALEKRGVALPRPNATCDTVLCFCGIRLHQIGS  168

Query  635  LSCP  646
            L CP
Sbjct  169  LRCP  172



>ref|NP_001144341.1| uncharacterized protein LOC100277244 precursor [Zea mays]
 gb|ACG39687.1| hypothetical protein [Zea mays]
Length=352

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 86/160 (54%), Gaps = 23/160 (14%)
 Frame = +2

Query  227  PDPEPVS---FSTPSTPA------TIPAFPEQSNTAA-----CPLDLTEELFRGIKSACG  364
            PDP P+     +TP  PA      TIPAFP QS++ A     CPL  +  L   ++++C 
Sbjct  32   PDPAPLDPALVATPVQPAAXVPGGTIPAFPAQSDSLAGSSSTCPLAPSPALLPAVRASCA  91

Query  365  SNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT---FDMPVLPDDSETCVD  535
            +     P  R RCCP LAAWL++AY+  AL       P        DMP+ PDDSE C  
Sbjct  92   AAAALPP--RLRCCPALAAWLFAAYAPAALAERPPARPPAAAAAAVDMPLPPDDSEACAG  149

Query  536  SLEKALGNKGIELVKP----NQTCDVVYCYCGIRLHPLSC  643
            + ++AL   G  L +P    N TCDV +CYCG+RL  L+C
Sbjct  150  AADRALRAAGATLPRPTGGNNGTCDVAFCYCGVRLRRLTC  189



>ref|XP_009400645.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=304

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 81/148 (55%), Gaps = 8/148 (5%)
 Frame = +2

Query  245  SFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACG-----SNDYSGPLHRTRCCP  409
            S +T   PAT+PA PE S +AACPLD+ ++L   I +AC      S+ +S     +RCCP
Sbjct  20   SAATDPHPATVPASPEWS-SAACPLDIPDDLLHDIATACSPVDSGSDSHSHSATLSRCCP  78

Query  410  VLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQ  589
             LAA      +  A   A           +P  PDDSE C  + E AL  +G+ L +PN+
Sbjct  79   SLAA--SLHAAHAAAALAVLSPASNNGIAVPDPPDDSEGCASAAEVALRARGVLLPRPNE  136

Query  590  TCDVVYCYCGIRLHPLSCPEAFSMNSHG  673
            TCD+ YCYCG+RL  L CP  F  ++ G
Sbjct  137  TCDLTYCYCGVRLRRLHCPGPFVASAAG  164



>ref|XP_008677003.1| PREDICTED: uncharacterized protein LOC100277244 isoform X1 [Zea 
mays]
 gb|AFW63581.1| hypothetical protein ZEAMMB73_212242 [Zea mays]
Length=361

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 86/160 (54%), Gaps = 23/160 (14%)
 Frame = +2

Query  227  PDPEPVS---FSTPSTPA------TIPAFPEQSNTAA-----CPLDLTEELFRGIKSACG  364
            PDP P+     +TP  PA      TIPAFP QS++ A     CPL  +  L   ++++C 
Sbjct  32   PDPAPLDPALVATPVQPAAAVPGGTIPAFPAQSDSLAGSSSTCPLAPSPALLPAVRASCA  91

Query  365  SNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTT---FDMPVLPDDSETCVD  535
            +     P  R RCCP LAAWL++AY+  AL       P        DMP+ PDDSE C  
Sbjct  92   AAAALPP--RLRCCPALAAWLFAAYAPAALAERPPARPPAAAAAAVDMPLPPDDSEACAG  149

Query  536  SLEKALGNKGIELVKP----NQTCDVVYCYCGIRLHPLSC  643
            + ++AL   G  L +P    N TCDV +CYCG+RL  L+C
Sbjct  150  AADRALRAAGATLPRPTGGNNGTCDVAFCYCGVRLRRLTC  189



>ref|XP_008670488.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
isoform X2 [Zea mays]
Length=301

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 73/125 (58%), Gaps = 13/125 (10%)
 Frame = +2

Query  311  CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTT----------ALQR  460
            C LDL+ ELF G+ +ACG+    G L R RCCPVLAAWL++A++ T          +   
Sbjct  49   CHLDLSAELFGGVAAACGAGGGPGSLDRGRCCPVLAAWLFAAHARTALSVPPAPPPSALA  108

Query  461  ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHP--  634
                +      D P++P D++ CVD+L  AL  +G+ L +PN TCD V C+CGIRLH   
Sbjct  109  GDEGMGPDGGDDGPMVPYDNQRCVDALGAALERRGVALPRPNATCDTVLCFCGIRLHQIG  168

Query  635  -LSCP  646
             L CP
Sbjct  169  SLRCP  173



>ref|XP_008670487.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
isoform X1 [Zea mays]
 tpg|DAA41110.1| TPA: hypothetical protein ZEAMMB73_853726 [Zea mays]
Length=345

