BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024N24

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009763845.1|  PREDICTED: uncharacterized protein LOC104215685    127   5e-31   Nicotiana sylvestris
ref|XP_009595596.1|  PREDICTED: uncharacterized protein LOC104091859    126   7e-31   Nicotiana tomentosiformis
ref|XP_006344428.1|  PREDICTED: uncharacterized protein LOC102597060    116   5e-27   Solanum tuberosum [potatoes]
ref|XP_004236230.1|  PREDICTED: uncharacterized protein LOC101257648    105   2e-23   Solanum lycopersicum
ref|XP_002263464.1|  PREDICTED: uncharacterized protein LOC100265372  89.4    1e-17   Vitis vinifera
ref|XP_010444166.1|  PREDICTED: uncharacterized protein LOC104726903  80.5    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010459745.1|  PREDICTED: uncharacterized protein LOC104740753  78.2    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006280741.1|  hypothetical protein CARUB_v10026710mg           78.2    1e-13   Capsella rubella
ref|XP_010484025.1|  PREDICTED: uncharacterized protein LOC104762443  77.8    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002318084.2|  hypothetical protein POPTR_0012s09050g           77.0    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011046159.1|  PREDICTED: uncharacterized protein LOC105140...  76.6    4e-13   Populus euphratica
ref|XP_011046174.1|  PREDICTED: uncharacterized protein LOC105140...  76.6    4e-13   Populus euphratica
ref|XP_002864832.1|  EMB2759                                          76.3    5e-13   
ref|NP_201110.2|  protein EMBRYO DEFECTIVE 2759                       75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABK96116.1|  unknown                                               75.1    2e-12   Populus trichocarpa [western balsam poplar]
gb|KDO69567.1|  hypothetical protein CISIN_1g020410mg                 74.7    2e-12   Citrus sinensis [apfelsine]
ref|XP_002511367.1|  conserved hypothetical protein                   74.7    2e-12   Ricinus communis
ref|XP_006476824.1|  PREDICTED: uncharacterized protein LOC102631...  74.3    2e-12   Citrus sinensis [apfelsine]
ref|XP_002322176.2|  hypothetical protein POPTR_0015s09120g           74.7    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006439862.1|  hypothetical protein CICLE_v10021009mg           74.3    2e-12   
emb|CDX87278.1|  BnaC09g05930D                                        74.3    3e-12   
ref|XP_009112054.1|  PREDICTED: uncharacterized protein LOC103837445  74.3    3e-12   Brassica rapa
emb|CDY16747.1|  BnaA09g06350D                                        73.9    3e-12   Brassica napus [oilseed rape]
ref|XP_008244999.1|  PREDICTED: uncharacterized protein LOC103343...  73.9    4e-12   
emb|CDP12656.1|  unnamed protein product                              73.6    5e-12   Coffea canephora [robusta coffee]
ref|XP_007036302.1|  Embryo defective 2759, putative isoform 1        72.8    8e-12   
ref|XP_011071906.1|  PREDICTED: uncharacterized protein LOC105157...  72.8    8e-12   Sesamum indicum [beniseed]
ref|XP_006394322.1|  hypothetical protein EUTSA_v10004512mg           72.4    1e-11   Eutrema salsugineum [saltwater cress]
ref|XP_008351789.1|  PREDICTED: uncharacterized protein LOC103415...  72.0    2e-11   
ref|XP_011040476.1|  PREDICTED: uncharacterized protein LOC105136...  70.9    4e-11   Populus euphratica
ref|XP_009362975.1|  PREDICTED: uncharacterized protein LOC103952...  70.9    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_004298965.1|  PREDICTED: uncharacterized protein LOC101308376  70.5    5e-11   Fragaria vesca subsp. vesca
ref|XP_011101307.1|  PREDICTED: uncharacterized protein LOC105179393  70.1    8e-11   Sesamum indicum [beniseed]
ref|XP_011046164.1|  PREDICTED: uncharacterized protein LOC105140...  69.3    1e-10   Populus euphratica
ref|XP_011046177.1|  PREDICTED: uncharacterized protein LOC105140...  69.3    1e-10   Populus euphratica
ref|NP_001190603.1|  protein EMBRYO DEFECTIVE 2759                    68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209326.1|  hypothetical protein PRUPE_ppa008249mg           68.6    3e-10   Prunus persica
ref|XP_008245000.1|  PREDICTED: uncharacterized protein LOC103343...  68.6    3e-10   Prunus mume [ume]
gb|EYU17699.1|  hypothetical protein MIMGU_mgv1a009574mg              68.2    4e-10   Erythranthe guttata [common monkey flower]
gb|KJB08225.1|  hypothetical protein B456_001G071700                  67.8    4e-10   Gossypium raimondii
ref|XP_006439864.1|  hypothetical protein CICLE_v10021009mg           68.2    4e-10   
ref|XP_010027415.1|  PREDICTED: uncharacterized protein LOC104417915  67.8    4e-10   Eucalyptus grandis [rose gum]
ref|XP_011071910.1|  PREDICTED: uncharacterized protein LOC105157...  65.9    6e-10   Sesamum indicum [beniseed]
emb|CAN66425.1|  hypothetical protein VITISV_007985                   67.0    7e-10   Vitis vinifera
gb|KJB53102.1|  hypothetical protein B456_008G293700                  67.0    1e-09   Gossypium raimondii
gb|EYU22149.1|  hypothetical protein MIMGU_mgv1a009494mg              67.0    1e-09   Erythranthe guttata [common monkey flower]
gb|KJB08224.1|  hypothetical protein B456_001G071700                  66.6    1e-09   Gossypium raimondii
gb|KDP31068.1|  hypothetical protein JCGZ_11444                       66.6    1e-09   Jatropha curcas
ref|XP_011071904.1|  PREDICTED: uncharacterized protein LOC105157...  65.1    4e-09   
ref|XP_011071905.1|  PREDICTED: uncharacterized protein LOC105157...  65.1    4e-09   
ref|XP_011040478.1|  PREDICTED: uncharacterized protein LOC105136...  63.9    1e-08   Populus euphratica
gb|KHG29598.1|  recA                                                  62.8    3e-08   Gossypium arboreum [tree cotton]
gb|KHG08396.1|  Adenylosuccinate synthetase                           54.3    4e-08   Gossypium arboreum [tree cotton]
ref|XP_008782690.1|  PREDICTED: uncharacterized protein LOC103702154  58.9    6e-07   Phoenix dactylifera
ref|XP_009150435.1|  PREDICTED: uncharacterized protein LOC103873787  58.5    8e-07   Brassica rapa
ref|XP_010942418.1|  PREDICTED: uncharacterized protein LOC105060428  57.8    1e-06   Elaeis guineensis
gb|KDO69572.1|  hypothetical protein CISIN_1g020410mg                 57.0    2e-06   Citrus sinensis [apfelsine]
ref|XP_010102523.1|  hypothetical protein L484_014579                 56.2    4e-06   Morus notabilis
ref|XP_008438584.1|  PREDICTED: uncharacterized protein LOC103483...  56.2    5e-06   Cucumis melo [Oriental melon]
emb|CDX84380.1|  BnaC03g51200D                                        55.8    7e-06   
ref|XP_010545998.1|  PREDICTED: uncharacterized protein LOC104818212  55.5    7e-06   Tarenaya hassleriana [spider flower]
ref|XP_008787334.1|  PREDICTED: uncharacterized protein LOC103705...  54.7    9e-06   Phoenix dactylifera
ref|XP_008346734.1|  PREDICTED: uncharacterized protein LOC103409...  55.5    9e-06   
emb|CDY00350.1|  BnaA06g22510D                                        55.1    1e-05   
emb|CDX72055.1|  BnaC08g28190D                                        55.1    1e-05   
ref|XP_007036303.1|  Embryo defective 2759 isoform 2                  54.7    1e-05   
ref|XP_008438592.1|  PREDICTED: uncharacterized protein LOC103483...  54.7    1e-05   Cucumis melo [Oriental melon]
ref|XP_011040479.1|  PREDICTED: uncharacterized protein LOC105136...  53.9    2e-05   Populus euphratica
ref|XP_010278054.1|  PREDICTED: uncharacterized protein LOC104612...  53.9    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_008787333.1|  PREDICTED: uncharacterized protein LOC103705...  52.8    6e-05   



>ref|XP_009763845.1| PREDICTED: uncharacterized protein LOC104215685 [Nicotiana sylvestris]
Length=339

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 103/154 (67%), Gaps = 6/154 (4%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MALAT HLQ SY+T P  SSS ++ NKL  SVT +  V +KD F SLKC+S  R      
Sbjct  1    MALATHHLQGSYRTCPLSSSSWTTRNKLRHSVTKIHTVSQKDNFISLKCKSCLRI-----  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
            GAP  LKP  K LKI AFK+S   + G   GSK+ K S+KLS V Q +EE SVESPRAQN
Sbjct  56   GAPFVLKPNGKSLKISAFKNSQNESGGRVGGSKSLKNSVKLSYVPQENEEASVESPRAQN  115

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +PISY++E  D T+   AIQ IFK WL +LRTPS
Sbjct  116  VPISYSAEA-DETTSYFAIQNIFKSWLTLLRTPS  148



>ref|XP_009595596.1| PREDICTED: uncharacterized protein LOC104091859 [Nicotiana tomentosiformis]
Length=340

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 108/155 (70%), Gaps = 7/155 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MALA  HLQ SY+T P  SSS ++GNKL  SVT +  V +KD F SLKC+S  R      
Sbjct  1    MALAIHHLQGSYRTCPLSSSSWTTGNKLRHSVTKIHTVSQKDNFISLKCKSCLRI-----  55

