BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024M09

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620725.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    258   4e-80   Nicotiana tomentosiformis
ref|XP_009794621.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    255   7e-79   Nicotiana sylvestris
emb|CAN73821.1|  hypothetical protein VITISV_014805                     254   1e-78   Vitis vinifera
ref|XP_002270329.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    254   2e-78   Vitis vinifera
ref|XP_002514787.1|  Anthranilate N-benzoyltransferase protein, p...    251   2e-77   Ricinus communis
emb|CAT00084.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    241   1e-74   Coffea arabica [arabica coffee]
ref|XP_007028077.1|  HXXXD-type acyl-transferase family protein         241   2e-73   
emb|CDP20135.1|  unnamed protein product                                241   2e-73   Coffea canephora [robusta coffee]
ref|XP_004250074.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    239   8e-73   Solanum lycopersicum
gb|KJB26880.1|  hypothetical protein B456_004G264500                    236   9e-72   Gossypium raimondii
ref|XP_010038444.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    233   3e-70   Eucalyptus grandis [rose gum]
ref|XP_006353264.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    232   7e-70   Solanum tuberosum [potatoes]
ref|XP_006480697.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    231   2e-69   Citrus sinensis [apfelsine]
ref|XP_006425205.1|  hypothetical protein CICLE_v10010861mg             231   2e-69   Citrus clementina [clementine]
gb|KDP26918.1|  hypothetical protein JCGZ_18076                         230   2e-69   Jatropha curcas
gb|KDO45315.1|  hypothetical protein CISIN_1g012689mg                   230   2e-69   Citrus sinensis [apfelsine]
gb|KHG26258.1|  Omega-hydroxypalmitate O-feruloyl transferase -li...    230   3e-69   Gossypium arboreum [tree cotton]
ref|XP_006301983.1|  hypothetical protein CARUB_v10022464mg             228   1e-68   Capsella rubella
ref|XP_003548796.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    228   2e-68   Glycine max [soybeans]
ref|XP_010415082.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    227   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006391555.1|  hypothetical protein EUTSA_v10018535mg             225   2e-67   Eutrema salsugineum [saltwater cress]
ref|NP_564853.2|  dual transcription unit and alternative splicin...    225   2e-67   Arabidopsis thaliana [mouse-ear cress]
gb|ACU13324.1|  unknown                                                 219   2e-67   Glycine max [soybeans]
ref|XP_011077121.1|  PREDICTED: LOW QUALITY PROTEIN: omega-hydrox...    224   5e-67   
ref|XP_003553994.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    223   1e-66   Glycine max [soybeans]
gb|KHN46377.1|  Omega-hydroxypalmitate O-feruloyl transferase           223   1e-66   Glycine soja [wild soybean]
ref|XP_008218487.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    224   2e-66   Prunus mume [ume]
ref|XP_007205121.1|  hypothetical protein PRUPE_ppa004875mg             224   2e-66   Prunus persica
ref|XP_002886918.1|  hypothetical protein ARALYDRAFT_315582             223   2e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_004493124.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    222   3e-66   Cicer arietinum [garbanzo]
ref|XP_010511440.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    222   3e-66   
ref|XP_010241521.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    221   6e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010673872.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    221   9e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010268237.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    218   8e-65   Nelumbo nucifera [Indian lotus]
gb|KHN13415.1|  Omega-hydroxypalmitate O-feruloyl transferase           218   9e-65   Glycine soja [wild soybean]
emb|CDY39285.1|  BnaC06g27060D                                          218   1e-64   Brassica napus [oilseed rape]
ref|XP_003548930.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    218   1e-64   Glycine max [soybeans]
ref|XP_009127402.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    218   2e-64   Brassica rapa
emb|CDY16408.1|  BnaA02g12120D                                          217   2e-64   Brassica napus [oilseed rape]
gb|ACU13347.1|  unknown                                                 211   2e-64   Glycine max [soybeans]
ref|XP_010470417.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    217   3e-64   Camelina sativa [gold-of-pleasure]
gb|EYU17601.1|  hypothetical protein MIMGU_mgv1a006316mg                216   4e-64   Erythranthe guttata [common monkey flower]
ref|XP_007151622.1|  hypothetical protein PHAVU_004G062600g             216   6e-64   Phaseolus vulgaris [French bean]
ref|XP_003624566.1|  Anthranilate N-benzoyltransferase protein          215   1e-63   Medicago truncatula
ref|XP_011014891.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    215   2e-63   Populus euphratica
ref|XP_002316174.2|  hypothetical protein POPTR_0010s18710g             215   2e-63   
gb|KHN46812.1|  Omega-hydroxypalmitate O-feruloyl transferase           213   3e-63   Glycine soja [wild soybean]
ref|XP_011078800.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    214   5e-63   Sesamum indicum [beniseed]
ref|XP_009361568.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    215   6e-63   Pyrus x bretschneideri [bai li]
ref|XP_008370853.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    215   6e-63   
ref|XP_003624564.1|  Omega-hydroxypalmitate O-feruloyl transferase      212   1e-62   
ref|XP_003519943.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    212   2e-62   Glycine max [soybeans]
gb|EYU20701.1|  hypothetical protein MIMGU_mgv1a023965mg                211   6e-62   Erythranthe guttata [common monkey flower]
gb|EYU17599.1|  hypothetical protein MIMGU_mgv1a006131mg                211   7e-62   Erythranthe guttata [common monkey flower]
ref|XP_010556190.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    211   7e-62   Tarenaya hassleriana [spider flower]
gb|EYU17598.1|  hypothetical protein MIMGU_mgv1a006131mg                207   2e-60   Erythranthe guttata [common monkey flower]
gb|EYU34269.1|  hypothetical protein MIMGU_mgv1a006390mg                207   2e-60   Erythranthe guttata [common monkey flower]
gb|EYU17594.1|  hypothetical protein MIMGU_mgv1a006220mg                206   3e-60   Erythranthe guttata [common monkey flower]
gb|EYU34268.1|  hypothetical protein MIMGU_mgv1a005307mg                204   6e-59   Erythranthe guttata [common monkey flower]
gb|EYU24113.1|  hypothetical protein MIMGU_mgv1a019465mg                193   3e-58   Erythranthe guttata [common monkey flower]
ref|XP_010912121.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    201   3e-58   Elaeis guineensis
ref|XP_011466087.1|  PREDICTED: LOW QUALITY PROTEIN: omega-hydrox...    202   5e-58   Fragaria vesca subsp. vesca
ref|XP_011100415.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    200   8e-58   Sesamum indicum [beniseed]
ref|XP_004138891.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    199   2e-57   Cucumis sativus [cucumbers]
gb|EYU20679.1|  hypothetical protein MIMGU_mgv1a006412mg                198   6e-57   Erythranthe guttata [common monkey flower]
ref|XP_011075071.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    197   2e-56   Sesamum indicum [beniseed]
ref|XP_011100416.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    196   2e-56   Sesamum indicum [beniseed]
gb|AHA84252.1|  omega-hydroxypalmitate O-feruloyl transferase           195   8e-56   Phaseolus vulgaris [French bean]
ref|XP_006858654.1|  hypothetical protein AMTR_s00066p00062130          197   1e-55   
ref|XP_010255141.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    191   4e-54   Nelumbo nucifera [Indian lotus]
gb|EYU34266.1|  hypothetical protein MIMGU_mgv1a023386mg                187   3e-53   Erythranthe guttata [common monkey flower]
ref|XP_010110379.1|  Omega-hydroxypalmitate O-feruloyl transferase      178   1e-52   
gb|KFK22279.1|  hypothetical protein AALP_AAs48576U000100               176   9e-52   Arabis alpina [alpine rockcress]
gb|EYU39480.1|  hypothetical protein MIMGU_mgv1a027110mg                181   4e-51   Erythranthe guttata [common monkey flower]
gb|EYU39979.1|  hypothetical protein MIMGU_mgv1a005557mg                183   4e-51   Erythranthe guttata [common monkey flower]
ref|XP_007161776.1|  hypothetical protein PHAVU_001G097500g             174   1e-50   Phaseolus vulgaris [French bean]
ref|XP_011069456.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    172   2e-50   
ref|NP_001185318.1|  dual transcription unit and alternative spli...    172   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65707.1|  unknown                                                 167   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006574746.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    164   2e-47   
gb|KHN00652.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    164   3e-47   Glycine soja [wild soybean]
emb|CDY07449.1|  BnaA07g25280D                                          165   4e-47   Brassica napus [oilseed rape]
emb|CDY41783.1|  BnaC02g13730D                                          163   8e-47   Brassica napus [oilseed rape]
ref|XP_006858657.1|  hypothetical protein AMTR_s00066p00063330          161   9e-43   Amborella trichopoda
gb|KGN61334.1|  hypothetical protein Csa_2G091780                       153   1e-42   Cucumis sativus [cucumbers]
gb|EYU24129.1|  hypothetical protein MIMGU_mgv1a020263mg                157   1e-41   Erythranthe guttata [common monkey flower]
ref|XP_008780371.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   9e-38   Phoenix dactylifera
gb|EYU34261.1|  hypothetical protein MIMGU_mgv11b021744mg               139   1e-37   Erythranthe guttata [common monkey flower]
gb|ABK24776.1|  unknown                                                 145   4e-37   Picea sitchensis
ref|XP_002967754.1|  BAHD family acyltransferase, clade V               138   1e-34   Selaginella moellendorffii
ref|XP_002992378.1|  BAHD family acyltransferase, clade V               137   3e-34   
gb|ABK24452.1|  unknown                                                 131   1e-33   Picea sitchensis
ref|XP_002991188.1|  BAHD family acyltransferase, clade V               127   1e-30   Selaginella moellendorffii
ref|XP_002991251.1|  BAHD family acyltransferase, clade V               125   6e-30   Selaginella moellendorffii
ref|XP_011071659.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    122   4e-29   Sesamum indicum [beniseed]
ref|XP_010930413.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    121   1e-28   Elaeis guineensis
ref|XP_010248037.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    120   3e-28   Nelumbo nucifera [Indian lotus]
ref|XP_008786402.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    120   3e-28   Phoenix dactylifera
gb|EYU45561.1|  hypothetical protein MIMGU_mgv1a005829mg                117   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_001752413.1|  predicted protein                                  117   3e-27   
ref|XP_002970966.1|  BAHD family acyltransferase, clade V               117   4e-27   Selaginella moellendorffii
ref|XP_002982104.1|  BAHD family acyltransferase, clade V               117   5e-27   Selaginella moellendorffii
ref|XP_002962120.1|  BAHD family acyltransferase, clade V               115   2e-26   Selaginella moellendorffii
ref|XP_002992205.1|  BAHD family acyltransferase, clade V               115   3e-26   Selaginella moellendorffii
ref|XP_004134484.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    113   6e-26   Cucumis sativus [cucumbers]
ref|XP_004169053.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    113   8e-26   
ref|XP_008438874.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    112   1e-25   Cucumis melo [Oriental melon]
emb|CAT00085.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    109   5e-25   Coffea arabica [arabica coffee]
gb|ABR16192.1|  unknown                                                 110   8e-25   Picea sitchensis
gb|KDP26368.1|  hypothetical protein JCGZ_17526                         110   1e-24   Jatropha curcas
ref|XP_009415665.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    109   2e-24   
ref|XP_007035554.1|  BAHD family acyltransferase, clade V, putative     106   2e-23   
ref|XP_002992754.1|  BAHD family acyltransferase, clade V               106   2e-23   
ref|XP_010666009.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    106   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007140651.1|  hypothetical protein PHAVU_008G130300g             105   4e-23   Phaseolus vulgaris [French bean]
dbj|BAK06725.1|  predicted protein                                      105   5e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001755199.1|  predicted protein                                  105   7e-23   
ref|XP_002962552.1|  BAHD family acyltransferase, clade V               105   7e-23   Selaginella moellendorffii
ref|XP_010259678.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    103   2e-22   Nelumbo nucifera [Indian lotus]
gb|KHN41391.1|  Omega-hydroxypalmitate O-feruloyl transferase           103   3e-22   Glycine soja [wild soybean]
ref|XP_003551391.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    103   3e-22   
emb|CAN63569.1|  hypothetical protein VITISV_043430                     102   5e-22   Vitis vinifera
ref|XP_002966887.1|  BAHD family acyltransferase, clade V               102   7e-22   
ref|XP_002961124.1|  BAHD family acyltransferase, clade V               102   8e-22   
gb|KEH22614.1|  HXXXD-type acyl-transferase family protein              100   3e-21   Medicago truncatula
ref|XP_004973560.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    100   3e-21   Setaria italica
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    100   4e-21   Prunus mume [ume]
ref|XP_004956854.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  99.8    4e-21   Setaria italica
emb|CBI33005.3|  unnamed protein product                              99.8    6e-21   Vitis vinifera
ref|XP_003578136.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  99.4    8e-21   Brachypodium distachyon [annual false brome]
gb|ABR16860.1|  unknown                                               99.4    8e-21   Picea sitchensis
ref|XP_007215405.1|  hypothetical protein PRUPE_ppa005943mg           99.0    1e-20   
ref|XP_002303052.1|  hypothetical protein POPTR_0002s24610g           99.0    1e-20   
ref|XP_004491723.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  98.6    1e-20   Cicer arietinum [garbanzo]
ref|XP_007161685.1|  hypothetical protein PHAVU_001G089700g           98.2    2e-20   Phaseolus vulgaris [French bean]
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase              97.1    4e-20   Trifolium pratense [peavine clover]
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase               97.1    4e-20   Trifolium pratense [peavine clover]
ref|XP_002988757.1|  BAHD family acyltransferase, clade V             97.1    4e-20   Selaginella moellendorffii
ref|XP_008231077.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.1    4e-20   Prunus mume [ume]
ref|XP_008379094.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.1    5e-20   
ref|XP_011024641.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.1    6e-20   Populus euphratica
gb|KJB70702.1|  hypothetical protein B456_011G088000                  96.7    6e-20   Gossypium raimondii
ref|XP_002986294.1|  BAHD family acyltransferase, clade V             96.7    6e-20   Selaginella moellendorffii
gb|KJB70701.1|  hypothetical protein B456_011G088000                  96.7    7e-20   Gossypium raimondii
gb|ABR16341.1|  unknown                                               96.7    9e-20   Picea sitchensis
ref|XP_002962972.1|  BAHD family acyltransferase, clade V             96.3    9e-20   Selaginella moellendorffii
ref|XP_009378002.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  96.3    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_004511192.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-19   
emb|CDX97133.1|  BnaC09g44920D                                        90.5    1e-19   
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.9    1e-19   
ref|XP_003553956.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  95.5    2e-19   Glycine max [soybeans]
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.5    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.5    2e-19   Cicer arietinum [garbanzo]
ref|XP_009403058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.5    2e-19   
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.5    2e-19   
gb|KDP41799.1|  hypothetical protein JCGZ_26817                       95.1    2e-19   Jatropha curcas
ref|XP_008341279.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  95.5    2e-19   
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  95.1    2e-19   Pyrus x bretschneideri [bai li]
gb|AGJ03151.1|  hydroxycinnamoyltransferase                           95.1    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.7    3e-19   Phoenix dactylifera
ref|XP_002298644.2|  hypothetical protein POPTR_0001s33390g           95.1    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_004304535.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  95.1    3e-19   Fragaria vesca subsp. vesca
emb|CAT00082.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  94.7    3e-19   Coffea arabica [arabica coffee]
ref|XP_007038058.1|  HXXXD-type acyl-transferase family protein i...  94.7    3e-19   
ref|XP_011468200.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  94.7    3e-19   Fragaria vesca subsp. vesca
ref|XP_002512898.1|  Anthranilate N-benzoyltransferase protein, p...  94.7    3e-19   
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.7    3e-19   Populus euphratica
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.7    3e-19   
ref|XP_003549071.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  94.7    3e-19   Glycine max [soybeans]
ref|XP_009344220.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  94.7    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_008804093.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  94.7    4e-19   Phoenix dactylifera
emb|CDY05770.1|  BnaC07g00330D                                        94.4    5e-19   
ref|XP_002521072.1|  Anthranilate N-benzoyltransferase protein, p...  94.4    5e-19   
gb|ADD62404.1|  fatty omega-hydroxyacid/fatty alcohol 0-hydroxyci...  94.0    5e-19   Quercus suber [cork oak]
ref|XP_007038057.1|  HXXXD-type acyl-transferase family protein, ...  94.7    6e-19   
ref|XP_008464403.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  94.0    6e-19   Cucumis melo [Oriental melon]
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.0    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006381775.1|  hypothetical protein POPTR_0006s17880g           94.0    7e-19   
gb|KEH21938.1|  omega-hydroxypalmitate O-feruloyl transferase         93.6    7e-19   Medicago truncatula
ref|XP_004138033.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  93.6    8e-19   Cucumis sativus [cucumbers]
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  93.6    9e-19   Fragaria vesca subsp. vesca
gb|KJB54981.1|  hypothetical protein B456_009G057200                  93.6    9e-19   Gossypium raimondii
ref|XP_009381344.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.8    9e-19   
dbj|BAJ89613.1|  predicted protein                                    93.6    9e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004516455.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  93.2    1e-18   Cicer arietinum [garbanzo]
ref|XP_002462397.1|  hypothetical protein SORBIDRAFT_02g024990        93.6    1e-18   Sorghum bicolor [broomcorn]
ref|XP_002894568.1|  transferase family protein                       93.2    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_010926850.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  93.6    1e-18   
ref|XP_009346788.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  93.2    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_011045747.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  93.2    1e-18   Populus euphratica
emb|CDO98678.1|  unnamed protein product                              92.8    1e-18   Coffea canephora [robusta coffee]
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  92.8    1e-18   Gossypium arboreum [tree cotton]
gb|EMT14263.1|  Taxadien-5-alpha-ol O-acetyltransferase               92.8    2e-18   
ref|XP_003634222.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.8    2e-18   Vitis vinifera
ref|XP_007031933.1|  HXXXD-type acyl-transferase family protein       93.2    2e-18   
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg           92.4    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_009383405.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.4    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.8    2e-18   Prunus mume [ume]
ref|XP_008778437.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.4    2e-18   Phoenix dactylifera
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.8    2e-18   Camelina sativa [gold-of-pleasure]
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...  92.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61215.1|  anthranilate N-benzoyltransferase                     92.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.4    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009381343.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.4    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.0    3e-18   Brassica rapa
ref|XP_007200675.1|  hypothetical protein PRUPE_ppa015918mg           92.0    3e-18   Prunus persica
gb|ACN28372.1|  unknown                                               92.4    3e-18   Zea mays [maize]
emb|CDY31956.1|  BnaA07g00390D                                        92.0    3e-18   Brassica napus [oilseed rape]
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg           92.4    3e-18   Prunus persica
ref|XP_004971119.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.0    3e-18   Setaria italica
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  92.0    3e-18   Ipomoea batatas [batate]
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.0    3e-18   Sesamum indicum [beniseed]
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.0    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.0    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_009600109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  91.7    4e-18   Nicotiana tomentosiformis
ref|XP_002300751.1|  transferase family protein                       92.0    4e-18   
ref|XP_010652628.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.0    4e-18   
gb|KDO63871.1|  hypothetical protein CISIN_1g014029mg                 91.7    4e-18   Citrus sinensis [apfelsine]
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase         91.7    4e-18   Medicago truncatula
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.7    4e-18   Sesamum indicum [beniseed]
ref|XP_006447016.1|  hypothetical protein CICLE_v10015302mg           91.7    4e-18   
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg           91.7    4e-18   Prunus persica
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg           91.7    4e-18   Capsella rubella
ref|XP_006470104.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  91.7    4e-18   Citrus sinensis [apfelsine]