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 73/125 (58%), Gaps = 13/125 (10%)
 Frame = +2

Query  311  CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTT----------ALQR  460
            C LDL+ ELF G+ +ACG+    G L R RCCPVLAAWL++A++ T          +   
Sbjct  49   CHLDLSAELFGGVAAACGAGGGPGSLDRGRCCPVLAAWLFAAHARTALSVPPAPPPSALA  108

Query  461  ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---  631
                +      D P++P D++ CVD+L  AL  +G+ L +PN TCD V C+CGIRLH   
Sbjct  109  GDEGMGPDGGDDGPMVPYDNQRCVDALGAALERRGVALPRPNATCDTVLCFCGIRLHQIG  168

Query  632  PLSCP  646
             L CP
Sbjct  169  SLRCP  173



>ref|XP_010911481.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Elaeis guineensis]
Length=144

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 71/145 (49%), Gaps = 10/145 (7%)
 Frame = +2

Query  218  PDLPDPEPVS------FSTPSTPATIPAFPEQSNTA--ACPLDLTEELFRGIKSACGSND  373
            P LPDP+P +      F T S P     FPEQ N A  ACPLDL  +L   + +A  ++ 
Sbjct  2    PVLPDPDPAAVQPSRPFPTSSPPTATSMFPEQFNIAGTACPLDLPNDLLPIVFAAYFASS  61

Query  374  YSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKAL  553
                  ++RCC  L  WLY  Y  TA   A   +P   T ++PVL D+ + C+  ++  L
Sbjct  62   TDRLSSQSRCCLTLVTWLYVGYFATAF--AAYPLPIPLTLNLPVLSDNFKACISGIKHTL  119

Query  554  GNKGIELVKPNQTCDVVYCYCGIRL  628
             ++ I L   N   D VY +  I L
Sbjct  120  HDRSICLSHVNGMHDAVYYFYDIHL  144



>dbj|BAJ99254.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03861.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 90/169 (53%), Gaps = 27/169 (16%)
 Frame = +2

Query  206  SIANPDLPDPEPV--SFSTPSTPA---------TIPAFPEQSNTAA----CPLDLTEELF  340
            ++A+P LPDP  +  S   PS  A         TIPAFPEQS  AA    C L  +  L 
Sbjct  21   AMASPALPDPASLEPSLLFPSAGASQAQPAAASTIPAFPEQSEAAATSSVCQLTPSPPLL  80

Query  341  RGIKSACGSNDYSGPLH--RTRCCPVLAAWLYSAYSTTAL---QRATSKIPRTT--TFDM  499
              + ++C +  + G +   R RCCP LAAWLY+AY+ T+L       SK+P       D+
Sbjct  81   PAVLASCNAAGHGGGVLPPRLRCCPALAAWLYAAYAPTSLGSDGSRWSKLPAAAADVTDL  140

Query  500  PVLPDDSETCVDSLEKALGNKGIELVKPNQ-----TCDVVYCYCGIRLH  631
            P+LPDD E C  + E+AL + G  L +        TCDV +CYCGIRL 
Sbjct  141  PLLPDDVEECAGAAERALRSAGATLPQTQAGSNGTTCDVPFCYCGIRLR  189



>gb|KHN00049.1| hypothetical protein glysoja_035611 [Glycine soja]
Length=214

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +2

Query  275  IPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSG--PLHRTRCCPVLAAWLYSAYSTT  448
            +  FPEQ   + CPL L++ELF GIKSACG         LH TR CPVL AWLYS YS T
Sbjct  1    MATFPEQFKVSRCPLTLSDELFDGIKSACGGAKSGADMELHHTRWCPVLTAWLYSTYSAT  60

Query  449  AL  454
             L
Sbjct  61   TL  62



>gb|KGN63863.1| hypothetical protein Csa_1G024950 [Cucumis sativus]
Length=184

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  575  VKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEXVGHQ  691
            +KPN+TCDVVYCYCGIRLHPLSCPEAFS+N +G   G++
Sbjct  1    MKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGILEGNR  39



>gb|EAZ37101.1| hypothetical protein OsJ_21441 [Oryza sativa Japonica Group]
Length=279

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 73/157 (46%), Gaps = 34/157 (22%)
 Frame = +2

Query  272  TIPAFPEQSNTAA----CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAY  439
            TIPAFPEQS  AA    C L  +  L   + ++C +   + P  R RCCP LAAW+Y+AY
Sbjct  63   TIPAFPEQSEAAAATSVCQLAPSPPLLPAVLASCNAGGGALP-PRLRCCPALAAWMYAAY  121

Query  440  STTAL----------------QRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIE  571
            + TAL                  A++        D+PVLPDD+E C  + E+AL   G  
Sbjct  122  APTALLAAAAGGGGGVPGAAHSTASAAEAVAAVVDLPVLPDDAEECAGAAERALLAAGAS  181