Query  391  GAPLFLKPKAKVLKILAFksssqnns-ggssgsktkkesikLSIVSQGSEETSVESPRAQ  567
            GAP  LKP  K LKI AFKS+SQN S G   GSK+ K S+KLS V Q SEETSVESPRAQ
Sbjct  56   GAPFILKPNGKSLKISAFKSNSQNESGGRVGGSKSLKNSVKLSYVPQESEETSVESPRAQ  115

Query  568  NLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            N PISY++E  +TTS + AIQ IFK WL +LRTPS
Sbjct  116  NAPISYSAEADETTSYS-AIQNIFKSWLTLLRTPS  149



>ref|XP_006344428.1| PREDICTED: uncharacterized protein LOC102597060 [Solanum tuberosum]
Length=338

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 106/155 (68%), Gaps = 9/155 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MALAT  LQ SY+T P   SS ++GNKL  SVT +  +G+KD F SLKC+S  R      
Sbjct  1    MALATHQLQGSYRTCPLSPSSWTTGNKLRHSVTKIP-IGQKDNFISLKCKSCLRI-----  54

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssg-sktkkesikLSIVSQGSEETSVESPRAQ  567
            GAP  LKPK K LKI AFKS+SQN SGG    SK+ K S+KLS V   SEETSVESPRAQ
Sbjct  55   GAPFILKPKGKSLKISAFKSNSQNESGGRVSGSKSLKSSVKLSYVPHESEETSVESPRAQ  114

Query  568  NLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            N+PISY++E  D T+   A + IFK WL +LRTPS
Sbjct  115  NVPISYSAEA-DETTNYFA-KNIFKSWLTLLRTPS  147



>ref|XP_004236230.1| PREDICTED: uncharacterized protein LOC101257648 [Solanum lycopersicum]
Length=337

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 106/155 (68%), Gaps = 10/155 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MALAT  LQ SY+T P  SSS ++ NKL  SVT +  VG+KD F SLKC+S  R      
Sbjct  1    MALATHQLQGSYRTCP-SSSSWTTANKLRHSVTKIP-VGQKDNFISLKCKSCLRI-----  53

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssg-sktkkesikLSIVSQGSEETSVESPRAQ  567
            G P  LKPK K LKI AFKS+SQN SGG +  SK+ K S+KLS V   SEETSVESPRAQ
Sbjct  54   GVPFILKPKGKSLKISAFKSNSQNESGGRASGSKSLKSSVKLSYVPHESEETSVESPRAQ  113

Query  568  NLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            N+PISY++ T D T+   A + IFK WL +LR+PS
Sbjct  114  NVPISYSAGT-DETTNYFA-KNIFKSWLTLLRSPS  146



>ref|XP_002263464.1| PREDICTED: uncharacterized protein LOC100265372 [Vitis vinifera]
 emb|CBI14996.3| unnamed protein product [Vitis vinifera]
Length=343

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 96/156 (62%), Gaps = 7/156 (4%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MALAT H+  SY T P +S S + G KL + V T   VG+ D   SLK     R +  S 
Sbjct  1    MALATHHVPGSYATFPTRSHSWTKGIKLKQYVKTRHIVGKPDISFSLK-----RNLHLSV  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRA  564
            G P    PK + LKI AFK S+QN+     +SGSK+ K S++LS   QG+EET  ESP++
Sbjct  56   GTPCVRVPKRRPLKICAFKGSAQNDESGGRASGSKSPKNSVRLSYAPQGNEETITESPKS  115

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            QN+P+ Y+SE   T  G+LAIQ +FK WL +LRT S
Sbjct  116  QNVPLPYSSEANGTIGGSLAIQNLFKKWLTMLRTQS  151



>ref|XP_010444166.1| PREDICTED: uncharacterized protein LOC104726903 [Camelina sativa]
Length=345

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 85/157 (54%), Gaps = 9/157 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRS-FYRYVVCS  387
            M L T  LQ S+  +P+ S + + G  L R VTTV +V RKDK   LK R  F     C+
Sbjct  1    MVLVTHKLQGSHVLSPWSSPTWTRGLSLRRPVTTVHFVERKDKHLRLKQRCCFSLGSPCN  60

Query  388  GGAPLFLKPKAKVLKILAFksssqnnsggssg--sktkkesikLSIVSQGSEETSVESPR  561
            GG       KAK  ++ +FK   QNN  G S    K    S+KLS  S   E     SP+
Sbjct  61   GGL------KAKTFRVTSFKGGIQNNESGGSEGGKKVTNNSVKLSYRSDDDENNVNGSPK  114

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            AQN   SYTSET D+ SG  AIQK+FK WL +LRT S
Sbjct  115  AQNTSFSYTSETEDSVSGQPAIQKLFKKWLTMLRTQS  151



>ref|XP_010459745.1| PREDICTED: uncharacterized protein LOC104740753 [Camelina sativa]
Length=344

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 85/156 (54%), Gaps = 7/156 (4%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ S+  +P+ S + + G  L R VTTV +V RKDK   LK +  +     S 
Sbjct  1    MVLVTHKLQGSHVLSPWSSPTWTRGLSLRRPVTTVHFVERKDKHLRLKQKCCF-----SL  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssg--sktkkesikLSIVSQGSEETSVESPRA  564
            G+P     KAK  ++ +FK   QNN  G S    K    S+KLS  S   E     SP+A
Sbjct  56   GSPCNGGLKAKAFRVTSFKGGIQNNESGGSEGGKKVTNNSVKLSYRSDDDENNVNGSPKA  115

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            QN   SYTSET D+ +G  AIQK+FK WL +LRT S
Sbjct  116  QNTSFSYTSETEDSVTGQPAIQKLFKKWLTMLRTQS  151



>ref|XP_006280741.1| hypothetical protein CARUB_v10026710mg [Capsella rubella]
 gb|EOA13639.1| hypothetical protein CARUB_v10026710mg [Capsella rubella]
Length=345

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 86/156 (55%), Gaps = 7/156 (4%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ S+  +P+ S + + G  L R VTTV +V RKDK   LK +  +     S 
Sbjct  1    MVLVTHKLQGSHVLSPWSSPTWTRGLSLRRPVTTVHFVERKDKHLRLKQKCCF-----SL  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssg--sktkkesikLSIVSQGSEETSVESPRA  564
            G+P     KAK  ++ +FK + QNN  G S    K    S+KLS  S   E     SP+A
Sbjct  56   GSPCNGGLKAKAFRVTSFKGAIQNNESGGSEGGKKVTNNSVKLSYRSDDDENNVNGSPKA  115

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            QN   SYTSET D+ +G  AIQK+FK WL +LRT S
Sbjct  116  QNTSFSYTSETEDSITGQPAIQKLFKKWLTMLRTQS  151



>ref|XP_010484025.1| PREDICTED: uncharacterized protein LOC104762443 [Camelina sativa]
Length=345

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 85/158 (54%), Gaps = 11/158 (7%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLK--CRSFYRYVVC  384
            M L T  LQ S+  +P+ S + + G  L R VTTV +V RKDK   LK  C  F     C
Sbjct  1    MVLVTHKLQGSHVLSPWSSPTWTRGLSLRRPVTTVHFVDRKDKHLRLKQTC-CFSLGSPC  59

Query  385  SGGAPLFLKPKAKVLKILAFksssqnnsggssg--sktkkesikLSIVSQGSEETSVESP  558
            +GG       KAK  ++ +FK   QNN  G S    K    S+KLS  S   E     SP
Sbjct  60   NGGL------KAKAFRVTSFKGGIQNNESGGSEGGKKVTNNSVKLSYRSDDDENNVNGSP  113

Query  559  RAQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +AQN   SYTSET D+ +G  AIQK+FK WL +LRT S
Sbjct  114  KAQNTSFSYTSETEDSVTGQPAIQKLFKKWLTMLRTQS  151



>ref|XP_002318084.2| hypothetical protein POPTR_0012s09050g [Populus trichocarpa]
 gb|EEE96304.2| hypothetical protein POPTR_0012s09050g [Populus trichocarpa]
Length=342

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 91/156 (58%), Gaps = 8/156 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S S G KL   V T++  GR +      C S  R ++ S 
Sbjct  1    MALVTHQMQGSYATFPSRPLSWSKGVKLKPHVMTLQMFGRTNM-----CFSVKRSLLLSA  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRA  564
            GA   L PK K+L+I AFK S+QN+      +GSK  K  +KLS V + S ET + S + 
Sbjct  56   GA-FALGPKVKLLRISAFKGSAQNDESGGRKNGSKVSKNYVKLSYVPKESGETIINSSKV  114

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
              +P+SYTSE  +T +G+ AI K+FK WL++LRT S
Sbjct  115  HTIPVSYTSEANNTITGSPAINKLFKKWLSMLRTQS  150



>ref|XP_011046159.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046160.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046161.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046162.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046163.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
Length=343

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 95/156 (61%), Gaps = 8/156 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S S G KL + VT ++ VGRKD      C S    +  S 
Sbjct  1    MALVTHQMQGSYATLPSRPLSWSKGVKLKQRVTELQMVGRKDM-----CFSVKHSLRLSA  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRA  564
            GA     PK K+L++ AFK S+QN+     ++GSK  K+S+KLS V + S ET ++S + 
Sbjct  56   GA-FSHGPKVKLLRVSAFKGSAQNDESGGRANGSKVSKKSVKLSYVPKESGETMMDSSKV  114

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
             ++P+SYTSE  +  +G+ AI K+FK WL++LRT S
Sbjct  115  HSIPVSYTSEANERIAGSPAINKLFKKWLSMLRTQS  150