ref|XP_010249109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  91.7    5e-18   Nelumbo nucifera [Indian lotus]
ref|XP_002325143.2|  transferase family protein                       91.7    5e-18   
emb|CAT00088.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  89.4    5e-18   Coffea arabica [arabica coffee]
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.7    5e-18   Prunus mume [ume]
emb|CDX71341.1|  BnaC07g06200D                                        86.3    5e-18   
emb|CAJ40778.1|  hydroxycinnamoyl transferase                         91.3    5e-18   Coffea arabica [arabica coffee]
gb|KJB19785.1|  hypothetical protein B456_003G119000                  91.3    6e-18   Gossypium raimondii
gb|KCW60630.1|  hypothetical protein EUGRSUZ_H03354                   91.3    6e-18   Eucalyptus grandis [rose gum]
ref|XP_010024179.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  91.3    6e-18   Eucalyptus grandis [rose gum]
gb|ADB44897.1|  hydroxycinnamoyl transferase                          91.3    6e-18   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  91.7    6e-18   Sesamum indicum [beniseed]
emb|CDY31377.1|  BnaA07g03120D                                        85.9    6e-18   Brassica napus [oilseed rape]
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg           90.9    6e-18   Capsella rubella
ref|NP_001151137.1|  LOC100284770                                     90.9    7e-18   
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  90.9    7e-18   Cynara cardunculus [cardoon]
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.9    8e-18   Vitis vinifera
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.3    9e-18   
ref|NP_001275190.1|  feruloyl transferase                             90.5    9e-18   Solanum tuberosum [potatoes]
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.9    9e-18   
ref|XP_006347627.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  90.5    9e-18   Solanum tuberosum [potatoes]
ref|XP_011092043.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  90.9    1e-17   Sesamum indicum [beniseed]
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                   91.3    1e-17   Eucalyptus grandis [rose gum]
ref|XP_007011892.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...  90.5    1e-17   
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.5    1e-17   Nelumbo nucifera [Indian lotus]
ref|NP_001150433.1|  LOC100284063                                     90.5    1e-17   
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.1    1e-17   Sesamum indicum [beniseed]
emb|CBI15706.3|  unnamed protein product                              92.0    1e-17   Vitis vinifera
emb|CBI83579.1|  hydroxycinnamoyl transferase                         90.1    1e-17   Plectranthus scutellarioides
gb|ABA93921.1|  transferase family protein, putative, expressed       90.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.1    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.1    2e-17   Camelina sativa [gold-of-pleasure]
gb|EPS65560.1|  hypothetical protein M569_09214                       90.1    2e-17   Genlisea aurea
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006474074.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.1    2e-17   Citrus sinensis [apfelsine]
ref|NP_001067952.2|  Os11g0507200                                     90.1    2e-17   
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  89.7    2e-17   Cynara cardunculus var. scolymus [artichoke]
gb|KDP32472.1|  hypothetical protein JCGZ_13397                       89.7    2e-17   Jatropha curcas
emb|CDO98242.1|  unnamed protein product                              89.7    2e-17   Coffea canephora [robusta coffee]
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora    89.7    2e-17   Coffea canephora [robusta coffee]
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  89.7    2e-17   Coffea canephora [robusta coffee]
ref|XP_003532502.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  89.7    2e-17   Glycine max [soybeans]
gb|AFW62334.1|  anthranilate N-benzoyltransferase protein 1           90.1    2e-17   
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...  89.7    2e-17   Coffea canephora [robusta coffee]
ref|XP_002449535.1|  hypothetical protein SORBIDRAFT_05g018060        89.4    2e-17   
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  89.4    2e-17   Coffea arabica [arabica coffee]
gb|KJB76362.1|  hypothetical protein B456_012G084200                  89.4    3e-17   Gossypium raimondii
emb|CBI19745.3|  unnamed protein product                              89.0    3e-17   Vitis vinifera
ref|XP_010034869.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  89.4    3e-17   Eucalyptus grandis [rose gum]
ref|XP_009770247.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  89.4    3e-17   Nicotiana sylvestris
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  89.0    3e-17   Lonicera japonica [Japanese honeysuckle]
ref|XP_004235315.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  89.0    3e-17   Solanum lycopersicum
ref|XP_011018001.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  89.4    3e-17   Populus euphratica
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                  89.0    3e-17   Arabis alpina [alpine rockcress]
emb|CBI28117.3|  unnamed protein product                              89.0    3e-17   Vitis vinifera
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg           89.0    3e-17   Capsella rubella
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase               89.0    4e-17   
ref|XP_011028892.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  89.0    4e-17   
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like     89.0    4e-17   
ref|XP_006844599.1|  hypothetical protein AMTR_s00016p00213830        89.0    4e-17   
gb|EYU23064.1|  hypothetical protein MIMGU_mgv1a006699mg              88.6    4e-17   
ref|XP_002281531.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  89.0    5e-17   
gb|AAX83048.1|  taxadienol acetyl transferase                         88.6    5e-17   
gb|AFD32420.1|  taxadien-5-alpha-ol-O-acetyltransferase               88.6    5e-17   
gb|ACF87435.1|  unknown                                               88.6    5e-17   
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  88.6    5e-17   
ref|XP_004503772.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  88.6    5e-17   
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g           88.6    5e-17   
ref|XP_002521543.1|  Anthranilate N-benzoyltransferase protein, p...  88.6    5e-17   
ref|XP_002281098.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  88.6    5e-17   
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  88.6    5e-17   
ref|XP_002870657.1|  transferase family protein                       88.6    6e-17   
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  88.6    6e-17   
ref|XP_009125170.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  88.6    6e-17   
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  88.2    6e-17   
ref|NP_001147464.1|  anthranilate N-benzoyltransferase protein 1      88.2    6e-17   
gb|KEH21000.1|  omega-hydroxypalmitate O-feruloyl transferase         88.6    6e-17   
ref|NP_851111.1|  omega-hydroxypalmitate O-feruloyl transferase       88.6    7e-17   
ref|NP_568587.2|  omega-hydroxypalmitate O-feruloyl transferase       88.2    7e-17   
gb|KDP38692.1|  hypothetical protein JCGZ_04045                       88.2    7e-17   
ref|XP_010086996.1|  Omega-hydroxypalmitate O-feruloyl transferase    88.2    7e-17   
ref|XP_010441266.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  88.6    7e-17   
ref|XP_002445570.1|  hypothetical protein SORBIDRAFT_07g021760        88.2    7e-17   
gb|ADG46003.1|  hydroxycinnamoyl transferase                          88.2    7e-17   
gb|KDO64448.1|  hypothetical protein CISIN_1g013997mg                 88.2    8e-17   
gb|ABG22392.1|  Transferase family protein, expressed                 85.5    8e-17   
emb|CDY11732.1|  BnaC06g13400D                                        87.8    8e-17   
dbj|BAF49305.1|  putative acyltransferase                             87.8    8e-17   
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.8    9e-17   
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...  87.8    9e-17   
ref|XP_010682493.1|  PREDICTED: anthranilate N-benzoyltransferase...  85.9    9e-17   
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  87.8    1e-16   
ref|XP_003565078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.8    1e-16   
ref|XP_006436888.1|  hypothetical protein CICLE_v10031592mg           87.8    1e-16   
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.8    1e-16   
ref|XP_009140062.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  87.8    1e-16   
ref|XP_008231492.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  87.8    1e-16   
ref|XP_006405403.1|  hypothetical protein EUTSA_v10027756mg           87.8    1e-16   
ref|XP_002437977.1|  hypothetical protein SORBIDRAFT_10g005780        87.4    1e-16   
ref|XP_006474075.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.8    1e-16   
ref|XP_011023948.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  87.4    1e-16   
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  87.4    1e-16   
emb|CDP21790.1|  unnamed protein product                              85.9    1e-16   
ref|XP_010436043.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  87.8    1e-16   
ref|XP_006453163.1|  hypothetical protein CICLE_v10010833mg           87.4    1e-16   
emb|CDY68497.1|  BnaCnng59260D                                        87.4    1e-16   
ref|NP_001141054.1|  uncharacterized protein LOC100273135             87.4    1e-16   
ref|XP_004301782.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  87.4    2e-16   
dbj|BAF49306.1|  putative acyltransferase                             87.0    2e-16   
gb|AEA36976.1|  rosmarinic acid synthase                              87.4    2e-16   
gb|KHG11495.1|  Omega-hydroxypalmitate O-feruloyl transferase -li...  87.0    2e-16   
gb|ADL62856.1|  acyltransferase                                       87.0    2e-16   
gb|ABI48360.1|  putative alcohol acyltransferase 1                    87.4    2e-16   
gb|AFS68800.1|  hydroxycinnamoyl transferase                          87.0    2e-16   
gb|KFK33037.1|  hypothetical protein AALP_AA6G322400                  87.4    2e-16   
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  87.0    2e-16   
ref|XP_006306146.1|  hypothetical protein CARUB_v10011653mg           87.0    2e-16   
gb|AAS49031.1|  taxa-4(20),11(12)-dien-5alpha-ol-O-acetyl transfe...  87.0    2e-16   
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.0    2e-16   
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg              86.7    2e-16   
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.7    2e-16   
gb|AEK80405.1|  HQT                                                   86.7    2e-16   
ref|XP_009113746.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  86.7    2e-16   
ref|XP_008384757.1|  PREDICTED: methanol O-anthraniloyltransferas...  87.0    2e-16   
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.7    3e-16   
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  86.7    3e-16   
emb|CDY27624.1|  BnaA09g27830D                                        86.7    3e-16   
ref|XP_002464789.1|  hypothetical protein SORBIDRAFT_01g026760        86.7    3e-16   
ref|XP_010254732.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  86.7    3e-16   
ref|XP_011467012.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.3    3e-16   
emb|CDX67482.1|  BnaA07g15220D                                        86.3    3e-16   
gb|EYU24586.1|  hypothetical protein MIMGU_mgv1a0064641mg             84.7    3e-16   
ref|XP_010273689.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.3    3e-16   
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.3    3e-16   
ref|XP_004979328.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  86.3    4e-16   
ref|XP_001772486.1|  predicted protein                                86.3    4e-16   
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.3    4e-16   
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.3    4e-16   
ref|XP_002436612.1|  hypothetical protein SORBIDRAFT_10g005770        85.9    4e-16   
ref|XP_002437976.1|  hypothetical protein SORBIDRAFT_10g005760        85.9    4e-16   
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  85.9    5e-16   
ref|XP_004494963.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  85.9    5e-16   
ref|XP_010672788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.9    5e-16   
ref|XP_010672790.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.9    5e-16   
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.9    5e-16   
ref|XP_004956853.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.5    5e-16   
emb|CDP21167.1|  unnamed protein product                              85.9    6e-16   
ref|XP_003576099.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  85.9    6e-16   
ref|XP_002511135.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...  85.5    6e-16   
ref|XP_002892159.1|  transferase family protein                       85.9    6e-16   
gb|EAZ17657.1|  hypothetical protein OsJ_33198                        85.5    6e-16   
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...  85.5    6e-16   
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.5    6e-16   
emb|CBI25231.3|  unnamed protein product                              85.1    6e-16   
ref|XP_006283644.1|  hypothetical protein CARUB_v10004701mg           85.9    6e-16   
ref|XP_011077685.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  85.9    6e-16   
ref|XP_009379971.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.9    6e-16   
ref|XP_010528157.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.5    7e-16   
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...  85.5    7e-16   
ref|XP_008242680.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.5    7e-16   
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg           85.5    7e-16   
ref|XP_010250620.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.5    7e-16   
ref|XP_010051711.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  85.5    7e-16   
ref|XP_010528158.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.5    7e-16   
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.5    7e-16   
gb|KCW82842.1|  hypothetical protein EUGRSUZ_C04213                   85.5    7e-16   
gb|ACU16063.1|  unknown                                               82.8    7e-16   
ref|XP_011048810.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.5    7e-16   
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  85.1    7e-16   
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...  85.1    8e-16   
ref|NP_001065905.1|  Os11g0182200                                     85.5    8e-16   
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg              85.1    8e-16   
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.1    8e-16   
ref|XP_006826688.1|  hypothetical protein AMTR_s00137p00072760        85.5    8e-16   
gb|KDP41953.1|  hypothetical protein JCGZ_26971                       85.1    8e-16   
ref|XP_011048809.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.1    9e-16   
ref|XP_002307677.2|  transferase family protein                       85.1    9e-16   
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.1    9e-16   
emb|CAN82918.1|  hypothetical protein VITISV_023290                   85.1    9e-16   
ref|XP_010939233.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.1    9e-16   
ref|XP_008791113.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.1    1e-15   
ref|XP_010450574.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.5    1e-15   
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.7    1e-15   
gb|KJB56505.1|  hypothetical protein B456_009G122600                  84.7    1e-15   
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  84.7    1e-15   
gb|KJB56501.1|  hypothetical protein B456_009G122600                  84.7    1e-15   
gb|KHN31434.1|  Benzyl alcohol O-benzoyltransferase                   85.1    1e-15   
ref|XP_002321725.2|  hypothetical protein POPTR_0015s11290g           84.7    1e-15   
ref|XP_010545447.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.7    1e-15   
gb|ACY79409.1|  omega-hydroxyacid hydroxycinnamoyltransferase         84.7    1e-15   
ref|XP_003522443.2|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.7    1e-15   
emb|CDY48963.1|  BnaA04g10770D                                        84.7    1e-15   
ref|NP_174083.1|  HXXXD-type acyl-transferase-like protein            84.7    1e-15   
gb|EAY81037.1|  hypothetical protein OsI_36216                        85.1    1e-15   
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g           85.1    1e-15   
ref|XP_009405177.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.1    1e-15   
sp|Q8S9G6.1|T5AT_TAXWC  RecName: Full=Taxadien-5-alpha-ol O-acety...  84.7    1e-15   
gb|EPS64002.1|  hypothetical protein M569_10778                       84.7    1e-15   
ref|XP_008237791.1|  PREDICTED: uncharacterized protein LOC103336520  83.2    1e-15   
gb|AGH61997.1|  rosmarinic acid synthase                              84.7    1e-15   
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                    84.7    1e-15   
ref|XP_004291518.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.7    1e-15   
ref|XP_010026248.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.7    1e-15   
ref|XP_010554116.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.7    1e-15   
ref|XP_011083891.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.7    1e-15   
gb|AGW30205.1|  alcohol acyl transferase                              84.7    1e-15   
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...  84.3    1e-15   
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  84.3    1e-15   
gb|KHN23966.1|  Omega-hydroxypalmitate O-feruloyl transferase         84.0    1e-15   
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.3    2e-15   
ref|XP_010031389.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.3    2e-15   
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                 84.3    2e-15   
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1            84.3    2e-15   
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...  84.3    2e-15   
sp|Q9M6F0.1|T5AT_TAXCU  RecName: Full=Taxadien-5-alpha-ol O-acety...  84.3    2e-15   
ref|XP_003521737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  84.3    2e-15   
ref|XP_003580168.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.3    2e-15   
tpg|DAA39907.1|  TPA: hypothetical protein ZEAMMB73_488506            84.0    2e-15   
ref|XP_010521555.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  84.3    2e-15   
ref|XP_002890739.1|  transferase family protein                       84.0    2e-15   
emb|CDY11777.1|  BnaC03g58010D                                        84.0    2e-15   
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.0    2e-15   
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  84.0    2e-15   
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.0    2e-15   
ref|XP_010672786.1|  PREDICTED: anthranilate N-benzoyltransferase...  83.2    2e-15   
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  84.0    2e-15   
ref|XP_008237725.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  83.2    2e-15   
ref|XP_006446267.1|  hypothetical protein CICLE_v10015194mg           84.0    2e-15   
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...  84.3    2e-15   
ref|XP_006662951.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.0    2e-15   
gb|ABR17740.1|  unknown                                               84.3    2e-15   
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...  83.6    2e-15   
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  83.6    2e-15   
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.6    3e-15   
ref|XP_006368492.1|  transferase family protein                       83.6    3e-15   
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase         83.6    3e-15   
ref|XP_010929588.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  83.6    3e-15   
gb|KJB44361.1|  hypothetical protein B456_007G247900                  84.0    3e-15   
gb|ABR16407.1|  unknown                                               83.6    3e-15   
emb|CDX90098.1|  BnaA08g18860D                                        83.6    3e-15   
ref|NP_001142105.1|  hypothetical protein                             83.6    3e-15   
gb|ABR16595.1|  unknown                                               83.6    3e-15   
ref|XP_004294955.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.6    3e-15   
ref|XP_009109793.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  83.6    3e-15   
gb|AGW30204.1|  truncated alcohol acyl transferase                    82.0    3e-15   
ref|XP_003564188.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.6    3e-15   
gb|EEC67797.1|  hypothetical protein OsI_35360                        80.9    3e-15   
emb|CDY44162.1|  BnaC01g22120D                                        83.6    3e-15   
gb|AEJ88365.1|  hydroxycinnamoyltransferase                           83.6    3e-15   
ref|NP_001063206.1|  Os09g0422000                                     83.6    3e-15   
gb|EMS57280.1|  Omega-hydroxypalmitate O-feruloyl transferase         83.6    3e-15   
ref|XP_008239515.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  83.2    3e-15   
ref|XP_010533496.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.2    4e-15   
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.2    4e-15   
ref|XP_004964652.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.2    4e-15   
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  83.2    4e-15   
gb|EMS51970.1|  Omega-hydroxypalmitate O-feruloyl transferase         83.2    4e-15   
ref|XP_003591040.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  83.2    4e-15   
gb|KJB71580.1|  hypothetical protein B456_011G130700                  81.6    4e-15   
gb|KJB71578.1|  hypothetical protein B456_011G130700                  81.6    4e-15   
ref|XP_006304467.1|  hypothetical protein CARUB_v10011142mg           83.2    4e-15   
ref|XP_002462399.1|  hypothetical protein SORBIDRAFT_02g025010        83.2    4e-15   
gb|AFK49108.1|  unknown                                               83.2    4e-15   
ref|XP_010457348.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  83.2    4e-15   
gb|EYU25633.1|  hypothetical protein MIMGU_mgv1a006801mg              82.8    4e-15   
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.2    5e-15   
ref|XP_010474963.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  83.2    5e-15   
gb|EMT21731.1|  Taxadien-5-alpha-ol O-acetyltransferase               80.9    5e-15   
ref|XP_010650165.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  83.2    5e-15   
gb|KJB71581.1|  hypothetical protein B456_011G130700                  81.6    5e-15   
ref|XP_007209159.1|  hypothetical protein PRUPE_ppa006018mg           82.8    5e-15   
gb|EYU24587.1|  hypothetical protein MIMGU_mgv1a006602mg              82.8    6e-15   
gb|KCW72711.1|  hypothetical protein EUGRSUZ_E01163                   82.8    6e-15   
ref|XP_009371433.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  82.8    6e-15   
ref|XP_010460517.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  82.4    7e-15   
ref|XP_009375174.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  82.4    7e-15   
ref|XP_009335934.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  82.8    7e-15   