Query  572  L-------------VKPNQTCDVVYCYCGIRLHPLSC  643
            L                   CDV +CYC +RL   +C
Sbjct  182  LPPPPPPSQVGANGTTAAAACDVPFCYCRVRLRRPAC  218



>ref|NP_001057696.1| Os06g0497400 [Oryza sativa Japonica Group]
 dbj|BAF19610.1| Os06g0497400 [Oryza sativa Japonica Group]
Length=256

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 71/153 (46%), Gaps = 34/153 (22%)
 Frame = +2

Query  272  TIPAFPEQSNTAA----CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAY  439
            TIPAFPEQS  AA    C L  +  L   + ++C +   + P  R RCCP LAAW+Y+AY
Sbjct  63   TIPAFPEQSEAAAATSVCQLAPSPPLLPAVLASCNAGGGALP-PRLRCCPALAAWMYAAY  121

Query  440  STTAL----------------QRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIE  571
            + TAL                  A++        D+PVLPDD+E C  + E+AL   G  
Sbjct  122  APTALLAAAAGGGGGVPGAAHSTASAAEAVAAVVDLPVLPDDAEECAGAAERALLAAGAS  181

Query  572  L-------------VKPNQTCDVVYCYCGIRLH  631
            L                   CDV +CYC +RL 
Sbjct  182  LPPPPPPSQVGANGTTAAAACDVPFCYCRVRLR  214



>ref|NP_001183921.1| uncharacterized protein LOC100502514 [Zea mays]
 gb|ACR38759.1| unknown [Zea mays]
Length=219

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  494  DMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN  664
            D P++P D++ CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP AF++ 
Sbjct  8    DGPMVPYDNQRCVDTLGAALERRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVK  67

Query  665  S  667
            +
Sbjct  68   T  68



>dbj|BAD45779.1| hypothetical protein [Oryza sativa Japonica Group]
Length=404

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 71/153 (46%), Gaps = 34/153 (22%)
 Frame = +2

Query  272  TIPAFPEQSNTAA----CPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAY  439
            TIPAFPEQS  AA    C L  +  L   + ++C +   + P  R RCCP LAAW+Y+AY
Sbjct  63   TIPAFPEQSEAAAATSVCQLAPSPPLLPAVLASCNAGGGALP-PRLRCCPALAAWMYAAY  121

Query  440  STTAL----------------QRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIE  571
            + TAL                  A++        D+PVLPDD+E C  + E+AL   G  
Sbjct  122  APTALLAAAAGGGGGVPGAAHSTASAAEAVAAVVDLPVLPDDAEECAGAAERALLAAGAS  181

Query  572  L-------------VKPNQTCDVVYCYCGIRLH  631
            L                   CDV +CYC +RL 
Sbjct  182  LPPPPPPSQVGANGTTAAAACDVPFCYCRVRLR  214



>gb|EYU24846.1| hypothetical protein MIMGU_mgv1a013501mg [Erythranthe guttata]
Length=218

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 3/59 (5%)
 Frame = +2

Query  503  VLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSH  670
            ++PDDS+ CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF++  +
Sbjct  1    MMPDDSQRCVNSLQSSLTSRNIHIPQPNASCDAVLCFCGIRLHQITSLSCPAAFNVTGN  59



>ref|XP_003563886.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Brachypodium distachyon]
Length=352

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 75/183 (41%), Gaps = 40/183 (22%)
 Frame = +2

Query  203  VSIANPDLPDPEPV--SFSTPSTPAT------------IPAFPEQSNTAA----CPLDLT  328
             + A+P +PDP  +  S   PS  AT            IPAFPEQS  AA    C L  +
Sbjct  22   AAAASPAMPDPASLEPSLLFPSASATQAALQPTRASSTIPAFPEQSEAAATSSVCQLAPS  81

Query  329  EELFRGIKSAC--GSNDYSGPLHRTRCCPVLA------------AWLYSAYSTTALQRAT  466
              L   + ++C  G         R +CCP LA              L  A +  A +   
Sbjct  82   PPLLPAVLASCNAGRGKKGALPPRLQCCPPLAAWLYAAYAPTALGLLGGARAAPAGEERP  141

Query  467  SKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKP--------NQTCDVVYCYCGI  622
            +         +P+LPDD E C  + ++AL   G  L  P          +CDV +CYCGI
Sbjct  142  AAAAADVADLLPLLPDDVEECAGAADRALRASGATLPLPPPQVNGNGTSSCDVAFCYCGI  201

Query  623  RLH  631
            RL 
Sbjct  202  RLR  204



>ref|XP_011100330.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Sesamum 
indicum]
Length=273

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +2

Query  527  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSM  661
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF++
Sbjct  80   CVNSLQTSLTSRNIHIPQPNASCDAVLCFCGIRLHQITSLSCPAAFTI  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340