>ref|XP_011046174.1| PREDICTED: uncharacterized protein LOC105140855 isoform X1 [Populus 
euphratica]
 ref|XP_011046175.1| PREDICTED: uncharacterized protein LOC105140855 isoform X1 [Populus 
euphratica]
 ref|XP_011046176.1| PREDICTED: uncharacterized protein LOC105140855 isoform X1 [Populus 
euphratica]
Length=343

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 95/156 (61%), Gaps = 8/156 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S S G KL + VT ++ VGRKD      C S    +  S 
Sbjct  1    MALVTHQMQGSYATFPSRPLSWSKGVKLKQRVTELQMVGRKDM-----CFSVKHSLRLSA  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRA  564
            GA     PK K+L++ AFK S+QN+     ++GSK  K+S+KLS V + S ET ++S + 
Sbjct  56   GA-FSHGPKVKLLRVSAFKGSAQNDESGGRANGSKVSKKSVKLSYVPKESGETMMDSSKV  114

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
             ++P+SYTSE  +  +G+ AI K+FK WL++LRT S
Sbjct  115  HSIPVSYTSEANERIAGSPAINKLFKKWLSMLRTQS  150



>ref|XP_002864832.1| EMB2759 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41091.1| EMB2759 [Arabidopsis lyrata subsp. lyrata]
Length=345

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 87/157 (55%), Gaps = 9/157 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRS-FYRYVVCS  387
            M L T  LQ S+  +P+ S + + G  L R VTTV +V RKDK   LK +  F     C+
Sbjct  1    MVLVTHKLQGSHVLSPWSSPTWTRGLILKRPVTTVHFVERKDKHLRLKQKCCFSLGSSCN  60

Query  388  GGAPLFLKPKAKVLKILAFksssqnnsggssg--sktkkesikLSIVSQGSEETSVESPR  561
            GG       +AK  ++ +FK S +NN  G S    K    S+KLS  S   E     SP+
Sbjct  61   GGL------RAKPFRVTSFKGSIKNNESGGSEGGKKVTNNSVKLSYRSDDDENNVNGSPK  114

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            AQN  +SYTSET D+ +G  AIQK+FK WL +LRT S
Sbjct  115  AQNTSLSYTSETEDSITGQPAIQKLFKKWLTLLRTQS  151



>ref|NP_201110.2| protein EMBRYO DEFECTIVE 2759 [Arabidopsis thaliana]
 gb|AAR92269.1| At5g63050 [Arabidopsis thaliana]
 gb|AAS76255.1| At5g63050 [Arabidopsis thaliana]
 gb|AED97691.1| embryo defective 2759 protein [Arabidopsis thaliana]
Length=345

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 85/156 (54%), Gaps = 7/156 (4%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ S+  +P+ S + + G  L R VTTV +V RKDK   LK +  +     S 
Sbjct  1    MVLVTHKLQGSHVLSPWSSPTWTRGLCLKRPVTTVHFVERKDKHLRLKQKCCF-----SL  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssg--sktkkesikLSIVSQGSEETSVESPRA  564
            G+P     +AK  ++ +FK   QNN  G S    K    S+KLS  S   E     SP+A
Sbjct  56   GSPCNGGLRAKPFRVTSFKGGIQNNESGGSEGGKKVTNNSVKLSYRSDDDENNVNGSPKA  115

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            QN   SYTSET D+ +G  AIQK+FK WL +LRT S
Sbjct  116  QNTSFSYTSETEDSMTGQPAIQKLFKKWLTLLRTQS  151



>gb|ABK96116.1| unknown [Populus trichocarpa]
Length=342

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 90/156 (58%), Gaps = 8/156 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S S G KL   V T++  GR +      C S  R ++ S 
Sbjct  1    MALVTHQMQGSYATFPSRPLSWSKGVKLKPHVMTLQMFGRTNM-----CFSVKRSLLLSA  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRA  564
            GA   L PK K+L+I AFK S+QN+      +GSK  K  +KLS V + S ET + S + 
Sbjct  56   GA-FALGPKVKLLRISAFKGSAQNDESGGRKNGSKVSKNYVKLSYVPKESGETIINSSKV  114

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
              +P+SYTSE  +  +G+ AI K+FK WL++LRT S
Sbjct  115  HTIPVSYTSEANNRIAGSPAINKLFKKWLSMLRTQS  150



>gb|KDO69567.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69568.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69569.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69570.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69571.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
Length=326

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 92/158 (58%), Gaps = 9/158 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ SY   P +  S + G  L R VTTV  VG+K++     C S+ R    S 
Sbjct  1    MVLVTHQLQGSYVAFPSRRLSWNKGLILRRCVTTVHMVGKKEQ-----CLSWKRNFCLSV  55

Query  391  GAPLFLKPKAKVLKI--LAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESP  558
            G P     K K +KI   AFK S+QN+     +SGSK  K S+KLS + + SEET  ES 
Sbjct  56   GTPHKCGVKVKSVKISFTAFKGSAQNDESGGRASGSKDPKNSVKLSYIPKESEETVTESS  115

Query  559  RAQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
             A N+P+SY S+T ++ +G+ AI+K+FK WL +LRT S
Sbjct  116  EAHNVPLSYASKTNESIAGSPAIRKLFKKWLTLLRTQS  153



>ref|XP_002511367.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51969.1| conserved hypothetical protein [Ricinus communis]
Length=343

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 85/156 (54%), Gaps = 8/156 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S + G KL + V+T+   GR D+  S+K         C  
Sbjct  1    MALVTHQMQGSYTTFPLRPFSWTKGFKLKQHVSTLHMFGRIDRRISVKRNLRLSVGACVH  60

Query  391  GAPLFLKPKAKVLKILAF--ksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRA  564
            G      P+ K  KI AF   + +  +    +GSK   +S+KLS   + S ET +ESP+ 
Sbjct  61   G------PRTKFFKISAFKGTAQNDESRNRENGSKISHKSVKLSYAQKESGETIMESPKV  114

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
             ++P+SYTSE  +  +G+ AI K+FK WL +LRT S
Sbjct  115  HSVPVSYTSEANEGFNGSPAIHKLFKKWLNMLRTQS  150



>ref|XP_006476824.1| PREDICTED: uncharacterized protein LOC102631155 isoform X1 [Citrus 
sinensis]
 ref|XP_006476825.1| PREDICTED: uncharacterized protein LOC102631155 isoform X2 [Citrus 
sinensis]
 ref|XP_006476826.1| PREDICTED: uncharacterized protein LOC102631155 isoform X3 [Citrus 
sinensis]
Length=338

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 92/158 (58%), Gaps = 9/158 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ SY   P +  S + G  L R VTTV  VG+K++     C S+ R    S 
Sbjct  1    MVLVTHQLQGSYVAFPSRRLSWNKGLILRRCVTTVHMVGKKEQ-----CLSWKRNFCLSV  55

Query  391  GAPLFLKPKAKVLKI--LAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESP  558
            G P     K K +KI   AFK S+QN+     +SGSK  K S+KLS + + SEET  ES 
Sbjct  56   GTPHKCGVKVKSVKISFTAFKGSAQNDESGGRASGSKDPKNSVKLSYIPKESEETVTESS  115

Query  559  RAQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
             A N+P+SY S+T ++ +G+ AI+K+FK WL +LRT S
Sbjct  116  EAHNVPLSYASKTNESIAGSPAIRKLFKKWLTLLRTQS  153



>ref|XP_002322176.2| hypothetical protein POPTR_0015s09120g [Populus trichocarpa]
 gb|EEF06303.2| hypothetical protein POPTR_0015s09120g [Populus trichocarpa]
Length=343

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 94/156 (60%), Gaps = 8/156 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S S G KL + VT ++ VGR D      C S    +  S 
Sbjct  1    MALVTHQMQGSYATFPSRPLSWSKGVKLKQRVTELQMVGRTDM-----CFSVKHSLRLSA  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRA  564
            GA     PK K+L++ AFK S+QN+     ++GSK  K+S+KLS V + S ET ++S + 
Sbjct  56   GA-FSHGPKVKLLRVSAFKGSAQNDESGGRANGSKVSKKSVKLSYVPKESGETMMDSSKV  114

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
             ++P+SYTSE  +  +G+ AI K+FK WL++LRT S
Sbjct  115  HSIPVSYTSEADERIAGSPAINKLFKKWLSMLRTQS  150



>ref|XP_006439862.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 ref|XP_006439863.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 ref|XP_006439865.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 ref|XP_006439866.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53102.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53103.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53105.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53106.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
Length=338

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 92/158 (58%), Gaps = 9/158 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ SY   P +  S + G  L R VTTV  VG+K++     C S+ R    S 
Sbjct  1    MVLVTHQLQGSYVAFPSRRLSWNKGLILRRCVTTVHMVGKKEQ-----CLSWKRNFCLSV  55

Query  391  GAPLFLKPKAKVLKI--LAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESP  558
            G P     K K +KI   AFK S+QN+     +SGSK  K S+KLS + + SEET  ES 
Sbjct  56   GTPHKCGVKVKSVKISFTAFKGSAQNDESGGRASGSKDPKNSVKLSYIPKESEETVTESS  115

Query  559  RAQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
             A N+P+SY S+T ++ +G+ AI+K+FK WL +LRT S
Sbjct  116  EAHNVPLSYASKTNESIAGSPAIRKLFKKWLTLLRTQS  153



>emb|CDX87278.1| BnaC09g05930D [Brassica napus]
Length=346

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 84/156 (54%), Gaps = 7/156 (4%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T +LQ S+   P+ S + + G  + R VTT+R  G K+K   LK R  +     S 
Sbjct  1    MVLLTHNLQGSHVLLPWSSPTWTKGLVIKRPVTTIRLSGSKEKHLRLKQRCCF-----SL  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRA  564
            G+P     KAK  K+ +FK   QN+      SG K    S+KLS  S   E     SP+A
Sbjct  56   GSPCSCGLKAKSFKVTSFKGGIQNSESGGRESGKKVTNNSVKLSYRSDDDENNVNSSPKA  115