>ref|XP_009620725.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Nicotiana 
tomentosiformis]
Length=456

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG LY   E+  ++LKVTI D+ L+FPS+ET K  MFLSNID+VLNFDVQT+HFFPA+  
Sbjct  1    MGTLYQPHESTIQELKVTIQDTSLVFPSEETQKKPMFLSNIDQVLNFDVQTLHFFPANSE  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPPEIV  K++NA  ++LV   YDFLAGRLK N +  R+EI+CNA GA F VASSE  L+
Sbjct  61   FPPEIVKEKLRNALSKVLVP--YDFLAGRLKMNHQIGRLEIDCNAEGAVFVVASSELTLK  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
            +IGDLVYPNP FRQL+T S D + K+D+PLC +QVTSFKCGGFA+GTS NHI+FDG+ +K
Sbjct  119  EIGDLVYPNPGFRQLITQSIDLLEKDDKPLCIIQVTSFKCGGFAMGTSTNHITFDGTSYK  178

Query  616  MFLENLAA  639
            +FL+NLA+
Sbjct  179  IFLQNLAS  186



>ref|XP_009794621.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Nicotiana 
sylvestris]
Length=455

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG LY   E+  ++LKVTI D+ L+FPS++T K  MFLSNID+VLNFDVQT+HFFPA+  
Sbjct  1    MGTLYQPLESTIQELKVTIQDTSLVFPSEKTQKKPMFLSNIDQVLNFDVQTLHFFPANSE  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPPEIV  K++NA  ++LV   YDFLAGRLK N +  R+EI+CNA GA F VASSE  L+
Sbjct  61   FPPEIVTEKLRNALSKVLVP--YDFLAGRLKMNHQIGRLEIDCNAEGAVFVVASSELTLK  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
            +IGDLVYPNP F+QLVT S D + K+D+PLC +QVTSFKCGGFA+GTS NHI+FDG+ +K
Sbjct  119  EIGDLVYPNPGFKQLVTQSIDHLEKDDKPLCIIQVTSFKCGGFAMGTSTNHITFDGTSYK  178

Query  616  MFLENLAA  639
            +FL+NLA+
Sbjct  179  IFLQNLAS  186



>emb|CAN73821.1| hypothetical protein VITISV_014805 [Vitis vinifera]
Length=435

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MGA++  P  L +DLKV +  S L+ PS ET + +MFLSNIDKVLNF+VQTVHFF A P 
Sbjct  1    MGAIFQDPPPLIQDLKVAVHSSSLVLPSSETERKSMFLSNIDKVLNFNVQTVHFFQAHPD  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPP  V  K++ A +++LV   YDFLAGRLK N +  R+E++CNAAGAGF VASSEF L+
Sbjct  61   FPPPTVVEKLETALQKILVP--YDFLAGRLKMNPKLGRLEVDCNAAGAGFVVASSEFTLD  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
            +IGDLVYPNPAF+QLV MS D +A +DQPLC LQVTSFKCGGFA+G + NH +FDG  FK
Sbjct  119  EIGDLVYPNPAFQQLVVMSMDNLAPDDQPLCILQVTSFKCGGFAMGVTNNHATFDGLSFK  178

Query  616  MFLENLAALS  645
            MFLENLA+L+
Sbjct  179  MFLENLASLA  188



>ref|XP_002270329.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
 emb|CBI38342.3| unnamed protein product [Vitis vinifera]
Length=448

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MGA++  P  L +DLKV +  S L+ PS ET + +MFLSNIDKVLNF+VQTVHFF A P 
Sbjct  1    MGAIFQDPPPLIQDLKVAVHSSSLVLPSSETERKSMFLSNIDKVLNFNVQTVHFFQAHPD  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPP  V  K++ A +++LV   YDFLAGRLK N +  R+E++CNAAGAGF VASSEF L+
Sbjct  61   FPPPTVVEKLETALQKILVP--YDFLAGRLKMNPKLGRLEVDCNAAGAGFVVASSEFTLD  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
            +IGDLVYPNPAF+QLV MS D +A +DQPLC LQVTSFKCGGFA+G + NH +FDG  FK
Sbjct  119  EIGDLVYPNPAFQQLVVMSMDNLAPDDQPLCILQVTSFKCGGFAMGVTNNHATFDGLSFK  178

Query  616  MFLENLAALS  645
            MFLENLA+L+
Sbjct  179  MFLENLASLA  188



>ref|XP_002514787.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF47341.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=450

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MGA+Y +P  L +DLKVTI D+ L+FP Q+T + TMFLSNID+VLNFDVQT+HFF +   
Sbjct  1    MGAIYQEPPPLLQDLKVTIKDTSLVFPPQDTGRRTMFLSNIDQVLNFDVQTLHFFASHED  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FP  +VA K+K +F +LL+   YDFLAGRLK N E+ R E +CN AGAGF VASSE  LE
Sbjct  61   FPSHVVAEKLKTSFEKLLLP--YDFLAGRLKMNTEAGRFEFDCNGAGAGFVVASSERRLE  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
            ++GDLVYPNPAF QL+  S D + KEDQPLC +QVTSFKCGGF +G S NH +FDG  FK
Sbjct  119  EVGDLVYPNPAFDQLIVKSLDILEKEDQPLCIIQVTSFKCGGFVMGISTNHATFDGISFK  178