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            QN  +SYTSE  D+ +G  AIQK+FK WL +LRT S
Sbjct  116  QNTSLSYTSEADDSVTGQPAIQKLFKKWLTLLRTQS  151



>ref|XP_009112054.1| PREDICTED: uncharacterized protein LOC103837445 [Brassica rapa]
Length=346

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 83/156 (53%), Gaps = 7/156 (4%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ S+   P+ S + S G  + R VTT+R  GRK+K   LK    +     S 
Sbjct  1    MVLLTHQLQGSHVLLPWSSPTWSKGLVIKRPVTTIRLAGRKEKSLRLKQSCCF-----SL  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRA  564
            G+P     KAK  K+ +FK   QN+      SG K    S+KLS  S   E     SP+A
Sbjct  56   GSPCSCGLKAKSFKVTSFKGGIQNSESGGRESGKKVTNNSVKLSYRSDDDENNVNSSPKA  115

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            QN  +SYTSE  D+ +G  AIQK+FK WL +LRT S
Sbjct  116  QNTSLSYTSEADDSVTGQPAIQKLFKKWLTLLRTQS  151



>emb|CDY16747.1| BnaA09g06350D [Brassica napus]
Length=346

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 83/156 (53%), Gaps = 7/156 (4%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ S+   P+ S + S G  + R VTT+R  GRK+K   LK    +     S 
Sbjct  1    MVLLTHQLQGSHVLLPWSSPTWSKGLVIKRPVTTIRLAGRKEKSLRLKQSCCF-----SL  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRA  564
            G+P     KAK  K+ +FK   QN+      SG K    S+KLS  S   E     SP+A
Sbjct  56   GSPCSCGLKAKSFKVTSFKGGIQNSESGGRESGKKVTNNSVKLSYRSDDDENNVNSSPKA  115

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            QN  +SYTSE  D+ +G  AIQK+FK WL +LRT S
Sbjct  116  QNTSLSYTSEADDSVTGQPAIQKLFKKWLTLLRTQS  151



>ref|XP_008244999.1| PREDICTED: uncharacterized protein LOC103343102 isoform X1 [Prunus 
mume]
Length=343

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 86/157 (55%), Gaps = 7/157 (4%)
 Frame = +1

Query  202  TETMALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVV  381
            TETMAL T  +Q SY T P +  S S G KL + VTT   VGR D    LK     R + 
Sbjct  2    TETMALVTHQMQGSYVTYPSRPLSWSKGLKLKQYVTTHHMVGRTDNCIMLK-----RNIC  56

Query  382  CSGGAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPR  561
             S GA L    K K L++ AFK S+QN+  G   S +K      S+  + +E+T   SP+
Sbjct  57   LSVGASLMRGSKVKPLRVSAFKGSAQNDKSGGRTSGSKLPKN--SVKLKENEDTLTGSPQ  114

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
              ++P+SY SE  ++ + +  I K+FK WL +LRT S
Sbjct  115  ENDMPLSYASEANESIASSPVIHKLFKKWLRMLRTQS  151



>emb|CDP12656.1| unnamed protein product [Coffea canephora]
Length=355

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 89/147 (61%), Gaps = 9/147 (6%)
 Frame = +1

Query  235  QHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSGGAPLFLKP  414
            Q S K  P      + GNKL  S  +  +VG K +FTSLKC+S  R      G P  L P
Sbjct  25   QASQKVFPSMHILWNCGNKLECSRRS-NHVGPKARFTSLKCKSCLRV-----GTPFTLGP  78

Query  415  KAKVLKILAFksssqnnsggs--sgsktkkesikLSIVSQGSEETSVESPRAQNLPISYT  588
            + K+LK+ AFKS+SQN+  G   +GSK+ K S+ LS V Q  E T V SP+ Q+ P S++
Sbjct  79   RKKLLKLSAFKSNSQNDGPGGRPTGSKSLKNSVGLSYVPQDGEATLVGSPKPQSDPTSFS  138

Query  589  SETVDTTSGTLAIQKIFKHWLAILRTP  669
            SE  ++ +G+L IQ +FK WL +LR+P
Sbjct  139  SEA-ESATGSLVIQNLFKSWLMLLRSP  164



>ref|XP_007036302.1| Embryo defective 2759, putative isoform 1 [Theobroma cacao]
 gb|EOY20803.1| Embryo defective 2759, putative isoform 1 [Theobroma cacao]
Length=343

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 85/157 (54%), Gaps = 9/157 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVC-S  387
            M L T  LQ SY   P +    S G  L R V T+  +G +++  SLK      + VC S
Sbjct  1    MVLVTHQLQGSYVAFPSRPLPWSKGLALRRHVVTLHMLGSRERGISLK------HNVCLS  54

Query  388  GGAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSI--VSQGSEETSVESPR  561
             GAP     KAK ++I AFK S+Q+N  G   +        + +  V +  EET++ES +
Sbjct  55   TGAPRTRGLKAKNIRISAFKGSAQSNESGGRANDASVPKNSIKVAYVPKDGEETTIESSK  114

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            A N  ++Y SET +T  G+ AIQK+FK W+ ILR+ S
Sbjct  115  AHNGQLAYASETSETIVGSPAIQKLFKKWIMILRSQS  151



>ref|XP_011071906.1| PREDICTED: uncharacterized protein LOC105157246 isoform X3 [Sesamum 
indicum]
Length=340

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 89/155 (57%), Gaps = 9/155 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MA AT  LQ S    P   SS S G+K+   + T + VGRKD+  SLKCRS+      S 
Sbjct  1    MAFATHQLQGSCSAFPSVPSSWSRGSKVKHFLPTFQ-VGRKDRLISLKCRSY-----SSV  54

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSI-VSQGSEETSVESPRAQ  567
            G+ L L PK+K  KI AFK SS+++  G   + +K     + +   Q   E+ +ES + Q
Sbjct  55   GSSLVLGPKSKSFKISAFKGSSRHDDSGGRANGSKSLKNPVKVSYLQQEGESPLESSKVQ  114

Query  568  NL-PISYTSETVDTTSGTLAIQKIFKHWLAILRTP  669
            N+ P SYT+    TT+ +LAIQ +FK WL +LRTP
Sbjct  115  NVVPASYTAAD-GTTTRSLAIQNLFKKWLILLRTP  148



>ref|XP_006394322.1| hypothetical protein EUTSA_v10004512mg [Eutrema salsugineum]
 gb|ESQ31608.1| hypothetical protein EUTSA_v10004512mg [Eutrema salsugineum]
Length=344

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 83/157 (53%), Gaps = 10/157 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCR-SFYRYVVCS  387
            M L T  LQ S+   P+ S + + G  + R V TV +VGRK+K   LK    F     CS
Sbjct  1    MVLVTHKLQGSHVLFPWSSPTWTKGLIIKRPVPTVHFVGRKEKHLRLKQNCCFSLGSPCS  60

Query  388  GGAPLFLKPKAKVLKILAFk--sssqnnsggssgsktkkesikLSIVSQGSEETSVESPR  561
            GG       KAK  ++ +FK    +  + G   G K    S+KLS  S   E     SP+
Sbjct  61   GGL------KAKSFRVTSFKGGIKNSESGGSEGGKKVTNNSVKLSYRSDDDENNVNGSPK  114

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            AQN  +SYTSET D T G  AIQK+FK WLA+LRT S
Sbjct  115  AQNTSLSYTSETEDIT-GQPAIQKLFKKWLALLRTQS  150



>ref|XP_008351789.1| PREDICTED: uncharacterized protein LOC103415230 isoform X1 [Malus 
domestica]
Length=339

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 84/154 (55%), Gaps = 7/154 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S S G KL + VTT + VGRK+K     C    R +  S 
Sbjct  1    MALVTHQMQGSYVTYPSRPLSWSKGMKLKQCVTTHQMVGRKEK-----CFMLKRNLCLSV  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
            GA L   PK K  ++ AFK S+QN+  G   + +K      S+  + +E+T   SP+A +
Sbjct  56   GASLMRGPKVKPFRVSAFKGSAQNDKSGGRTNGSKLPKN--SVKLKENEDTITGSPQAND  113

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +P+SY SE  +  + +  I  +FK WL +LRT S
Sbjct  114  IPLSYASEADERIASSPVIHSLFKKWLRMLRTQS  147



>ref|XP_011040476.1| PREDICTED: uncharacterized protein LOC105136723 isoform X1 [Populus 
euphratica]
 ref|XP_011040477.1| PREDICTED: uncharacterized protein LOC105136723 isoform X1 [Populus 
euphratica]
Length=342

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 88/156 (56%), Gaps = 8/156 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S S G KL   V T++  GR +      C      ++ S 
Sbjct  1    MALVTHQMQGSYATFPSRPLSWSKGVKLKPHVMTLQMFGRTNM-----CFPVKHSLLLSA  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRA  564
            GA   L PK K+L+I AFK ++QN+      +GS+  +  +KLS V + S ET + S + 
Sbjct  56   GA-FALGPKVKLLRISAFKGTAQNDESGGRKNGSRVSRNYVKLSYVPKESGETIINSSKV  114

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
              +P+SYTSE +D  + + AI K+FK WL++LRT S
Sbjct  115  HTIPVSYTSEAIDRIAVSPAINKLFKKWLSMLRTQS  150



>ref|XP_009362975.1| PREDICTED: uncharacterized protein LOC103952990 isoform X1 [Pyrus 
x bretschneideri]
Length=339