Query  616  MFLENLAAL  642
             FLENLAA+
Sbjct  179  TFLENLAAV  187



>emb|CAT00084.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=343

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 145/189 (77%), Gaps = 3/189 (2%)
 Frame = +1

Query  76   MGALYL-KPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASP  252
            MG LY   P+T   DLKVTI +S L+FP+QET   +MFLSNID+VLNF+VQTVHFFPA+ 
Sbjct  1    MGTLYQGPPDTAIHDLKVTIQESQLVFPAQETQSKSMFLSNIDQVLNFNVQTVHFFPANL  60

Query  253  GFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFAL  432
             FPP+IVA +++ A   +LV   YDFLAGR++ N  S R+EI+CN+AGA F VASSEFAL
Sbjct  61   EFPPKIVADRLRTALSNVLVP--YDFLAGRIQLNPHSGRLEIDCNSAGAVFAVASSEFAL  118

Query  433  EDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  612
            +DIGDLVYPNPAF QL+    D +  +DQPLC +Q+TSFKCGGFA+G S NH   DG  F
Sbjct  119  DDIGDLVYPNPAFGQLIVEKVDAIGSDDQPLCIIQLTSFKCGGFAMGVSTNHAMLDGLSF  178

Query  613  KMFLENLAA  639
            K+FL+NLA+
Sbjct  179  KIFLQNLAS  187



>ref|XP_007028077.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY08579.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=452

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 148/190 (78%), Gaps = 2/190 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG + ++P +L +DLK+TI +  L+FPSQ+T + +MFLSNIDKVLNF V+TVHFFP+   
Sbjct  1    MGTICVEPPSLLQDLKITIQNVSLVFPSQQTERKSMFLSNIDKVLNFPVETVHFFPSHKD  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPP +VA K+K+   RLLV   YDFLAGRL+ N E+ R+EI+CNAAG GF VASSE+ ++
Sbjct  61   FPPHLVAEKLKSTLARLLVP--YDFLAGRLRSNPETGRLEIDCNAAGIGFAVASSEYTMD  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
             +G+LVYPNPAF QL+    D + ++DQPLC +QVTSF+CGGFA+G   NH++FDG  FK
Sbjct  119  SLGELVYPNPAFGQLILKRMDNLEQDDQPLCIVQVTSFRCGGFAMGMFTNHVTFDGLSFK  178

Query  616  MFLENLAALS  645
            +FL+NL AL+
Sbjct  179  IFLDNLGALA  188



>emb|CDP20135.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 144/188 (77%), Gaps = 3/188 (2%)
 Frame = +1

Query  76   MGALYL-KPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASP  252
            MG LY   P+T   DLKVTI +S L+FP+QET   +MFLSNID+VLNF+VQTVHFFPA+ 
Sbjct  1    MGTLYQGPPDTAIHDLKVTIQESQLVFPAQETQSKSMFLSNIDQVLNFNVQTVHFFPANL  60

Query  253  GFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFAL  432
             FPP+IVA +++ A   +LV   YDFLAGR+K N  S R+EI+CN+AGA F VASSEFAL
Sbjct  61   EFPPKIVADRLRTALSNVLVP--YDFLAGRIKLNPHSGRLEIDCNSAGAVFAVASSEFAL  118

Query  433  EDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  612
            +DIGDLVYPNPAF QL+    D +  +DQPLC +Q+TSFKCGGFA+G S NH   DG  F
Sbjct  119  DDIGDLVYPNPAFGQLIVEKVDAIGSDDQPLCIIQLTSFKCGGFAMGVSTNHAMLDGLSF  178

Query  613  KMFLENLA  636
            K+FL+NLA
Sbjct  179  KIFLQNLA  186



>ref|XP_004250074.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Solanum 
lycopersicum]
Length=461

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 147/190 (77%), Gaps = 4/190 (2%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG LY   E+  +DLKVTI ++ L+FPSQET K  MFL NID+VLNFDVQT+HFF A+P 
Sbjct  1    MGTLYQPLESTIQDLKVTIHNTSLVFPSQETPKKPMFLPNIDQVLNFDVQTLHFFNANPE  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNA-AGAGFTVASSEFAL  432
            FPPEIV  +++ A  R+LV   YDFLAGRL+ N+ES+R+E +CN+ AGA F VASSE  L
Sbjct  61   FPPEIVTERLRIALSRVLVP--YDFLAGRLRMNQESKRLEFDCNSDAGAVFMVASSELTL  118

Query  433  EDIGDLVYPNPAFRQLVTM-SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  609
             +IGDLVYPNP FRQL+   + D + K+D+PLC LQVTSFKCGGFA+G S NHI+FDG  
Sbjct  119  NEIGDLVYPNPGFRQLIVHENIDILEKDDKPLCILQVTSFKCGGFAMGFSTNHITFDGIS  178

Query  610  FKMFLENLAA  639
            FK FL+NLA+
Sbjct  179  FKTFLQNLAS  188



>gb|KJB26880.1| hypothetical protein B456_004G264500 [Gossypium raimondii]
Length=449

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 145/184 (79%), Gaps = 3/184 (2%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIV  273
            P TL +DLK+T  +  L+FPS++T  K +MFLSNIDKVLNF V+TVHFFP+   FPP + 
Sbjct  9    PATLIQDLKITTQNVSLVFPSRKTERKKSMFLSNIDKVLNFPVETVHFFPSHEDFPPHVA  68

Query  274  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  453
            A K+K A   LLV   YDFLAGRL+ N E+ R++I+CN+AG GF VASS++AL+D+GDLV
Sbjct  69   AEKLKTALSELLVP--YDFLAGRLRSNPETGRLQIDCNSAGIGFAVASSDYALDDVGDLV  126

Query  454  YPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENL  633
            YPNPAF QL+  S D + ++DQPLC +QVTSFKCGGFA+G + NH++FDG  FK+FL+NL
Sbjct  127  YPNPAFGQLICKSVDSLEQDDQPLCIVQVTSFKCGGFAMGVATNHVTFDGLSFKIFLDNL  186

Query  634  AALS  645
            AA++
Sbjct  187  AAVT  190



>ref|XP_010038444.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Eucalyptus 
grandis]
 gb|KCW84609.1| hypothetical protein EUGRSUZ_B01441 [Eucalyptus grandis]
Length=463

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 141/190 (74%), Gaps = 2/190 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG LY +P  L +DL+VT+ D+ L+FPS+       FLSNIDKVLNFDVQT+HFFPA   
Sbjct  1    MGTLYQEPPRLIQDLRVTVHDTSLVFPSKPVPNKPFFLSNIDKVLNFDVQTIHFFPAHVE  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPP+ V   +K A  ++LV   Y+FL+GRLK N  S R+EIECN+ G GF VASSE +L+
Sbjct  61   FPPDKVTETLKVALAKILVH--YEFLSGRLKFNAASGRLEIECNSEGVGFVVASSECSLD  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
            D+GDLVYPNPAF +LVT S D +  ++QPLC +QVTSF CGGF +G S NH +FDG  FK
Sbjct  119  DVGDLVYPNPAFERLVTKSMDILQPDNQPLCIVQVTSFTCGGFVMGISTNHGTFDGLSFK  178

Query  616  MFLENLAALS  645
            MFL+NLAAL+
Sbjct  179  MFLQNLAALA  188



>ref|XP_006353264.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Solanum tuberosum]
Length=461

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 145/190 (76%), Gaps = 4/190 (2%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG LY   E+  +DLKVTI ++ L+FPSQET K  MFL NID+VLNFDVQT+HFF A+P 
Sbjct  1    MGTLYQPLESTIQDLKVTIHNTSLVFPSQETPKKPMFLPNIDQVLNFDVQTLHFFNANPE  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNA-AGAGFTVASSEFAL  432
            FPPEIV  +++ A  R++V   YDFLAGRL+ N+ES+R+E +CN+ AGA F VASSE  L
Sbjct  61   FPPEIVTERLRIALSRVVVH--YDFLAGRLRMNQESKRLEFDCNSDAGAVFMVASSELTL  118

Query  433  EDIGDLVYPNPAFRQLVTM-SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  609
             +IGDLVYPNP FRQL+   + D + K+D+PL  LQVTSFKCGGF +G S NHI+FDG  
Sbjct  119  NEIGDLVYPNPGFRQLIVHENIDILEKDDKPLFILQVTSFKCGGFVMGFSTNHITFDGIS  178

Query  610  FKMFLENLAA  639
            FK FL+NLA+
Sbjct  179  FKTFLQNLAS  188



>ref|XP_006480697.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
Length=458

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 150/196 (77%), Gaps = 8/196 (4%)
 Frame = +1

Query  76   MGAL---YLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPA  246
            MG+L   + +   L +DLKVTI  S L+FPSQET K ++FLSNID+VLNF V+TVHFF +
Sbjct  1    MGSLDHHHQESPPLPQDLKVTIQHSSLVFPSQETEKKSLFLSNIDQVLNFSVETVHFFAS  60

Query  247  SPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEF  426
               FPP +VA K++N   ++LV   YDFLAGRLK N ++ ++EI+CNAAGA F VASSE+
Sbjct  61   HKDFPPRVVAEKLRNTLGKILVP--YDFLAGRLKANAKTGKMEIDCNAAGAVFIVASSEY  118

Query  427  ALEDIGDLVYPNPAFRQL-VTMSFD--FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISF  597
             L+DIGDLVYPNP F+QL +  SFD   + ++D+PLC  QVTSFKCGGF++GTS NH +F
Sbjct  119  KLDDIGDLVYPNPGFKQLIINSSFDDNLLEQDDKPLCIFQVTSFKCGGFSIGTSTNHATF  178

Query  598  DGSGFKMFLENLAALS  645
            DG  FK+FL+NLAAL+
Sbjct  179  DGLSFKVFLDNLAALA  194



>ref|XP_006425205.1| hypothetical protein CICLE_v10010861mg [Citrus clementina]
 gb|ESR38445.1| hypothetical protein CICLE_v10010861mg [Citrus clementina]
Length=458

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 150/196 (77%), Gaps = 8/196 (4%)
 Frame = +1

Query  76   MGAL---YLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPA  246
            MG+L   + +   L +DLKVTI  S L+FPSQET K ++FLSNID+VLNF V+TVHFF +
Sbjct  1    MGSLDHHHQESPPLPQDLKVTIQHSSLVFPSQETEKKSLFLSNIDQVLNFSVETVHFFAS  60

Query  247  SPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEF  426
               FPP +VA K++N   ++LV   YDFLAGRLK N ++ ++EI+CNAAGA F VASSE+
Sbjct  61   HKDFPPHVVAEKLRNTLGKILVP--YDFLAGRLKANAKTGKMEIDCNAAGAVFIVASSEY  118

Query  427  ALEDIGDLVYPNPAFRQL-VTMSFD--FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISF  597
             L+DIGDLVYPNP F+QL +  SFD   + ++D+PLC  QVTSFKCGGF++GTS NH +F
Sbjct  119  KLDDIGDLVYPNPGFKQLIINSSFDDNLLEQDDKPLCIFQVTSFKCGGFSIGTSTNHATF  178

Query  598  DGSGFKMFLENLAALS  645
            DG  FK+FL+NLAAL+
Sbjct  179  DGLSFKVFLDNLAALA  194



>gb|KDP26918.1| hypothetical protein JCGZ_18076 [Jatropha curcas]
Length=450

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 147/193 (76%), Gaps = 5/193 (3%)
 Frame = +1

Query  76   MGALYLK-PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASP  252
            MGA+Y + P  L +DLK+TI DS ++FP QE+ + ++FLSNID+VLNF+VQT+HFF +  
Sbjct  1    MGAMYQESPSDLLQDLKITIRDSCMVFPPQESKRQSLFLSNIDQVLNFNVQTLHFFASHK  60

Query  253  GFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFAL  432
             FPP +VA K+K   ++LLV   YDFLAGRLK N ++ R+EI+CN AGAGF VASS+  L
Sbjct  61   DFPPHLVAEKLKRTLQKLLVP--YDFLAGRLKMNLQTGRLEIDCNGAGAGFVVASSDRRL  118

Query  433  EDIGDLVYPNPAFRQLVTMSFDFVAK--EDQPLCFLQVTSFKCGGFALGTSMNHISFDGS  606
            E++GDLVYPNPAF++L+    D +    +DQPLC +QVTSF+CGGF +G S NH +FDG 
Sbjct  119  EELGDLVYPNPAFQELILKGMDILQDKLDDQPLCIVQVTSFRCGGFVIGLSTNHTAFDGL  178

Query  607  GFKMFLENLAALS  645
             FK FL+NLAA++
Sbjct  179  SFKTFLDNLAAVA  191



>gb|KDO45315.1| hypothetical protein CISIN_1g012689mg [Citrus sinensis]
Length=458

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 150/196 (77%), Gaps = 8/196 (4%)
 Frame = +1

Query  76   MGAL---YLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPA  246
            MG+L   + +   L +DLKVTI  S L+FPSQET K ++FLSNID+VLNF V+TVHFF +
Sbjct  1    MGSLDHHHQESPPLPQDLKVTIHHSSLVFPSQETEKKSLFLSNIDQVLNFSVETVHFFES  60

Query  247  SPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEF  426
               FPP +VA K++N   ++LV   YDFLAGRLK N ++ ++EI+CNAAGA F VASSE+
Sbjct  61   HKDFPPHVVAEKLRNTLGKILVP--YDFLAGRLKANAKTGKMEIDCNAAGAVFIVASSEY  118

Query  427  ALEDIGDLVYPNPAFRQL-VTMSFD--FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISF  597
             L+DIGDLVYPNP F+QL +  SFD   + ++D+PLC  QVTSFKCGGF++GTS NH +F
Sbjct  119  KLDDIGDLVYPNPGFKQLIINSSFDDNLLEQDDKPLCIFQVTSFKCGGFSIGTSTNHATF  178

Query  598  DGSGFKMFLENLAALS  645
            DG  FK+FL+NLAAL+
Sbjct  179  DGLSFKVFLDNLAALA  194



>gb|KHG26258.1| Omega-hydroxypalmitate O-feruloyl transferase -like protein [Gossypium 
arboreum]
Length=449