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 83/154 (54%), Gaps = 7/154 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S S G KL + +TT + VGR +K     C    R +  S 
Sbjct  1    MALVTHQMQGSYVTYPSRPLSWSKGMKLKQCITTHQMVGRTEK-----CFMLKRNLCLSV  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
            GA L   PK K  K+ AFK S+QN+  G   + +K      S+  + +E+T   SP+A +
Sbjct  56   GASLMRGPKVKPFKVSAFKGSAQNDKSGGRTNGSKLPKN--SVKLKENEDTITGSPQAND  113

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +P+SY SE  +  + +  I  +FK WL +LRT S
Sbjct  114  IPLSYASEADERNASSPVIHNLFKKWLRMLRTQS  147



>ref|XP_004298965.1| PREDICTED: uncharacterized protein LOC101308376 [Fragaria vesca 
subsp. vesca]
Length=339

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 84/154 (55%), Gaps = 7/154 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q S+ T P +  S S G KL R VTT+  VGR +      C      +  S 
Sbjct  1    MALVTHQMQGSFVTYPSRPLSWSKGMKLKRYVTTLHMVGRTES-----CSIMKHNICLSV  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
            GA     PK K L++ AFK S+QN+  G   S +K     + I  + +E+T+V  P+A +
Sbjct  56   GASPICGPKLKPLRVSAFKGSAQNDKSGGRKSGSKLPKNSVKI--KENEDTTVGPPQAND  113

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +P+SY SE  ++ + + AI  +FK WL +LRT S
Sbjct  114  IPLSYASEANESITSSPAIHNLFKKWLRMLRTQS  147



>ref|XP_011101307.1| PREDICTED: uncharacterized protein LOC105179393 [Sesamum indicum]
Length=339

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 95/158 (60%), Gaps = 11/158 (7%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MA AT HL+    + P   S  ++ N+L  S+ T   VGRKD F SLKCRS      CS 
Sbjct  2    MAFATNHLKGCCSSFPSVPSLWNTRNRLKHSIPTSHTVGRKDGFISLKCRS------CSS  55

Query  391  -GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSI--VSQGSEETSVESPR  561
             G  LFL+ K+K+LKI AFK SS N+  G   + +K     + +  +   SEE+SVES +
Sbjct  56   IGGSLFLEQKSKLLKISAFKGSSLNDDSGGRANGSKSPKNAVKVYYLQNKSEESSVESSK  115

Query  562  AQNL-PISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
             QN+ P  YT+E  +TT+ +LAIQ +FK+WL +L TP+
Sbjct  116  VQNVVPAPYTAED-ETTTRSLAIQNLFKNWLTLLCTPT  152



>ref|XP_011046164.1| PREDICTED: uncharacterized protein LOC105140850 isoform X2 [Populus 
euphratica]
Length=340

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 90/148 (61%), Gaps = 8/148 (5%)
 Frame = +1

Query  235  QHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSGGAPLFLKP  414
            Q SY T P +  S S G KL + VT ++ VGRKD      C S    +  S GA     P
Sbjct  6    QGSYATLPSRPLSWSKGVKLKQRVTELQMVGRKDM-----CFSVKHSLRLSAGA-FSHGP  59

Query  415  KAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRAQNLPISYT  588
            K K+L++ AFK S+QN+     ++GSK  K+S+KLS V + S ET ++S +  ++P+SYT
Sbjct  60   KVKLLRVSAFKGSAQNDESGGRANGSKVSKKSVKLSYVPKESGETMMDSSKVHSIPVSYT  119

Query  589  SETVDTTSGTLAIQKIFKHWLAILRTPS  672
            SE  +  +G+ AI K+FK WL++LRT S
Sbjct  120  SEANERIAGSPAINKLFKKWLSMLRTQS  147



>ref|XP_011046177.1| PREDICTED: uncharacterized protein LOC105140855 isoform X2 [Populus 
euphratica]
Length=340

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 90/148 (61%), Gaps = 8/148 (5%)
 Frame = +1

Query  235  QHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSGGAPLFLKP  414
            Q SY T P +  S S G KL + VT ++ VGRKD      C S    +  S GA     P
Sbjct  6    QGSYATFPSRPLSWSKGVKLKQRVTELQMVGRKDM-----CFSVKHSLRLSAGA-FSHGP  59

Query  415  KAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRAQNLPISYT  588
            K K+L++ AFK S+QN+     ++GSK  K+S+KLS V + S ET ++S +  ++P+SYT
Sbjct  60   KVKLLRVSAFKGSAQNDESGGRANGSKVSKKSVKLSYVPKESGETMMDSSKVHSIPVSYT  119

Query  589  SETVDTTSGTLAIQKIFKHWLAILRTPS  672
            SE  +  +G+ AI K+FK WL++LRT S
Sbjct  120  SEANERIAGSPAINKLFKKWLSMLRTQS  147



>ref|NP_001190603.1| protein EMBRYO DEFECTIVE 2759 [Arabidopsis thaliana]
 gb|AED97692.1| embryo defective 2759 protein [Arabidopsis thaliana]
Length=339

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 82/149 (55%), Gaps = 7/149 (5%)
 Frame = +1

Query  232  LQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSGGAPLFLK  411
            ++ S+  +P+ S + + G  L R VTTV +V RKDK   LK +  +     S G+P    
Sbjct  2    IEGSHVLSPWSSPTWTRGLCLKRPVTTVHFVERKDKHLRLKQKCCF-----SLGSPCNGG  56

Query  412  PKAKVLKILAFksssqnnsggssg--sktkkesikLSIVSQGSEETSVESPRAQNLPISY  585
             +AK  ++ +FK   QNN  G S    K    S+KLS  S   E     SP+AQN   SY
Sbjct  57   LRAKPFRVTSFKGGIQNNESGGSEGGKKVTNNSVKLSYRSDDDENNVNGSPKAQNTSFSY  116

Query  586  TSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            TSET D+ +G  AIQK+FK WL +LRT S
Sbjct  117  TSETEDSMTGQPAIQKLFKKWLTLLRTQS  145



>ref|XP_007209326.1| hypothetical protein PRUPE_ppa008249mg [Prunus persica]
 gb|EMJ10525.1| hypothetical protein PRUPE_ppa008249mg [Prunus persica]
Length=339

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 83/154 (54%), Gaps = 7/154 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S S G KL + VTT   VGR D    LK     R +  S 
Sbjct  1    MALVTHQMQGSYVTYPSRPLSWSKGLKLKQYVTTHHMVGRTDNCIMLK-----RNICLSV  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
            GA L    K K L++ AFK S+QN+  G   S +K      S+  + +E+T   SP+  +
Sbjct  56   GASLMRGSKVKPLRVSAFKGSAQNDKSGGRTSGSKLPKN--SVKLKENEDTLTGSPQEND  113

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +P+SY SE  ++ + +  I K+FK WL +LRT S
Sbjct  114  MPLSYASEANESIASSPVIHKLFKKWLRMLRTQS  147



>ref|XP_008245000.1| PREDICTED: uncharacterized protein LOC103343102 isoform X2 [Prunus 
mume]
Length=339

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 83/154 (54%), Gaps = 7/154 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +  S S G KL + VTT   VGR D    LK     R +  S 
Sbjct  1    MALVTHQMQGSYVTYPSRPLSWSKGLKLKQYVTTHHMVGRTDNCIMLK-----RNICLSV  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
            GA L    K K L++ AFK S+QN+  G   S +K      S+  + +E+T   SP+  +
Sbjct  56   GASLMRGSKVKPLRVSAFKGSAQNDKSGGRTSGSKLPKN--SVKLKENEDTLTGSPQEND  113

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +P+SY SE  ++ + +  I K+FK WL +LRT S
Sbjct  114  MPLSYASEANESIASSPVIHKLFKKWLRMLRTQS  147



>gb|EYU17699.1| hypothetical protein MIMGU_mgv1a009574mg [Erythranthe guttata]
Length=337

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 83/154 (54%), Gaps = 10/154 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MA AT  L+ S  T P   SS S G+KL     T   VGRKD+F SLKCRS      CS 
Sbjct  1    MASATHQLKGSCSTFPSVPSSWSRGSKLKHFAPTFHSVGRKDRFISLKCRS------CSS  54

Query  391  -GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQ  567
             GA   L  K+   KI AF   S + +     + + K++ K+  +    E +S+ES + Q
Sbjct  55   VGASRVLGSKSNSFKISAF-KGSNSYNDSGIRTNSSKDNGKVGYLENTIEASSLESSKVQ  113

Query  568  NLPISYTSETVDTTSGTLAIQKIFKHWLAILRTP  669
            N+  S  ++  +T S +LAIQ +FK WL +LRTP
Sbjct  114  NVTPSTAAD--ETISRSLAIQNLFKSWLMLLRTP  145



>gb|KJB08225.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
Length=307

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 77/157 (49%), Gaps = 10/157 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ S+ + P +  S   G  L R V TV  +GR++       R   R+ VCS 
Sbjct  1    MVLLTHQLQDSHISFPSRPLSRGKGLTLKRHVVTVHMLGRRE-------RGISRHSVCSS  53

Query  391  -GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSI--VSQGSEETSVESPR  561
             GAP     K K + I  FK S QNN      +        + +  V +  EET +ES  
Sbjct  54   IGAPHTCGSKVKNVGISTFKGSGQNNESRGRTNNAFLSKNTIKVSYVPKDREETMIESSN  113

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
              N+P++Y SET +   G+ AIQK+FK W+ IL + S
Sbjct  114  VHNVPLAYASETSENHLGSPAIQKLFKKWIMILLSQS  150



>ref|XP_006439864.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53104.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
Length=335

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 88/150 (59%), Gaps = 9/150 (6%)
 Frame = +1

Query  235  QHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSGGAPLFLKP  414
            Q SY   P +  S + G  L R VTTV  VG+K++     C S+ R    S G P     
Sbjct  6    QGSYVAFPSRRLSWNKGLILRRCVTTVHMVGKKEQ-----CLSWKRNFCLSVGTPHKCGV  60

Query  415  KAKVLKI--LAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRAQNLPIS  582
            K K +KI   AFK S+QN+     +SGSK  K S+KLS + + SEET  ES  A N+P+S
Sbjct  61   KVKSVKISFTAFKGSAQNDESGGRASGSKDPKNSVKLSYIPKESEETVTESSEAHNVPLS  120

Query  583  YTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            Y S+T ++ +G+ AI+K+FK WL +LRT S
Sbjct  121  YASKTNESIAGSPAIRKLFKKWLTLLRTQS  150



>ref|XP_010027415.1| PREDICTED: uncharacterized protein LOC104417915 [Eucalyptus grandis]
 gb|KCW83317.1| hypothetical protein EUGRSUZ_B00249 [Eucalyptus grandis]
 gb|KCW83318.1| hypothetical protein EUGRSUZ_B00249 [Eucalyptus grandis]
 gb|KCW83319.1| hypothetical protein EUGRSUZ_B00249 [Eucalyptus grandis]
Length=336

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 85/155 (55%), Gaps = 10/155 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T   Q SY   P +  S S    L R       VG  D+  SLK      +V+   
Sbjct  1    MALVTHQFQGSYVAFPSRHLSLSKVLTLRRCYV----VGETDRPLSLK-----HHVLLRV  51

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgs-ktkkesikLSIVSQGSEETSVESPRAQ  567
             +P F   + K L+I +FK S+QN+      +  T K S+KLS +   S+E  VESP+AQ
Sbjct  52   TSPRFSASRVKCLRISSFKGSAQNDESSGRANGTTSKSSVKLSYLPNESDENIVESPKAQ  111

Query  568  NLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            N+P+SYTSE  ++  G+ AIQK+F+ WL +LRT S
Sbjct  112  NVPVSYTSEADESIGGSPAIQKLFRKWLTMLRTRS  146



>ref|XP_011071910.1| PREDICTED: uncharacterized protein LOC105157246 isoform X6 [Sesamum 
indicum]
Length=216

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 78/131 (60%), Gaps = 9/131 (7%)
 Frame = +1

Query  283  GNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSGGAPLFLKPKAKVLKILAFksssqn  462
            G+K+   + T + VGRKD+  SLKCRS+      S G+ L L PK+K  KI AFK SS++
Sbjct  44   GSKVKHFLPTFQ-VGRKDRLISLKCRSY-----SSVGSSLVLGPKSKSFKISAFKGSSRH  97

Query  463  nsggssgsktkkesikLSIVS-QGSEETSVESPRAQNL-PISYTSETVDTTSGTLAIQKI  636
            +  G   + +K     + +   Q   E+ +ES + QN+ P SYT+    TT+ +LAIQ +
Sbjct  98   DDSGGRANGSKSLKNPVKVSYLQQEGESPLESSKVQNVVPASYTAAD-GTTTRSLAIQNL  156

Query  637  FKHWLAILRTP  669
            FK WL +LRTP
Sbjct  157  FKKWLILLRTP  167



>emb|CAN66425.1| hypothetical protein VITISV_007985 [Vitis vinifera]
Length=307

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = +1

Query  385  SGGAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESP  558
            S G P    PK + LKI AFK S+QN+     +SGSK+ K S++LS   QG+EET  ESP
Sbjct  18   SVGTPCVRVPKRRPLKICAFKGSAQNDESGGRASGSKSPKNSVRLSYAPQGNEETITESP  77

Query  559  RAQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            ++QN+P+ Y+SE   T  G+LAIQ +FK WL +LRT S
Sbjct  78   KSQNVPLPYSSEANGTIGGSLAIQNLFKKWLTMLRTQS  115



>gb|KJB53102.1| hypothetical protein B456_008G293700 [Gossypium raimondii]
 gb|KJB53103.1| hypothetical protein B456_008G293700 [Gossypium raimondii]
 gb|KJB53104.1| hypothetical protein B456_008G293700 [Gossypium raimondii]
Length=342

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 80/156 (51%), Gaps = 8/156 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ SY   P +      G  L R V T+  +GR+++  SL+    +   +C G
Sbjct  1    MMLVTHQLQGSYVACPSRPLLWRKGLTLKRPVVTLHMLGRRERSISLR----HSTCLCIG  56

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSI--VSQGSEETSVESPRA  564
                 L  K+  ++I AFK S +N   G+           + +  V +  E T++ES +A
Sbjct  57   AHTCGLNTKS--IRISAFKGSVENGESGARAIDENVPKSSIKVSYVPKDGEATTIESSKA  114

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
             N P++Y+SET +   G+ AIQ++FK W+ ILR+ S
Sbjct  115  HNGPVTYSSETGENIVGSAAIQELFKKWIMILRSQS  150



>gb|EYU22149.1| hypothetical protein MIMGU_mgv1a009494mg [Erythranthe guttata]
 gb|EYU22150.1| hypothetical protein MIMGU_mgv1a009494mg [Erythranthe guttata]
 gb|EYU22151.1| hypothetical protein MIMGU_mgv1a009494mg [Erythranthe guttata]
Length=340

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 90/155 (58%), Gaps = 8/155 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T   Q S  T P   SS S G+K+T  + T R V RKD+  SLKCRS       S 
Sbjct  2    MALTTNQFQGSCSTFPSMPSSWSRGSKITHFLPTFRPVCRKDRIISLKCRSH-----SSV  56

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
             + + L  K+K  KILAFK SS+N+  G  GS        +S +   SEE+SVESP  Q 
Sbjct  57   ESSVALGLKSKPFKILAFKGSSRNDDSGGRGSLKNPVK--VSYLQHESEESSVESPNVQK  114

Query  571  L-PISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            + P SYT    +TT+ +LAIQ +F++WL +LRTPS
Sbjct  115  VVPASYTEAADETTTRSLAIQNLFRNWLMLLRTPS  149



>gb|KJB08224.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
 gb|KJB08226.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
 gb|KJB08227.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
Length=342

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 77/157 (49%), Gaps = 10/157 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ S+ + P +  S   G  L R V TV  +GR++       R   R+ VCS 
Sbjct  1    MVLLTHQLQDSHISFPSRPLSRGKGLTLKRHVVTVHMLGRRE-------RGISRHSVCSS  53

Query  391  -GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSI--VSQGSEETSVESPR  561
             GAP     K K + I  FK S QNN      +        + +  V +  EET +ES  
Sbjct  54   IGAPHTCGSKVKNVGISTFKGSGQNNESRGRTNNAFLSKNTIKVSYVPKDREETMIESSN  113

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
              N+P++Y SET +   G+ AIQK+FK W+ IL + S
Sbjct  114  VHNVPLAYASETSENHLGSPAIQKLFKKWIMILLSQS  150



>gb|KDP31068.1| hypothetical protein JCGZ_11444 [Jatropha curcas]
Length=343

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 87/155 (56%), Gaps = 9/155 (6%)
 Frame = +1

Query  211  MALATLHLQH-SYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCS  387
            MAL T  +Q  SY T P +  S S G KL + V+T+   GR D+ + +K         C 
Sbjct  1    MALVTHQMQQGSYTTFPMRPLSWSKGFKLKQHVSTLHMFGRIDRRSPIKRNIRLSVGACV  60

Query  388  GGAPLFLKPKAKVLKILAFksssqnnsggssg--sktkkesikLSIVSQGSEETSVESPR  561
             G+ L      K+LKI AFK S +N+  G+    SK  K S+K+S V + S ET + SP+
Sbjct  61   NGSRL------KLLKIAAFKGSVRNDESGNRANGSKVSKNSVKVSYVPKESGETIMGSPK  114

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRT  666
              ++P+SYTSE  +  +G+  I K+FK WL +LRT
Sbjct  115  VHSVPVSYTSEANEGIAGSPVIHKLFKKWLNMLRT  149



>ref|XP_011071904.1| PREDICTED: uncharacterized protein LOC105157246 isoform X1 [Sesamum 
indicum]
Length=359

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 78/131 (60%), Gaps = 9/131 (7%)
 Frame = +1

Query  283  GNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSGGAPLFLKPKAKVLKILAFksssqn  462
            G+K+   + T + VGRKD+  SLKCRS+      S G+ L L PK+K  KI AFK SS++
Sbjct  44   GSKVKHFLPTFQ-VGRKDRLISLKCRSY-----SSVGSSLVLGPKSKSFKISAFKGSSRH  97

Query  463  nsggssgsktkkesikLSI-VSQGSEETSVESPRAQNL-PISYTSETVDTTSGTLAIQKI  636
            +  G   + +K     + +   Q   E+ +ES + QN+ P SYT+    TT+ +LAIQ +
Sbjct  98   DDSGGRANGSKSLKNPVKVSYLQQEGESPLESSKVQNVVPASYTAAD-GTTTRSLAIQNL  156

Query  637  FKHWLAILRTP  669
            FK WL +LRTP
Sbjct  157  FKKWLILLRTP  167



>ref|XP_011071905.1| PREDICTED: uncharacterized protein LOC105157246 isoform X2 [Sesamum 
indicum]
Length=355

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 78/131 (60%), Gaps = 9/131 (7%)
 Frame = +1

Query  283  GNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSGGAPLFLKPKAKVLKILAFksssqn  462
            G+K+   + T + VGRKD+  SLKCRS+      S G+ L L PK+K  KI AFK SS++
Sbjct  40   GSKVKHFLPTFQ-VGRKDRLISLKCRSY-----SSVGSSLVLGPKSKSFKISAFKGSSRH  93