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 142/184 (77%), Gaps = 3/184 (2%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIV  273
            P TL +DLK+T  +  LIFPS++T  K +MFLSNID+VLNF V+TVHFF +   FPP + 
Sbjct  9    PATLIQDLKITTQNVSLIFPSRKTERKKSMFLSNIDRVLNFPVETVHFFRSHEDFPPHVA  68

Query  274  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  453
            A K+K A   LLV   YDFLAGRL+ N E+ R+EI+CN+AG GF VASS++AL+D+GDLV
Sbjct  69   AEKLKTALSELLVP--YDFLAGRLRSNPETGRLEIDCNSAGIGFAVASSDYALDDVGDLV  126

Query  454  YPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENL  633
            YPNPAF QL+  S D + ++DQPLC +QVTSF+CGGFA G   NH++FDG  FK+FL+NL
Sbjct  127  YPNPAFGQLICKSVDSLEQDDQPLCIVQVTSFRCGGFATGIVTNHVTFDGLSFKIFLDNL  186

Query  634  AALS  645
            AA++
Sbjct  187  AAVT  190



>ref|XP_006301983.1| hypothetical protein CARUB_v10022464mg [Capsella rubella]
 gb|EOA34881.1| hypothetical protein CARUB_v10022464mg [Capsella rubella]
Length=451

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 148/192 (77%), Gaps = 5/192 (3%)
 Frame = +1

Query  76   MGALYLK-PETLHEDLKVTILDSGLIFPSQETT--KHTMFLSNIDKVLNFDVQTVHFFPA  246
            MG+LY + P  L +DLKVTI +S LIFPS+ETT  K +MFLSN+D++LNFDVQTVHFF  
Sbjct  1    MGSLYQESPPLLLQDLKVTIKESTLIFPSEETTSEKKSMFLSNVDQILNFDVQTVHFFRP  60

Query  247  SPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEF  426
            +  FPPE+V+ K++ A  + +  + Y+FLAGRL+ +  S R++++CN AGAGF +A+SE+
Sbjct  61   NKDFPPEMVSEKLRKALVKAM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVIAASEY  118

Query  427  ALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGS  606
             LE++GDLVYPNPAF QLVT   + + K+DQPL   Q+TSFKCGGFA+G S NH +FDG 
Sbjct  119  TLEELGDLVYPNPAFAQLVTSQLESLPKDDQPLFAFQMTSFKCGGFAMGISTNHTTFDGL  178

Query  607  GFKMFLENLAAL  642
             FK FLENLA+L
Sbjct  179  SFKTFLENLASL  190



>ref|XP_003548796.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=447

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 140/190 (74%), Gaps = 2/190 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG   L+   + +D +VTIL++ ++FPS+ET K ++FLSNIDKVLNF+V+TVHFF A+  
Sbjct  1    MGTTCLESPPILQDPRVTILETSMVFPSKETEKRSLFLSNIDKVLNFEVETVHFFGANED  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPP  VA   KNA    LV   YDFL GRL  N E++R+EI+CN  GAGF VASSE+ L 
Sbjct  61   FPPAKVAKMFKNALEEALV--VYDFLGGRLNLNPETKRLEIDCNGKGAGFVVASSEYKLS  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
            +IGDLVYPNPAF Q V  S DFV + DQPLC  Q+TSFKCGGFA+G + +H +FDG  FK
Sbjct  119  EIGDLVYPNPAFAQFVQKSKDFVQQNDQPLCVAQLTSFKCGGFAIGFTTSHTTFDGLSFK  178

Query  616  MFLENLAALS  645
             FL+NLAAL+
Sbjct  179  TFLDNLAALA  188



>ref|XP_010415082.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=451

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 146/191 (76%), Gaps = 4/191 (2%)
 Frame = +1

Query  76   MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  249
            MG+LY + P  L +DLKVTI +S LIFPS+ET+ K +MFLSN+D++LNFDVQTVHFF  +
Sbjct  1    MGSLYQESPPLLLQDLKVTIKESTLIFPSEETSEKKSMFLSNVDQILNFDVQTVHFFRPN  60

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
              FPPEIV+ K++ A  + +  + Y+FLAGRL+ +  S R++++CN AGAGF  A+SE+ 
Sbjct  61   KDFPPEIVSEKLRKALVKAM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVTAASEYT  118

Query  430  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  609
            LE++GDLVYPNPAF QLVT     + K+DQPL   Q+TSFKCGGFA+G S NH +FDG  
Sbjct  119  LEELGDLVYPNPAFAQLVTSQLQSLPKDDQPLFAFQMTSFKCGGFAMGISTNHTTFDGLS  178

Query  610  FKMFLENLAAL  642
            FK FLENLA+L
Sbjct  179  FKTFLENLASL  189



>ref|XP_006391555.1| hypothetical protein EUTSA_v10018535mg [Eutrema salsugineum]
 gb|ESQ28841.1| hypothetical protein EUTSA_v10018535mg [Eutrema salsugineum]
Length=452

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 142/193 (74%), Gaps = 6/193 (3%)
 Frame = +1

Query  76   MGALYLKPETLH-EDLKVTILDSGLIFPSQET---TKHTMFLSNIDKVLNFDVQTVHFFP  243
            MGA Y +P +L  +DLKVTI +S LIFPS++T    + +MFLSN+D++LNFDVQTVHFF 
Sbjct  1    MGASYQEPSSLLLQDLKVTIKESSLIFPSEQTLTNKRKSMFLSNVDQILNFDVQTVHFFR  60

Query  244  ASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSE  423
             +  FPPEIV G ++ A   +   + Y+FLAGRL+ N  S R++++CN AGAGF  A+SE
Sbjct  61   QNKEFPPEIVTGILRKAL--VSAIDVYEFLAGRLRLNHSSGRLDVDCNGAGAGFVTAASE  118

Query  424  FALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
            + LED+GDLVYPNPAF QLVT   +   K+DQPL   Q+TSFKCGGFA+G S NH +FDG
Sbjct  119  YTLEDLGDLVYPNPAFAQLVTSQLESFPKDDQPLFAFQLTSFKCGGFAMGISTNHTTFDG  178

Query  604  SGFKMFLENLAAL  642
              FK FLENLA L
Sbjct  179  LSFKTFLENLATL  191



>ref|NP_564853.2| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
 gb|AAC27152.1| Similar to gb|Z84386 anthranilate N-hydroxycinnamoyl/benzoyltransferase 
from Dianthus caryophyllus [Arabidopsis thaliana]
 gb|AEE34376.1| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
Length=450

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 146/191 (76%), Gaps = 4/191 (2%)
 Frame = +1

Query  76   MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  249
            MG+ Y + P  L EDLKVTI +S LIFPS+ET+ + +MFLSN+D++LNFDVQTVHFF  +
Sbjct  1    MGSSYQESPPLLLEDLKVTIKESTLIFPSEETSERKSMFLSNVDQILNFDVQTVHFFRPN  60

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
              FPPE+V+ K++ A  +L+  + Y+FLAGRL+ +  S R++++CN AGAGF  A+S++ 
Sbjct  61   KEFPPEMVSEKLRKALVKLM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVTAASDYT  118

Query  430  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  609
            LE++GDLVYPNPAF QLVT     + K+DQPL   Q+TSFKCGGFA+G S NH +FDG  
Sbjct  119  LEELGDLVYPNPAFAQLVTSQLQSLPKDDQPLFVFQITSFKCGGFAMGISTNHTTFDGLS  178

Query  610  FKMFLENLAAL  642
            FK FLENLA+L
Sbjct  179  FKTFLENLASL  189



>gb|ACU13324.1| unknown [Glycine max]
Length=260

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 137/183 (75%), Gaps = 2/183 (1%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  276
            P +L +DLKVTI ++ +IFPS+E  + ++FLSNIDKVLNFDV+TVHFF A   FPP +V 
Sbjct  12   PPSLLKDLKVTIHNASMIFPSKEIERKSLFLSNIDKVLNFDVETVHFFGAHKDFPPHVVN  71

Query  277  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  456
             ++KNA    LV   YDFL GRLK N +++R+E++CN  GAGF VASSE+ L+ IGDL Y
Sbjct  72   ERLKNALEDALVV--YDFLGGRLKLNYDTKRLEMDCNPEGAGFVVASSEYNLDQIGDLDY  129

Query  457  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
            PNPAF QLV  + DF+   D PLC  QVTSFKCGGFA+G S +H +FDG  FK FL+N+A
Sbjct  130  PNPAFAQLVHQNKDFLKDGDVPLCVAQVTSFKCGGFAIGISTSHTTFDGLSFKTFLDNIA  189

Query  637  ALS  645
            +++
Sbjct  190  SIA  192



>ref|XP_011077121.1| PREDICTED: LOW QUALITY PROTEIN: omega-hydroxypalmitate O-feruloyl 
transferase [Sesamum indicum]
Length=448

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 142/190 (75%), Gaps = 8/190 (4%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETT--KHTMFLSNIDKVLNFDVQTVHFFPAS  249
            MG L LKP    +DLKV I ++ LI PS   T    ++FLSNID+VLNF VQTVHFFPA+
Sbjct  1    MGTLDLKPAI--QDLKVAIQETTLIHPSSHGTLENKSIFLSNIDQVLNFHVQTVHFFPAN  58

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
            P FPPE    ++KNA  +++VA  YDFL GRLK N ++ R+EIEC+ +G GF VA++E++
Sbjct  59   PDFPPETTVARLKNALEKVMVA--YDFLGGRLKFNHQTGRLEIECSQSGVGFVVATTEYS  116

Query  430  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  609
            L+++GDLVYPNPAF QL+  + D    +DQPLC LQVTSFKCGGFA+G S NH+ FDG  
Sbjct  117  LDEVGDLVYPNPAFMQLIVQALD--KFDDQPLCVLQVTSFKCGGFAMGLSTNHVLFDGLS  174

Query  610  FKMFLENLAA  639
            FK+FLENLA+
Sbjct  175  FKIFLENLAS  184



>ref|XP_003553994.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=444

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 140/190 (74%), Gaps = 2/190 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG    +   L +DL+VTI ++ ++FPS+ET K ++FLSNIDKVLNF+V+TVHFF A+  
Sbjct  1    MGTTCPESPPLLQDLRVTIHETSMVFPSKETEKRSLFLSNIDKVLNFEVETVHFFGANKD  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPP+ VA   KNA    LV   YDFL GRL  N E++R+EI+CNA GAGF VASSE+ L 
Sbjct  61   FPPQKVAKMFKNALEDALV--VYDFLGGRLNLNPETKRLEIDCNAKGAGFVVASSEYKLS  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
            +IG LVYPNP+F Q V  S DF+ + DQPLC  Q+TSFKCGGFA+G + +H +FDG  FK
Sbjct  119  EIGHLVYPNPSFAQFVHKSKDFLQQNDQPLCVAQLTSFKCGGFAIGFTTSHTTFDGLSFK  178

Query  616  MFLENLAALS  645
             FL+NLAAL+
Sbjct  179  TFLDNLAALA  188



>gb|KHN46377.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=444

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 140/190 (74%), Gaps = 2/190 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG    +   L +DL+VTI ++ ++FPS+ET K ++FLSNIDKVLNF+V+TVHFF A+  
Sbjct  1    MGTTCPESPPLLQDLRVTIHETSMVFPSKETEKRSLFLSNIDKVLNFEVETVHFFGANKD  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPP+ VA   KNA    LV   YDFL GRL  N E++R+EI+CNA GAGF VASSE+ L 
Sbjct  61   FPPQKVAKMFKNALEDALV--VYDFLGGRLNLNPETKRLEIDCNAKGAGFVVASSEYKLS  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
            +IG LVYPNP+F Q V  S DF+ + DQPLC  Q+TSFKCGGFA+G + +H +FDG  FK
Sbjct  119  EIGHLVYPNPSFAQFVHKSKDFLQQNDQPLCVAQLTSFKCGGFAIGFTTSHTTFDGLSFK  178

Query  616  MFLENLAALS  645
             FL+NLAAL+
Sbjct  179  TFLDNLAALA  188



>ref|XP_008218487.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Prunus 
mume]
Length=488

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 148/198 (75%), Gaps = 11/198 (6%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG+L+ +  TL +DLKVT+  S LIFPSQ+T K T+FLSNID+VLNFDVQTVHFF A   
Sbjct  1    MGSLHDQ-LTLLQDLKVTVHHSCLIFPSQQTQKKTVFLSNIDQVLNFDVQTVHFFGAHKD  59

Query  256  FP-PEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFAL  432
            FP  +IVA K+++A  ++LV   YDFLAGRLK N  + R+EI+CNAAGAGF VASSE+AL
Sbjct  60   FPQSQIVAEKVQDALAQILVP--YDFLAGRLKLNPNTSRLEIDCNAAGAGFVVASSEYAL  117

Query  433  EDIGDLVYPNPAFRQLVTMSFDFVA-------KEDQPLCFLQVTSFKCGGFALGTSMNHI  591
            ++IGDLVYPN AF QLV  + D            DQPL  LQVT+FKCGGFA+G S NH 
Sbjct  118  DEIGDLVYPNSAFAQLVCTAMDSRILNPAAGDDHDQPLFILQVTTFKCGGFAMGISNNHT  177

Query  592  SFDGSGFKMFLENLAALS  645
            +FDG  F++FL+NLAA++
Sbjct  178  TFDGLSFRLFLDNLAAVA  195



>ref|XP_007205121.1| hypothetical protein PRUPE_ppa004875mg [Prunus persica]
 gb|EMJ06320.1| hypothetical protein PRUPE_ppa004875mg [Prunus persica]
Length=487

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 149/196 (76%), Gaps = 9/196 (5%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG+L+ +  TL +DLKVT+  S L+FPSQ+T K T+FLSNID+VL FDVQTVHFF A   
Sbjct  1    MGSLHDQ-LTLLQDLKVTVHHSCLVFPSQQTQKKTVFLSNIDQVLKFDVQTVHFFGAHKD  59

Query  256  FP-PEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFAL  432
            FP  +IVA K+K+A  ++LV   YDFLAGRLK N  + R+EI+CNAAGAGF VASSE+AL
Sbjct  60   FPESQIVAEKVKDALAKILVP--YDFLAGRLKLNPNTSRLEIDCNAAGAGFVVASSEYAL  117

Query  433  EDIGDLVYPNPAFRQLVTMSFDF-----VAKEDQPLCFLQVTSFKCGGFALGTSMNHISF  597
            ++IGDLVYPN AF QLV  + D       A +D+PL  LQVT+FKCGGFA+G S NH +F
Sbjct  118  DEIGDLVYPNSAFAQLVCTAMDSRILNPAAGDDRPLFILQVTTFKCGGFAMGISNNHATF  177