Query  463  nsggssgsktkkesikLSI-VSQGSEETSVESPRAQNL-PISYTSETVDTTSGTLAIQKI  636
            +  G   + +K     + +   Q   E+ +ES + QN+ P SYT+    TT+ +LAIQ +
Sbjct  94   DDSGGRANGSKSLKNPVKVSYLQQEGESPLESSKVQNVVPASYTAAD-GTTTRSLAIQNL  152

Query  637  FKHWLAILRTP  669
            FK WL +LRTP
Sbjct  153  FKKWLILLRTP  163



>ref|XP_011040478.1| PREDICTED: uncharacterized protein LOC105136723 isoform X2 [Populus 
euphratica]
Length=339

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 83/148 (56%), Gaps = 8/148 (5%)
 Frame = +1

Query  235  QHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSGGAPLFLKP  414
            Q SY T P +  S S G KL   V T++  GR +      C      ++ S GA   L P
Sbjct  6    QGSYATFPSRPLSWSKGVKLKPHVMTLQMFGRTNM-----CFPVKHSLLLSAGA-FALGP  59

Query  415  KAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESPRAQNLPISYT  588
            K K+L+I AFK ++QN+      +GS+  +  +KLS V + S ET + S +   +P+SYT
Sbjct  60   KVKLLRISAFKGTAQNDESGGRKNGSRVSRNYVKLSYVPKESGETIINSSKVHTIPVSYT  119

Query  589  SETVDTTSGTLAIQKIFKHWLAILRTPS  672
            SE +D  + + AI K+FK WL++LRT S
Sbjct  120  SEAIDRIAVSPAINKLFKKWLSMLRTQS  147



>gb|KHG29598.1| recA [Gossypium arboreum]
Length=342

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 73/157 (46%), Gaps = 10/157 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ S    P +  S   G  L R V TV  +GR++       R   R+  CS 
Sbjct  1    MVLLTHQLQDSQIAFPSRPLSRGKGLTLKRHVVTVHMLGRRE-------RGISRHSACSS  53

Query  391  -GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSI--VSQGSEETSVESPR  561
             GAP     K K + I  FK S  NN      +        + +  V +  EET +ES  
Sbjct  54   IGAPHTYGSKVKNVGISTFKGSGLNNELRGRTNNAFLSKNTIKVSYVPKDREETMIESSN  113

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
              N+P++Y SET +   G+ AIQK+FK W+ IL + S
Sbjct  114  VHNVPLAYASETSENHLGSPAIQKLFKKWIMILLSQS  150



>gb|KHG08396.1| Adenylosuccinate synthetase [Gossypium arboreum]
Length=354

 Score = 54.3 bits (129),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  511  LSIVSQGSEETSVESPRAQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +S V +  E T++ES +A N P++Y+SET +   G+ AIQ++FK W+ ILR+ S
Sbjct  109  VSYVPKDGEATTIESSKAHNGPVTYSSETGENIVGSAAIQELFKKWIMILRSQS  162


 Score = 30.0 bits (66),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 29/61 (48%), Gaps = 2/61 (3%)
 Frame = +3

Query  219  GNPSFAAFL*NKSFSIFIVEQWEQIDTFCDNGSLCWEER*IYLIEVQILL--*ICGLQWR  392
            G+PS A F+ +  F  FI+E    +   C   S  WE+   ++I+    +    CGL  +
Sbjct  18   GDPSIAGFICSMPFKAFIMEGRIDVKETCSYTSYAWEKGEEHIIKALYFIGAHTCGLNTK  77

Query  393  S  395
            S
Sbjct  78   S  78



>ref|XP_008782690.1| PREDICTED: uncharacterized protein LOC103702154 [Phoenix dactylifera]
Length=340

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 79/154 (51%), Gaps = 10/154 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL     Q SY T   +      G + + +    +++GRKD+F  LK R  +R      
Sbjct  1    MALLAHQTQGSYLTYSLRPKELIHGVRWS-TCAAFQFIGRKDEFIPLKHRFHFR------  53

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQ-GSEETSVESPRAQ  567
            G P+ L+ K +  K+  FK ++QN+   +  S +      + + +Q  SEE   +S   Q
Sbjct  54   GRPIILQ-KGRAFKVSYFKGNAQNDEPEARDSCSTFPKAPVQLSTQEDSEEILSDSHNVQ  112

Query  568  NLPISYTSE-TVDTTSGTLAIQKIFKHWLAILRT  666
              P+SY  E   DT +G+LAIQK+F+ WL +LRT
Sbjct  113  KHPLSYAPEGREDTRAGSLAIQKLFRKWLIMLRT  146



>ref|XP_009150435.1| PREDICTED: uncharacterized protein LOC103873787 [Brassica rapa]
Length=325

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 71/156 (46%), Gaps = 27/156 (17%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFY--RYVVC  384
            M L T  LQ S+   P+ S   + G      VTTV + GRK+K   LK +SF    +   
Sbjct  1    MVLVTHKLQSSHVLFPWSSPKWTKGLVTKTPVTTVHFAGRKEKLLRLKAKSFRVTSFKGE  60

Query  385  SGGAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRA  564
            SGG+    K                          T   S+KLS  S   E     S ++
Sbjct  61   SGGSERGKK-------------------------ATNNNSVKLSYRSDDVENNVDSSSKS  95

Query  565  QNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            QN  +SYTSET D+ +G  AIQK+FK WL++L T S
Sbjct  96   QNTSVSYTSETEDSITGQPAIQKLFKKWLSLLLTQS  131



>ref|XP_010942418.1| PREDICTED: uncharacterized protein LOC105060428 [Elaeis guineensis]
Length=340

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 70/125 (56%), Gaps = 9/125 (7%)
 Frame = +1

Query  298  RSVTTVRYVGRKDKFTSLKCRSFYRYVVCSGGAPLFLKPKAKVLKILAFksssqnnsggs  477
            RS    +++GRKD+F  LK R  +R      G P+ +  K +  K+ +FK ++Q++   +
Sbjct  29   RSCAAFQFIGRKDEFIPLKHRLHFR------GRPI-ISQKRRAFKVSSFKGNAQHDEPEA  81

Query  478  sgsktkkesikLSIVSQG-SEETSVESPRAQNLPISYTSE-TVDTTSGTLAIQKIFKHWL  651
              S +K     + + +Q  SEE   +S   Q  P+SY  E   DT +G+LAIQK+F+ WL
Sbjct  82   RDSCSKFLKAPVQLSTQDDSEEILSDSHNGQQHPLSYAPEGREDTRAGSLAIQKLFRKWL  141

Query  652  AILRT  666
             +LRT
Sbjct  142  IMLRT  146



>gb|KDO69572.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69573.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
Length=290

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  511  LSIVSQGSEETSVESPRAQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            LS + + SEET  ES  A N+P+SY S+T ++ +G+ AI+K+FK WL +LRT S
Sbjct  64   LSYIPKESEETVTESSEAHNVPLSYASKTNESIAGSPAIRKLFKKWLTLLRTQS  117



>ref|XP_010102523.1| hypothetical protein L484_014579 [Morus notabilis]
 gb|EXB93587.1| hypothetical protein L484_014579 [Morus notabilis]
Length=327

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 75/154 (49%), Gaps = 15/154 (10%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T  +Q SY T P +      G K  R VTTV    R D+   LK        +C  
Sbjct  1    MALVTHQMQGSYVTLPSRPLPWIKGVKWKRYVTTVHVAARTDRPFLLKGN------IC--  52

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
                 L+PK K L+I AFK S+QN   G   S +K      SI  + SE    ES +A  
Sbjct  53   -----LRPKLKALRISAFKGSAQNGEPGGRASGSKTAKN--SIKLKESEGAITESTQANE  105

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            + +SYT+E  ++   + AI ++FK WL  LRT S
Sbjct  106  ISLSYTAEANESVGPSPAIHELFKKWLTNLRTQS  139



>ref|XP_008438584.1| PREDICTED: uncharacterized protein LOC103483645 isoform X1 [Cucumis 
melo]
Length=340

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 75/154 (49%), Gaps = 11/154 (7%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLK---CRSFYRYVV  381
            MAL T H Q SY     + S  +    L + VT+VR VGR +  T L+   C SF     
Sbjct  1    MALITHHPQGSYAELSSRLSFWNGSLNLKQRVTSVRTVGRTEHHTPLRSNICFSF-----  55

Query  382  CSGGAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPR  561
             S G P    P+  +L++ AFKS+++ +      +   K +     +  G  +   E+P+
Sbjct  56   -SIGTPRLCGPRPNLLRVSAFKSAARIDDETGGVANGSKITSYPVKLKDG--DYCTETPK  112

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILR  663
              N+P+ Y S   +  + + AIQ +FK WL +LR
Sbjct  113  GNNVPVCYASGANEDIAPSPAIQNLFKKWLELLR  146



>emb|CDX84380.1| BnaC03g51200D [Brassica napus]
Length=322

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 72/154 (47%), Gaps = 23/154 (15%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ S+   P+ S + + G      VTTV + GRK+K   LK +S  R     G
Sbjct  1    MVLVTHKLQSSHVLFPWSSPTWTKG-----LVTTVHFAGRKEKHLRLKAKSL-RVTSFKG  54

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
            G  +     ++  K                   T   S+KLS  S   E     S ++QN
Sbjct  55   GIQISESGGSERGK-----------------KATNNNSVKLSYRSDDVENNVDSSSKSQN  97

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
              +SYTSET D+ +G  AIQK+FK WL++L T S
Sbjct  98   TSVSYTSETEDSVTGQPAIQKLFKKWLSLLLTQS  131



>ref|XP_010545998.1| PREDICTED: uncharacterized protein LOC104818212 [Tarenaya hassleriana]
Length=343

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 77/154 (50%), Gaps = 11/154 (7%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLK--CRSFYRYVVC  384
            M L T  LQ S    P  S + S G  L + V  V  VGRK+++  L+  CR        
Sbjct  1    MVLVTHKLQGSQILFPRSSPTWSEGLFLRQPVARVNVVGRKEEYLRLRQPCR-------L  53

Query  385  SGGAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQGSEETSVESP  558
            S GAP   + KAK   + +FK    N+      +G+K    S+KLS      E     SP
Sbjct  54   SLGAPCNGRLKAKPFGVTSFKGGIHNSDIGGSENGTKVTNNSVKLSYHHDDDENNLKGSP  113

Query  559  RAQNLPISYTSETVDTTSGTLAIQKIFKHWLAIL  660
            +AQN  +SYTS+  D+ SG  +IQK+FK WL +L
Sbjct  114  KAQNRSLSYTSDPEDSISGQPSIQKLFKKWLTML  147



>ref|XP_008787334.1| PREDICTED: uncharacterized protein LOC103705411 isoform X2 [Phoenix 
dactylifera]
Length=218

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 79/153 (52%), Gaps = 10/153 (7%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL     Q SY T+  ++ + +   +  RS    +++GRKDKF  LK R  +R      
Sbjct  1    MALLAHQAQGSYSTHSLRAKALTHEVRW-RSFVAFQFIGRKDKFIPLKLRFHFR------  53

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGS-EETSVESPRAQ  567
              P+ L  K K  K+ +FK ++QN+      S +K     + + +Q   EE   +S   Q
Sbjct  54   DEPIIL-AKRKAFKVSSFKGNAQNDEREGRDSGSKFRKAPVQLSAQQEREEILSDSHDVQ  112

Query  568  NLPISYTSE-TVDTTSGTLAIQKIFKHWLAILR  663
               +SY  E   +TT+G+LAIQ++F+ WL +LR
Sbjct  113  KHLLSYAPEGREETTAGSLAIQEVFRKWLIMLR  145



>ref|XP_008346734.1| PREDICTED: uncharacterized protein LOC103409711 isoform X1 [Malus 
domestica]
Length=337

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 9/154 (6%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL    +Q +Y T P +  S S G KL + VTT + V  +      +C    R +  S 
Sbjct  1    MALVVHQMQGTYVTYPSRPLSWSKGMKLKQCVTTHQMVRTE------RCFILKRNLCLSV  54

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
            GA L   PK K  ++ AFK S+QN+  G     +K       +      E ++   +A +
Sbjct  55   GASLMRGPKVKPFRVSAFKGSAQNDKSGGRTRGSKLPKNSAKL---KENEDTITKSQAND  111

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +P+SY SE  ++ + +  I  +FK WL +LRTPS
Sbjct  112  IPLSYASEANESIASSPIIHNLFKKWLRMLRTPS  145



>emb|CDY00350.1| BnaA06g22510D [Brassica napus]
Length=324

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 71/157 (45%), Gaps = 30/157 (19%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFY--RYVVC  384
            M L T  LQ S+   P+ S   + G      VTTV + GRK+K   LK +SF    +   
Sbjct  1    MVLVTHKLQSSHVLFPWSSPKWTKGLVTKTPVTTVHFAGRKEKLLRLKAKSFRVTSFKGE  60

Query  385  SGGAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESP-R  561
            SGG+    K                              +  + +  +   E +V+S  +
Sbjct  61   SGGSERGKK---------------------------ATNNNSVKLSYRSDVENNVDSSSK  93

Query  562  AQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +QN  +SYTSET D+ +G  AIQK+FK WL++L T S
Sbjct  94   SQNTSVSYTSETEDSITGQPAIQKLFKKWLSLLLTQS  130



>emb|CDX72055.1| BnaC08g28190D [Brassica napus]
Length=294

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 72/154 (47%), Gaps = 23/154 (15%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            M L T  LQ S+   P+ S + + G      VTTV + GRK+K   LK +S  R     G
Sbjct  1    MVLVTHKLQSSHVLFPWSSPTWTKG-----LVTTVHFAGRKEKHLRLKAKSL-RVTSFKG  54

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
            G  +                 S++         T   S+KLS  S   E     S ++QN
Sbjct  55   GFQI-----------------SESGGRERGKKATNNNSVKLSYRSDDIENNVDSSSKSQN  97

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
              +SYTSET D+ +G  AIQK+FK WL++L T S
Sbjct  98   TSVSYTSETEDSITGQPAIQKLFKKWLSLLLTQS  131



>ref|XP_007036303.1| Embryo defective 2759 isoform 2, partial [Theobroma cacao]
 gb|EOY20804.1| Embryo defective 2759 isoform 2, partial [Theobroma cacao]
Length=290

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 58/98 (59%), Gaps = 2/98 (2%)
 Frame = +1

Query  385  SGGAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSI--VSQGSEETSVESP  558
            S GAP     KAK ++I AFK S+Q+N  G   +        + +  V +  EET++ES 
Sbjct  1    STGAPRTRGLKAKNIRISAFKGSAQSNESGGRANDASVPKNSIKVAYVPKDGEETTIESS  60

Query  559  RAQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
            +A N  ++Y SET +T  G+ AIQK+FK W+ ILR+ S
Sbjct  61   KAHNGQLAYASETSETIVGSPAIQKLFKKWIMILRSQS  98



>ref|XP_008438592.1| PREDICTED: uncharacterized protein LOC103483645 isoform X2 [Cucumis 
melo]
Length=338

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 73/151 (48%), Gaps = 7/151 (5%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL T H Q SY     + S  +    L + VT+VR VGR +  T L+       +  S 
Sbjct  1    MALITHHPQGSYAELSSRLSFWNGSLNLKQRVTSVRTVGRTEHHTPLRSN-----ICFSI  55

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGSEETSVESPRAQN  570
            G P    P+  +L++ AFKS+++ +      +   K +     +  G  +   E+P+  N
Sbjct  56   GTPRLCGPRPNLLRVSAFKSAARIDDETGGVANGSKITSYPVKLKDG--DYCTETPKGNN  113

Query  571  LPISYTSETVDTTSGTLAIQKIFKHWLAILR  663
            +P+ Y S   +  + + AIQ +FK WL +LR
Sbjct  114  VPVCYASGANEDIAPSPAIQNLFKKWLELLR  144



>ref|XP_011040479.1| PREDICTED: uncharacterized protein LOC105136723 isoform X3 [Populus 
euphratica]
Length=310

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 65/108 (60%), Gaps = 3/108 (3%)
 Frame = +1

Query  355  CRSFYRYVVCSGGAPLFLKPKAKVLKILAFksssqnnsg--gssgsktkkesikLSIVSQ  528
            C      ++ S GA   L PK K+L+I AFK ++QN+      +GS+  +  +KLS V +
Sbjct  12   CFPVKHSLLLSAGA-FALGPKVKLLRISAFKGTAQNDESGGRKNGSRVSRNYVKLSYVPK  70

Query  529  GSEETSVESPRAQNLPISYTSETVDTTSGTLAIQKIFKHWLAILRTPS  672
             S ET + S +   +P+SYTSE +D  + + AI K+FK WL++LRT S
Sbjct  71   ESGETIINSSKVHTIPVSYTSEAIDRIAVSPAINKLFKKWLSMLRTQS  118



>ref|XP_010278054.1| PREDICTED: uncharacterized protein LOC104612361 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010278055.1| PREDICTED: uncharacterized protein LOC104612361 isoform X1 [Nelumbo 
nucifera]
Length=335

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 82/157 (52%), Gaps = 13/157 (8%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL    +Q SY T P +  S +   KL      ++ VG+ D+     C +  + +  S 
Sbjct  1    MALIAYQMQSSYATFPLRPLSWTRCMKLKP--VALQLVGKLDR-----CGASKQNLFLSI  53

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssg--sktkkesikLSIVSQGSEETSVESPRA  564
            GAP  L+P  +  +++AFK S+QN+  G      K  K ++KLS V    EET  E    
Sbjct  54   GAPCMLEPSKRNFRVIAFKGSAQNDESGDRSGGCKFPKNNVKLSYVPHDGEETLTEPADR  113

Query  565  QNLPISYTSET-VDTTSGTLAIQKIFKHWLAILRTPS  672
            + +   YTSE   D+  G++AIQK+FK WL +LRT S
Sbjct  114  EKV---YTSEDGQDSLVGSIAIQKLFKKWLMMLRTQS  147



>ref|XP_008787333.1| PREDICTED: uncharacterized protein LOC103705411 isoform X1 [Phoenix 
dactylifera]
Length=340

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 79/153 (52%), Gaps = 10/153 (7%)
 Frame = +1

Query  211  MALATLHLQHSYKTNPFQssssssGNKLTRSVTTVRYVGRKDKFTSLKCRSFYRYVVCSG  390
            MAL     Q SY T+  ++ + +   +  RS    +++GRKDKF  LK R  +R      
Sbjct  1    MALLAHQAQGSYSTHSLRAKALTHEVRW-RSFVAFQFIGRKDKFIPLKLRFHFR------  53

Query  391  GAPLFLKPKAKVLKILAFksssqnnsggssgsktkkesikLSIVSQGS-EETSVESPRAQ  567
              P+ L  K K  K+ +FK ++QN+      S +K     + + +Q   EE   +S   Q
Sbjct  54   DEPIIL-AKRKAFKVSSFKGNAQNDEREGRDSGSKFRKAPVQLSAQQEREEILSDSHDVQ  112

Query  568  NLPISYTSE-TVDTTSGTLAIQKIFKHWLAILR  663
               +SY  E   +TT+G+LAIQ++F+ WL +LR
Sbjct  113  KHLLSYAPEGREETTAGSLAIQEVFRKWLIMLR  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600