Query  598  DGSGFKMFLENLAALS  645
            DG  F++FL+NLAA++
Sbjct  178  DGLSFRLFLDNLAAVA  193



>ref|XP_002886918.1| hypothetical protein ARALYDRAFT_315582 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63177.1| hypothetical protein ARALYDRAFT_315582 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 144/191 (75%), Gaps = 4/191 (2%)
 Frame = +1

Query  76   MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  249
            MG+ Y + P  L +DLKVTI +S LIFPS ET+ + +MFLSN+D++LNFDVQTVHFF  +
Sbjct  1    MGSSYQESPPLLLQDLKVTIKESSLIFPSDETSERKSMFLSNVDQILNFDVQTVHFFRPN  60

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
              FPPE+V+ K++ A  + +  + Y+FLAGRL+ +  S R++++CN AGAGF  A+SE+ 
Sbjct  61   KDFPPEMVSEKLRKALVKAM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVTAASEYT  118

Query  430  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  609
            LE++GDLVYPNPAF QLVT     + K+DQPL   QVTSFKCGGFA+G S NH +FDG  
Sbjct  119  LEELGDLVYPNPAFAQLVTSQLPSLPKDDQPLFAFQVTSFKCGGFAMGISTNHTTFDGLS  178

Query  610  FKMFLENLAAL  642
            FK FLENLA+L
Sbjct  179  FKTFLENLASL  189



>ref|XP_004493124.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=447

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 139/190 (73%), Gaps = 2/190 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG    +   L +DLKVTI  + +IFPS++T + ++FLSNIDKVLNF+V+T+HFF A+  
Sbjct  1    MGTTCQETPPLLQDLKVTIHKTSMIFPSKQTERQSLFLSNIDKVLNFNVETIHFFEANKD  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPP+IV  K+K A   +LV   YDFLAGRLK N E+ R+EI+CNA GAGF VASS++ L+
Sbjct  61   FPPQIVVEKLKKALEDVLVV--YDFLAGRLKMNSETNRLEIDCNAEGAGFVVASSDYKLD  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  615
             IGDL YPNPAF Q V  + DF+   D PLC  Q+TSFKCGGF +G + +H +FDG  FK
Sbjct  119  QIGDLTYPNPAFEQFVHKTKDFLKLGDLPLCVFQLTSFKCGGFTIGITTSHATFDGLSFK  178

Query  616  MFLENLAALS  645
             FL+NLA+L+
Sbjct  179  TFLDNLASLA  188



>ref|XP_010511440.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Camelina sativa]
 ref|XP_010511441.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Camelina sativa]
Length=451

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 144/191 (75%), Gaps = 4/191 (2%)
 Frame = +1

Query  76   MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  249
            MG+LY + P  L +DLKVTI +S LIFPS ET+ + +MFLSN+D++LNFDVQTVHFF ++
Sbjct  1    MGSLYQESPPLLLQDLKVTINESTLIFPSDETSERKSMFLSNVDQILNFDVQTVHFFRSN  60

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
              FPPE+V+ K++ A  + +  + Y+FLAGRL+ +  S R++++CN AGAGF    SE+ 
Sbjct  61   KDFPPEMVSEKLRRALVKAM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVTGESEYT  118

Query  430  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  609
            LE++GDLVYPNPAF QLVT     + K+DQPL   Q+TSFKCGGFA+G S NH +FDG  
Sbjct  119  LEELGDLVYPNPAFAQLVTSQLKSLRKDDQPLFAFQMTSFKCGGFAMGISTNHTTFDGLS  178

Query  610  FKMFLENLAAL  642
            FK FLENLA+L
Sbjct  179  FKTFLENLASL  189



>ref|XP_010241521.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=459

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 139/183 (76%), Gaps = 2/183 (1%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  276
            P +L  DLKV    S  I P ++T + ++FLSN+D+VLNF+V+TVHFFPA+P FPPE V 
Sbjct  9    PLSLITDLKVRRQRSSRIIPPEKTERRSLFLSNMDQVLNFNVETVHFFPANPDFPPETVV  68

Query  277  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  456
              ++ AF+++L+   YDFLAGRL+ N +  R+EI+CN+AG GF VASSE +L++IGDLVY
Sbjct  69   DILEAAFQKILMP--YDFLAGRLRFNPQQRRLEIDCNSAGIGFWVASSELSLDEIGDLVY  126

Query  457  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
            PNPAFRQL+    D +  +D PLC +QVT+FKCGGFALG   NH++FDG   K+FLENLA
Sbjct  127  PNPAFRQLIMDKVDNLDADDSPLCVVQVTTFKCGGFALGLCTNHVTFDGISVKLFLENLA  186

Query  637  ALS  645
            +L+
Sbjct  187  SLT  189



>ref|XP_010673872.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Beta 
vulgaris subsp. vulgaris]
Length=454

 Score =   221 bits (563),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG LY  P  L +DLKVTILDS LI+  QE+ + +MFLSNID+VLNFDVQT+HFF ++P 
Sbjct  1    MGTLYQVPPPLLKDLKVTILDSSLIYSPQESEEKSMFLSNIDQVLNFDVQTLHFFTSNPE  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPP+I   K+KNA ++LLV   Y FL+GR+K N ++ R+EI+C   G GF +ASSE+ L+
Sbjct  61   FPPKIAFEKLKNALQKLLVP--YYFLSGRVKLNHKNGRIEIDCKNGGIGFVIASSEYTLD  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKED-QPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  612
            ++GDLVYPNP+F QL+T   D + + D  PLC +Q+T+FKCGGF +G   NH +FDG+  
Sbjct  119  ELGDLVYPNPSFEQLLTKKMDDLLEVDGHPLCIVQMTAFKCGGFVMGLQTNHATFDGTSI  178

Query  613  KMFLENLAALS  645
            K  L+NLAAL+
Sbjct  179  KYLLQNLAALA  189



>ref|XP_010268237.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=458

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 139/188 (74%), Gaps = 9/188 (5%)
 Frame = +1

Query  100  ETLHED-------LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGF  258
            E LHED       LKV++     I P+++T + ++FLSNID+VLNF V++VHFF A+P F
Sbjct  2    EPLHEDVPPLSTDLKVSLQRCSTILPAEKTQRRSIFLSNIDQVLNFTVESVHFFLANPAF  61

Query  259  PPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALED  438
            PPE VA  ++ A ++LLV   YDFLAGRL+ N +  R+EI+CN+AG GF+VA+SE +LE+
Sbjct  62   PPETVAQMLERALQKLLVE--YDFLAGRLRFNPQQGRLEIDCNSAGVGFSVATSELSLEE  119

Query  439  IGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKM  618
            +GDLVYPNPAF QL+      +  +DQPLC LQVTSF+CGGFA+G   NH+ FDG GFKM
Sbjct  120  VGDLVYPNPAFGQLMMDKLCSLETDDQPLCALQVTSFRCGGFAMGVCTNHVLFDGIGFKM  179

Query  619  FLENLAAL  642
            FL NLA+L
Sbjct  180  FLHNLASL  187



>gb|KHN13415.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=447

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 136/183 (74%), Gaps = 2/183 (1%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  276
            P  L +DLKVTI ++ +IFPS+E  + ++FLSNIDKVLNFDV+TVHFF A   FPP +V 
Sbjct  12   PPPLLKDLKVTIHNASMIFPSKEIERKSLFLSNIDKVLNFDVETVHFFGAHKDFPPHVVN  71

Query  277  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  456
             ++KNA    LV   YDFL GRLK N +++R+E++CN  GAGF VASSE+ L+ IGDL Y
Sbjct  72   ERLKNALEDALV--VYDFLGGRLKLNYDTKRLEMDCNPEGAGFVVASSEYNLDQIGDLDY  129

Query  457  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
            PNPAF QLV  + DF+   D PLC  QVTSFKCGGFA+G S +H +FDG  FK FL+N+A
Sbjct  130  PNPAFAQLVHQNKDFLKDGDVPLCVAQVTSFKCGGFAIGISTSHTTFDGLSFKTFLDNIA  189

Query  637  ALS  645
            +++
Sbjct  190  SIA  192



>emb|CDY39285.1| BnaC06g27060D [Brassica napus]
Length=451

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 135/182 (74%), Gaps = 5/182 (3%)
 Frame = +1

Query  106  LHEDLKVTILDSGLIFPSQETTKH---TMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  276
            L +DLKVT  ++ LIFPSQET  H   TMFLSN+D+VLNFDVQTVHFF  +  FPPEIV+
Sbjct  12   LLQDLKVTSKEASLIFPSQETLTHERKTMFLSNVDQVLNFDVQTVHFFRPNKDFPPEIVS  71

Query  277  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  456
              ++ A  R +  + Y+FLAGRL+ N  S R++++CN AGAGF  A+SE+ LE++GDLVY
Sbjct  72   EMLRKALVRAM--DVYEFLAGRLRLNPSSGRLDVDCNGAGAGFVTAASEYTLEELGDLVY  129

Query  457  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
            PNPA+ +LVT     + K+DQPL   QVTSFKCGGFA+G S NH +FDG  FK FL NLA
Sbjct  130  PNPAYVKLVTSQLQSLPKDDQPLFAFQVTSFKCGGFAMGISTNHTTFDGLSFKTFLANLA  189

Query  637  AL  642
            +L
Sbjct  190  SL  191



>ref|XP_003548930.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Glycine 
max]
Length=457

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 136/183 (74%), Gaps = 2/183 (1%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  276
            P  L +DLKVTI ++ +IFPS+E  + ++FLSNIDKVLNFDV+TVHFF A   FPP +V 
Sbjct  12   PPPLLKDLKVTIHNASMIFPSKEIERKSLFLSNIDKVLNFDVETVHFFGAHKDFPPHVVN  71

Query  277  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  456
             ++KNA    LV   YDFL GRLK N +++R+E++CN  GAGF VASSE+ L+ IGDL Y
Sbjct  72   ERLKNALEDALV--VYDFLGGRLKLNYDTKRLEMDCNPEGAGFVVASSEYNLDQIGDLDY  129

Query  457  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
            PNPAF QLV  + DF+   D PLC  QVTSFKCGGFA+G S +H +FDG  FK FL+N+A
Sbjct  130  PNPAFAQLVHQNKDFLKDGDVPLCVAQVTSFKCGGFAIGISTSHTTFDGLSFKTFLDNIA  189

Query  637  ALS  645
            +++
Sbjct  190  SIA  192



>ref|XP_009127402.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Brassica 
rapa]
Length=451

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 141/193 (73%), Gaps = 6/193 (3%)
 Frame = +1

Query  76   MGALYLKPETLH-EDLKVTILDSGLIFPSQETTKH---TMFLSNIDKVLNFDVQTVHFFP  243
            MGA Y +  +L  ++LKVTI +S LIFPS+ET  H   +MFLSN+D++LNFDVQTVHFF 
Sbjct  1    MGASYQECSSLLLQNLKVTIKESYLIFPSEETLTHESKSMFLSNVDQILNFDVQTVHFFR  60

Query  244  ASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSE  423
             +  FPPEIV+  ++ A  R +  + Y+FLAGRL+ N  S R+ I+CN AGAGF  A SE
Sbjct  61   PNKDFPPEIVSEMLRMALVRAM--DVYEFLAGRLRLNPSSGRLNIDCNGAGAGFVTAESE  118

Query  424  FALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
            + LE++GDLVYPNPAF +LVT     + K+DQPL   QVTSFKCGGFA+G S NH +FDG
Sbjct  119  YTLEELGDLVYPNPAFAELVTSQLQSLPKDDQPLFAFQVTSFKCGGFAMGISTNHTTFDG  178

Query  604  SGFKMFLENLAAL  642
              FK FL+NLA+L
Sbjct  179  LSFKTFLDNLASL  191



>emb|CDY16408.1| BnaA02g12120D [Brassica napus]
Length=451

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 141/193 (73%), Gaps = 6/193 (3%)
 Frame = +1

Query  76   MGALYLKPETLH-EDLKVTILDSGLIFPSQETTKH---TMFLSNIDKVLNFDVQTVHFFP  243
            MGA Y +  +L  ++LKVTI +S LIFPS+ET  H   +MFLSN+D++LNFDVQTVHFF 
Sbjct  1    MGASYQECSSLLLQNLKVTIKESYLIFPSEETLTHESKSMFLSNVDQILNFDVQTVHFFR  60

Query  244  ASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSE  423
             +  +PPEIV+  ++ A  R +  + Y+FLAGRL+ N  S R+ I+CN AGAGF  A SE
Sbjct  61   PNKDYPPEIVSEMLRMALVRAM--DVYEFLAGRLRLNPSSGRLNIDCNGAGAGFVTAESE  118

Query  424  FALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
            + LE++GDLVYPNPAF +LVT     + K+DQPL   QVTSFKCGGFA+G S NH +FDG
Sbjct  119  YTLEELGDLVYPNPAFAELVTSQLQSLPKDDQPLFAFQVTSFKCGGFAMGISTNHTTFDG  178

Query  604  SGFKMFLENLAAL  642
              FK FL+NLA+L
Sbjct  179  LSFKTFLDNLASL  191



>gb|ACU13347.1| unknown [Glycine max]
Length=238

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  291
            +DLKV I ++ +IFPS+E  + ++FLSNIDKVL+FDV+TVHFF A   FPP +V  ++KN
Sbjct  18   QDLKVIIHNASMIFPSKEIERKSLFLSNIDKVLSFDVETVHFFGAHKDFPPRVVNERLKN  77

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            A    L+   YDFL GRLK N +++R+E++CN+ GAGF VASSE+ L+ IGDL YPNPAF
Sbjct  78   ALEDALM--VYDFLGGRLKLNFDTKRLEMDCNSEGAGFVVASSEYNLDQIGDLDYPNPAF  135

Query  472  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             QLV  + DF+   D PLC  QVTSFKCGGFA+G S +H +FDG  FK FL+N+A+++
Sbjct  136  AQLVQKNKDFLKHGDVPLCVAQVTSFKCGGFAIGISTSHTTFDGLSFKTFLDNIASIA  193



>ref|XP_010470417.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=451

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 4/191 (2%)
 Frame = +1

Query  76   MGALYLKPETLH-EDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  249
            MG+LY +   L  +DLKVTI +S LIFPS+ET+ K +MFLSN+D++LNFDVQTVHFF  +
Sbjct  1    MGSLYQESSPLLLQDLKVTIKESTLIFPSEETSEKKSMFLSNVDQILNFDVQTVHFFRPN  60

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
              F PEIV+ K++ A  + +  + Y+FLAGRL+ +  S R++++CN +GAGF  A+SE+ 
Sbjct  61   KDFLPEIVSEKLRKALVKAM--DAYEFLAGRLRVDPSSGRLDVDCNGSGAGFVTAASEYT  118

Query  430  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  609
            LE++GDLVYPNPAF QLVT     + K++QPL   Q+TSFKCGGFA+G S NH +FDG  
Sbjct  119  LEELGDLVYPNPAFAQLVTSQLQSLPKDNQPLFAFQMTSFKCGGFAMGISTNHTTFDGLS  178

Query  610  FKMFLENLAAL  642
            FK FLENLA+L
Sbjct  179  FKTFLENLASL  189



>gb|EYU17601.1| hypothetical protein MIMGU_mgv1a006316mg [Erythranthe guttata]
Length=448

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 139/192 (72%), Gaps = 6/192 (3%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            M AL   P    EDLKV   +S LIFP +ET K ++FLSNID++LN+D+ T HFF A+P 
Sbjct  1    MAALSAVPSM--EDLKVKFQESSLIFPYKETPKKSIFLSNIDQILNYDIPTAHFFKANPA  58

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPPEIVA + K A  ++LV   YDF+AGRLK N+E  R+EI+CNAAGAGF VA S+ +L+
Sbjct  59   FPPEIVAKRFKFALEKVLV--PYDFMAGRLKLNRELGRLEIDCNAAGAGFVVAKSDVSLD  116

Query  436  DIGD-LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  609
            +IG+ LVYPN  +RQL     D +  E DQPLC  Q+TSFKCGGFA+G S NHI FDG G
Sbjct  117  EIGENLVYPNLGYRQLAVQRLDSLPPEVDQPLCVFQITSFKCGGFAIGMSTNHILFDGIG  176

Query  610  FKMFLENLAALS  645
             K+F+ENLA+ S
Sbjct  177  AKVFIENLASQS  188



>ref|XP_007151622.1| hypothetical protein PHAVU_004G062600g [Phaseolus vulgaris]
 gb|ESW23616.1| hypothetical protein PHAVU_004G062600g [Phaseolus vulgaris]
Length=449

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 136/183 (74%), Gaps = 2/183 (1%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  276
            P  L EDLKVTI +  +IFPS+E  + +MF+SNIDKVL FDV+TVHFF A   FPP +V+
Sbjct  10   PTPLLEDLKVTIENCSMIFPSKEIQRKSMFVSNIDKVLTFDVETVHFFGAHRDFPPHLVS  69

Query  277  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  456
             ++KNA    LV   Y+FL GRLK   ES+R+EI+C++ GAGF VASSE+ L+ IGDL Y
Sbjct  70   ERLKNALEDALV--VYEFLGGRLKVCHESKRLEIDCSSEGAGFVVASSEYKLDQIGDLDY  127

Query  457  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
            PN AF QLV  +  F+ ++D PLC +QVTSFKCGGFA+G S +H +FDG  FK FLEN+A
Sbjct  128  PNTAFAQLVHKNKSFLREDDDPLCVVQVTSFKCGGFAIGISTSHTTFDGLSFKSFLENIA  187

Query  637  ALS  645
            AL+
Sbjct  188  ALA  190



>ref|XP_003624566.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AES80784.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=445

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            D+KVTI  + +IFPS++T   +MFLSNIDKVLNF V+TVHFF A+  FPP+IV  K+K A
Sbjct  13   DMKVTIHKTSMIFPSKQTENKSMFLSNIDKVLNFYVKTVHFFEANKDFPPQIVTEKLKKA  72

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
                LVA  YDFLAGRLK N E+ R+EI+CNA G GF VASSE+ L  IGDL YPN AF 
Sbjct  73   LEDALVA--YDFLAGRLKMNTETNRLEIDCNAEGVGFVVASSEYKLNQIGDLAYPNQAFA  130

Query  475  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            Q V  + DF+   D PLC +Q+TSFKCGGFA+G + +H++FDG  FK FL+NLA+L+
Sbjct  131  QFVHNAKDFLKIGDLPLCVVQLTSFKCGGFAIGFTTSHVTFDGLSFKNFLDNLASLA  187



>ref|XP_011014891.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
Length=468

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 143/193 (74%), Gaps = 4/193 (2%)
 Frame = +1

Query  73   IMGALYLKPETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  249
            IMG    +     +DLKVTI +S L+FP+QET  + +MFLSNID+VLNF+V+TVHFF + 
Sbjct  20   IMGIQCQETPPPLQDLKVTIQNSSLVFPNQETAQRKSMFLSNIDQVLNFNVETVHFFASH  79

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
              FPP+ VA KIK+A  ++LV   YDFLAGRLK N  + R+E++CN AGAGF VASSE  
Sbjct  80   EDFPPQTVAEKIKDALEKILVP--YDFLAGRLKLNARTGRLEVDCNGAGAGFVVASSECT  137

Query  430  LEDIGDLVYPNPAFRQLVTMSFDF-VAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGS  606
            L++IGDLVYPN AF +LV  S D  + K+ + LC +QVTSFKCGGFA+G S +H +FDG 
Sbjct  138  LDEIGDLVYPNAAFAKLVVNSSDHSLEKDGKLLCIIQVTSFKCGGFAMGISTSHATFDGI  197

Query  607  GFKMFLENLAALS  645
             FK FL+NLAAL+
Sbjct  198  SFKTFLQNLAALA  210



>ref|XP_002316174.2| hypothetical protein POPTR_0010s18710g [Populus trichocarpa]
 gb|EEF02345.2| hypothetical protein POPTR_0010s18710g [Populus trichocarpa]
Length=468

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 143/193 (74%), Gaps = 4/193 (2%)
 Frame = +1

Query  73   IMGALYLKPETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  249
            IMG    +     +DLKVTI +S L+FP+ ET  + +MFLSNID+VLNF+V+TVHFF + 
Sbjct  20   IMGIQCQETPPPLQDLKVTIQNSSLVFPNHETAQRKSMFLSNIDQVLNFNVETVHFFASH  79

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
              FPP+ VA KIK+A  ++LV   YDFLAGRLK N  + R+E++CN AGAGF VASSE  
Sbjct  80   EDFPPQTVAEKIKDALEKILVP--YDFLAGRLKSNARTGRLEVDCNGAGAGFVVASSECT  137

Query  430  LEDIGDLVYPNPAFRQLVTMSFDF-VAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGS  606
            L++IGDLVYPN AF +LV  S D  + K+ + LC +QVTSFKCGGFA+G S +H +FDG 
Sbjct  138  LDEIGDLVYPNAAFAKLVVNSSDHSLEKDGKLLCIIQVTSFKCGGFAMGISTSHATFDGI  197

Query  607  GFKMFLENLAALS  645
             FK+FL+NLAAL+
Sbjct  198  SFKIFLQNLAALA  210



>gb|KHN46812.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=424

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 126/167 (75%), Gaps = 2/167 (1%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            ++FPS+ET K ++FLSNIDKVLNF+V+TVHFF A+  FPP  VA   KNA    LV   Y
Sbjct  1    MVFPSKETEKRSLFLSNIDKVLNFEVETVHFFGANEDFPPAKVAKMFKNALEEALV--VY  58

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
            DFL GRL  N E++R+EI+CN  GAGF VASSE+ L +IGDLVYPNPAF Q V  S DFV
Sbjct  59   DFLGGRLNLNPETKRLEIDCNGKGAGFVVASSEYKLSEIGDLVYPNPAFAQFVQKSKDFV  118

Query  505  AKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             + DQPLC  Q+TSFKCGGFA+G + +H +FDG  FK FL+NLAAL+
Sbjct  119  QQNDQPLCVAQLTSFKCGGFAIGFTTSHTTFDGLSFKTFLDNLAALA  165



>ref|XP_011078800.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Sesamum 
indicum]
Length=452

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = +1

Query  91   LKPETLHEDLKVTILDSGLIFPSQETTKH-TMFLSNIDKVLNFDVQTVHFFPASPGFPPE  267
            L P    +DLK+T   S L+FP+Q+T  H T+FLSNID+ LNF+VQ ++FF  +P FPP+
Sbjct  10   LSPNPAMQDLKLTFQLSTLVFPAQQTDDHKTLFLSNIDQSLNFNVQILYFFSPNPDFPPD  69

Query  268  IVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGD  447
             V  ++K A  ++LV   YDF+AGRLK N  S R+++ CNAAGAGF  ASS F+L++IGD
Sbjct  70   TVVTRLKLAVEKVLVP--YDFMAGRLKWNHHSARLDLHCNAAGAGFMAASSTFSLDEIGD  127

Query  448  LVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLE  627
            LV PNP FRQLV  + + +  EDQPLC  QVTSFKCGGFA+G S+NHI  DG   +MFLE
Sbjct  128  LVCPNPGFRQLVVQTLNNLEDEDQPLCVFQVTSFKCGGFAIGVSLNHILLDGLAGRMFLE  187

Query  628  NLAA  639
            NLA+
Sbjct  188  NLAS  191



>ref|XP_009361568.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Pyrus 
x bretschneideri]
Length=499

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 141/198 (71%), Gaps = 17/198 (9%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPP-EIV  273
            P +L +DLKVT+  S L+FPSQ+T K TMFLSNID+VLNFDV +VHFF A   FP  +I 
Sbjct  19   PHSLLQDLKVTVHHSSLVFPSQQTQKRTMFLSNIDQVLNFDVHSVHFFGAHKDFPDGQIA  78

Query  274  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  453
            A K++++  ++LV   YDFLAGRLK N  + R+EIECN AGAGF VASSE+AL++IGDLV
Sbjct  79   AEKLRDSLAKILVP--YDFLAGRLKVNPNTGRLEIECNGAGAGFVVASSEYALDEIGDLV  136

Query  454  YPNPAFRQLVTMSFDF---------VAKED-----QPLCFLQVTSFKCGGFALGTSMNHI  591
            YPN AF QLV  + D             +D     QPL  LQVT+FKCGGFA+G S NH 
Sbjct  137  YPNSAFAQLVCSAMDHDQLLKLTAGAVGDDHDGLRQPLFILQVTTFKCGGFAMGISNNHA  196

Query  592  SFDGSGFKMFLENLAALS  645
            +FDG  F++FL+NLAAL+
Sbjct  197  TFDGISFRLFLDNLAALA  214



>ref|XP_008370853.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Malus 
domestica]
Length=499

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 141/198 (71%), Gaps = 17/198 (9%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPP-EIV  273
            P +L +DLKVT+  S L+FPSQ+T K TMFLSNID+VLNFDV +VHFF A   FP  +I 
Sbjct  19   PHSLLQDLKVTVHHSSLVFPSQQTQKRTMFLSNIDQVLNFDVHSVHFFGAHKDFPDGQIA  78

Query  274  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  453
            A K++++  ++LV   YDFLAGRLK N  + R+EIECN AGAGF VASSE+AL++IGDLV
Sbjct  79   AEKLRDSLAKILVP--YDFLAGRLKVNPNTGRLEIECNGAGAGFVVASSEYALDEIGDLV  136

Query  454  YPNPAFRQLVTMSFDF---------VAKED-----QPLCFLQVTSFKCGGFALGTSMNHI  591
            YPN AF QLV  + D             +D     QPL  LQVT+FKCGGFA+G S NH 
Sbjct  137  YPNSAFAQLVCSAMDHDQLLKLTDGAVGDDHDGLRQPLFILQVTTFKCGGFAMGISNNHA  196

Query  592  SFDGSGFKMFLENLAALS  645
            +FDG  F++FL+NLAAL+
Sbjct  197  TFDGISFRLFLDNLAALA  214



>ref|XP_003624564.1| Omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
 gb|AES80782.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=435

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 131/180 (73%), Gaps = 2/180 (1%)
 Frame = +1

Query  106  LHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI  285
            L +D+KVTI  + +IFPS++  K ++FLSNID+VLNF V+TVHFF A+  FPP+IV  K+
Sbjct  11   LLQDMKVTIHKTSMIFPSKQIEKKSLFLSNIDRVLNFHVKTVHFFEANKDFPPQIVTEKL  70

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K A    LVA  YDFLAGRLK N E+ R+EI+CNA G GF VASSE+ L  IGDL YPN 
Sbjct  71   KKALEDALVA--YDFLAGRLKMNTETNRLEIDCNAEGVGFVVASSEYKLNQIGDLAYPNQ  128

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            AF Q V  + DF+   D PLC +QVTSFKCGGFA G + +H + DG   K+FL+NLAAL+
Sbjct  129  AFAQFVHNAKDFLKIGDLPLCVVQVTSFKCGGFAFGITRSHAAIDGHSLKIFLDNLAALA  188



>ref|XP_003519943.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X1 [Glycine max]
Length=456

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  291
            +DLKV I ++ +IFPS+E  + ++FLSNIDKVL+FDV+TVHFF A   FPP +V  ++KN
Sbjct  18   QDLKVIIHNASMIFPSKEIERKSLFLSNIDKVLSFDVETVHFFGAHKDFPPRVVNERLKN  77

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            A    LV   YDFL GRLK N +++R+E++CN+ GAGF VASSE+ L+ IGDL YPNPAF
Sbjct  78   ALEDALVV--YDFLGGRLKLNFDTKRLEMDCNSEGAGFVVASSEYNLDQIGDLDYPNPAF  135

Query  472  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             QLV  + DF+   D PLC  QVTSFKCGGFA+G S +H +FDG  FK FL+N+A+++
Sbjct  136  AQLVQKNKDFLKHGDVPLCVAQVTSFKCGGFAIGISTSHTTFDGLSFKTFLDNIASIA  193



>gb|EYU20701.1| hypothetical protein MIMGU_mgv1a023965mg [Erythranthe guttata]
Length=460

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 134/185 (72%), Gaps = 2/185 (1%)
 Frame = +1

Query  91   LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  270
            + P+   +DLK+T  +S L+FPSQ+T K ++FLSNID+ LNF+VQT HFF A+P FPPEI
Sbjct  4    ISPDPSMQDLKITFQESTLVFPSQQTQKKSLFLSNIDQFLNFNVQTAHFFKANPHFPPEI  63

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
             A ++K A  ++LV   YDF+AGRL  N   +R +I+CNAAGAGF VASSEF+L+++GDL
Sbjct  64   AAKRLKMALEKVLVP--YDFMAGRLNWNHHLDRFKIDCNAAGAGFVVASSEFSLDELGDL  121

Query  451  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
              PN  FRQL       +  + QPLC  QVT+FKCGGFA+G S+NH+ FDG    MF +N
Sbjct  122  FRPNLGFRQLAVEKLRNLDDDKQPLCVFQVTAFKCGGFAIGVSLNHMLFDGLAAIMFQQN  181

Query  631  LAALS  645
            LA+L+
Sbjct  182  LASLA  186



>gb|EYU17599.1| hypothetical protein MIMGU_mgv1a006131mg [Erythranthe guttata]
Length=450

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 137/193 (71%), Gaps = 7/193 (4%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            M AL   P    EDLK+   +S LIFP +ET K ++FLSNID++LN+D+ T HFF A+P 
Sbjct  1    MAALSAVPSM--EDLKIKFQESSLIFPYKETPKKSIFLSNIDQILNYDIPTAHFFKANPD  58

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPPEI+A ++K A  ++LV   YDF+AGRLK N+E  R+EI CNAAGAGF VA S+ +L+
Sbjct  59   FPPEIMAKRLKIALEKVLVP--YDFMAGRLKLNRELGRLEINCNAAGAGFVVAKSDVSLD  116

Query  436  DIGD--LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGS  606
            +IGD  LV PN  +RQL     D +  E DQPLC  QVTSFKCGGFA+G S NHI FDG 
Sbjct  117  EIGDENLVCPNLGYRQLAVQRLDSLPPEVDQPLCVFQVTSFKCGGFAIGMSTNHILFDGL  176

Query  607  GFKMFLENLAALS  645
            G K+FL NLA+ S
Sbjct  177  GAKVFLLNLASQS  189



>ref|XP_010556190.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
Length=443

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 133/181 (73%), Gaps = 3/181 (2%)
 Frame = +1

Query  100  ETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAG  279
            E+L +DLK T+ ++ L+FPS   TK TMFLSN+D+VLNFDVQT+HFF  S  FPPEIV+ 
Sbjct  2    ESLCQDLKFTVQETSLVFPSH-GTKKTMFLSNVDQVLNFDVQTLHFFRPSKDFPPEIVSE  60

Query  280  KIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYP  459
             +K+   R +   +Y+F+AGRL+ N  S R+E+ECN AGAGF  A SE  L+++GDLVYP
Sbjct  61   MLKDGVGRAM--ESYEFVAGRLRTNPSSGRLEVECNGAGAGFVRARSECTLDELGDLVYP  118

Query  460  NPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  639
            NPAF  LVT   + + ++DQP+C  Q+TSFKCGGF +G S NH +FDG  F+ FL NLA+
Sbjct  119  NPAFANLVTSRLENLPEDDQPICTFQITSFKCGGFVMGVSTNHAAFDGLSFRNFLGNLAS  178

Query  640  L  642
            L
Sbjct  179  L  179



>gb|EYU17598.1| hypothetical protein MIMGU_mgv1a006131mg [Erythranthe guttata]
Length=456

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 139/199 (70%), Gaps = 13/199 (7%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            M AL   P    EDLK+   +S LIFP +ET K ++FLSNID++LN+D+ T HFF A+P 
Sbjct  1    MAALSAVPSM--EDLKIKFQESSLIFPYKETPKKSIFLSNIDQILNYDIPTAHFFKANPD  58

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPPEI+A ++K A  ++LV   YDF+AGRLK N+E  R+EI CNAAGAGF VA S+ +L+
Sbjct  59   FPPEIMAKRLKIALEKVLVP--YDFMAGRLKLNRELGRLEINCNAAGAGFVVAKSDVSLD  116

Query  436  DIGD--LVYPNPAFRQLVTMSFDFVAKE-DQPLC------FLQVTSFKCGGFALGTSMNH  588
            +IGD  LV PN  +RQL     D +  E DQPLC      +LQVTSFKCGGFA+G S NH
Sbjct  117  EIGDENLVCPNLGYRQLAVQRLDSLPPEVDQPLCVFQFKHYLQVTSFKCGGFAIGMSTNH  176

Query  589  ISFDGSGFKMFLENLAALS  645
            I FDG G K+FL NLA+ S
Sbjct  177  ILFDGLGAKVFLLNLASQS  195



>gb|EYU34269.1| hypothetical protein MIMGU_mgv1a006390mg [Erythranthe guttata]
Length=445

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 5/188 (3%)
 Frame = +1

Query  91   LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  270
            L P    EDLKV   +S LIFP +ET K ++FLSN+D++LN+D+ T HFF  +P FPPE 
Sbjct  4    LSPVPSMEDLKVMFQESSLIFPYKETPKKSIFLSNMDQILNYDIPTAHFFGPNPDFPPET  63

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIG--  444
            VA +++ A  ++LV   YDF+AGRLK+N+E  R+EI CNAAGAGF VA S+ +L++IG  
Sbjct  64   VAERLRTALEKVLVP--YDFMAGRLKQNRELGRLEINCNAAGAGFVVAKSDVSLDEIGNE  121

Query  445  DLVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMF  621
            +LV PN  +RQL     D +  E DQPLC  QVTSFKCGGFA+G S NHI FDG G K+F
Sbjct  122  NLVCPNLGYRQLAVQRLDSLPPEVDQPLCVFQVTSFKCGGFAIGMSTNHILFDGLGAKVF  181

Query  622  LENLAALS  645
            L NLA+ S
Sbjct  182  LLNLASQS  189



>gb|EYU17594.1| hypothetical protein MIMGU_mgv1a006220mg [Erythranthe guttata]
Length=452

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 136/193 (70%), Gaps = 7/193 (4%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            M AL   P    EDLK+   +S LIFP +ET K ++FLSNID++LN+D+ T HFF A+P 
Sbjct  1    MAALSAVPSM--EDLKIKFQESSLIFPYKETPKKSIFLSNIDQILNYDIPTAHFFKANPD  58

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPPEI+A ++K A  ++LV   YDF+AGRLK N+E  R+EI CNAAGAGF VA S+ +L+
Sbjct  59   FPPEIMAKRLKIALEKVLVP--YDFMAGRLKLNRELGRLEINCNAAGAGFVVAKSDVSLD  116

Query  436  DIGD--LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGS  606
            +IGD  LV PN  +RQL     D +  E DQPL   QVTSFKCGGFA+G S NHI FDG 
Sbjct  117  EIGDENLVCPNLGYRQLAVQRLDSLPPEVDQPLSVFQVTSFKCGGFAIGMSTNHILFDGL  176

Query  607  GFKMFLENLAALS  645
            G K+FL NLA+ S
Sbjct  177  GAKVFLLNLASQS  189



>gb|EYU34268.1| hypothetical protein MIMGU_mgv1a005307mg [Erythranthe guttata]
Length=489

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 133/188 (71%), Gaps = 5/188 (3%)
 Frame = +1

Query  91   LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  270
            L P    EDL +   +S LIFP +ET K  +FLSNID++LN+++ T HFF A+P FPPE 
Sbjct  4    LSPVPSMEDLNIKFQESSLIFPYKETPKKLIFLSNIDQILNYNIPTAHFFKANPDFPPET  63

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIG--  444
            VA +++ A  ++LV   YDF+AGRLK N+E  R+EI+CNAAGAGF VA S+ +L++IG  
Sbjct  64   VAERLRTALEKVLVP--YDFMAGRLKLNRELGRLEIDCNAAGAGFVVAKSDVSLDEIGGE  121

Query  445  DLVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMF  621
            +LV PN  +RQL     D +  E DQPLC  QVTSFKCGGFA+G S NHI FDG G K+F
Sbjct  122  NLVCPNLGYRQLAVQRLDNLPPEVDQPLCVFQVTSFKCGGFAIGMSTNHILFDGLGAKVF  181

Query  622  LENLAALS  645
            L NLA+ S
Sbjct  182  LLNLASQS  189



>gb|EYU24113.1| hypothetical protein MIMGU_mgv1a019465mg, partial [Erythranthe 
guttata]
Length=182

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 127/172 (74%), Gaps = 4/172 (2%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  291
            +DL+V   +  L+ PS++T + +MFLSNID++ N++  T HFF A+P FPP+IV  ++K 
Sbjct  11   QDLRVIFHEKVLVSPSEKTERKSMFLSNIDQMHNYNAHTAHFFTANPDFPPKIVTERLKM  70

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIG-DLVYPNPA  468
            A  ++L   TYDF AGRL+ N+ES R+EIEC+ AGAGF  ASSE++L D+G DLV+ NP 
Sbjct  71   ALEKVLA--TYDFAAGRLRTNQESGRLEIECDGAGAGFVAASSEYSLCDLGDDLVFSNPG  128

Query  469  FRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  624
            FRQL  + FD + ++DQPL  LQVTSFKCGGFA+GT+MNH   DG+G +  L
Sbjct  129  FRQLSVL-FDILPRDDQPLLILQVTSFKCGGFAIGTAMNHTLVDGAGAQKLL  179



>ref|XP_010912121.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Elaeis 
guineensis]
Length=452

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 135/191 (71%), Gaps = 5/191 (3%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG L   P    +DLKVTIL S  ++P+++T   +MFLSNID++LNFDV+T+HFF A+  
Sbjct  1    MGPLPQGPTL--QDLKVTILSSTTLYPAEKTEGRSMFLSNIDQILNFDVETIHFFAANLE  58

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FP  +V  ++ +A  ++LV   YDFLAGRLK      R+ I+CNAAG    VASSE  LE
Sbjct  59   FPAAVVVERLSSALEKVLV--PYDFLAGRLKLEPGDGRLVIDCNAAGVKLVVASSELKLE  116

Query  436  DIGDLVYPNPAFRQLVTMSFD-FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  612
            ++GDL  PNPAFRQLV  + D  +A ED+PLC  QVTSFKCGGFALG   NHI+FDG  F
Sbjct  117  EVGDLQCPNPAFRQLVAANPDNGLALEDRPLCSFQVTSFKCGGFALGICNNHITFDGLSF  176

Query  613  KMFLENLAALS  645
            + FL+NLAA++
Sbjct  177  QAFLQNLAAVA  187



>ref|XP_011466087.1| PREDICTED: LOW QUALITY PROTEIN: omega-hydroxypalmitate O-feruloyl 
transferase [Fragaria vesca subsp. vesca]
Length=521

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 132/200 (66%), Gaps = 19/200 (10%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  276
            P  L +DLKVT+    L+ PS ET K ++FLSNID+VLNFDVQTV FF +   F  ++VA
Sbjct  34   PSNLLKDLKVTVQYKSLVSPSHETEKRSIFLSNIDQVLNFDVQTVLFFASHNEFSSDLVA  93

Query  277  GKIKNAFRRLLVANTYDFLAGRLKKNKES----ERVEIECNAAGAGFTVASSEFALEDIG  444
             K+K +   +LV   YDFLAG LK N  S     R+ IECNAAGAGF VASSE+AL +IG
Sbjct  94   EKLKQSLTNILVP--YDFLAGGLKLNPNSSTGGSRLAIECNAAGAGFLVASSEYALHEIG  151

Query  445  DLVYPNPAFRQLVTMSFDFVAK-------------EDQPLCFLQVTSFKCGGFALGTSMN  585
            DLVYPN AF QLV ++ D   K              D PLC LQVT FKCGGFA+G S N
Sbjct  152  DLVYPNSAFAQLVCITMDMDRKNDASIKHPASAGHRDHPLCILQVTKFKCGGFAMGISTN  211

Query  586  HISFDGSGFKMFLENLAALS  645
            H  FDG  F++FL+NLAAL+
Sbjct  212  HXIFDGQSFRLFLDNLAALA  231



>ref|XP_011100415.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Sesamum indicum]
Length=448

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 3/184 (2%)
 Frame = +1

Query  88   YLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPE  267
            ++ P    +DLK+ +  S L+ P+++T     FLSNID+ LNFDV TVHFF A+P FPPE
Sbjct  3    FVLPVPSMQDLKLKLQQSTLVSPAKQTENKVFFLSNIDQFLNFDVVTVHFFKANPDFPPE  62

Query  268  IVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGD  447
             VA ++K A  R+LV   YDFLAGRLK N  S R+EI+CN+AG GF VASSE +L ++GD
Sbjct  63   TVAKRLKMALERVLVP--YDFLAGRLKLNLHSGRLEIDCNSAGVGFVVASSECSLAEVGD  120

Query  448  LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  624
            LV PN  FRQL   + D +  E DQ LC  QVTSFKCGGF++G S NH+ FDG+  ++F+
Sbjct  121  LVSPNLGFRQLAIQTLDNLGPEVDQLLCVFQVTSFKCGGFSIGMSTNHVLFDGASAQIFI  180

Query  625  ENLA  636
            ENLA
Sbjct  181  ENLA  184



>ref|XP_004138891.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
 ref|XP_004155115.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
Length=469

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 137/197 (70%), Gaps = 9/197 (5%)
 Frame = +1

Query  76   MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-----KHTMFLSNIDKVLNFDVQTVHF  237
            MG+ + K P  L +DLKV+I +  ++FPSQ  T      + +FL+NID+VLNF V+T+ F
Sbjct  1    MGSFHQKSPILLPQDLKVSIKECSVVFPSQLETDQKKKSNVLFLTNIDQVLNFSVETLQF  60

Query  238  FPASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVAS  417
            F     FP  ++  K+K  F +LLV   Y+ LAGRLK + E+ R+EI+CN AGAGF VAS
Sbjct  61   FSPHTKFPSHVIIEKMKTTFSKLLVP--YELLAGRLKVSHENGRLEIDCNGAGAGFVVAS  118

Query  418  SEFALEDIGDLVYPNPAFRQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHIS  594
            S++ L++IGDLVYPNPAF QLVT S   + K  DQPL  LQVT FKCGGFA+G S NH +
Sbjct  119  SDYCLDEIGDLVYPNPAFHQLVTKSLAALFKPHDQPLVILQVTLFKCGGFAMGFSTNHCA  178

Query  595  FDGSGFKMFLENLAALS  645
            FDG  FK FL+N AAL+
Sbjct  179  FDGLSFKQFLDNFAALA  195



>gb|EYU20679.1| hypothetical protein MIMGU_mgv1a006412mg [Erythranthe guttata]
Length=445

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 128/183 (70%), Gaps = 2/183 (1%)
 Frame = +1

Query  91   LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  270
            + P    +DLKV I +S L+FPSQ+T K + FLS++D  L +++QT +FF A+P +PPE 
Sbjct  4    ISPNPAMKDLKVKIEESKLVFPSQQTQKRSFFLSDVDHFLCYNIQTAYFFKANPDYPPES  63

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
            +A ++K A  ++LV   YDF+AGRLK N +S R+EI+CN+ GAGF  ASSEF LE++GDL
Sbjct  64   IARRLKMAVEKVLVP--YDFMAGRLKWNHQSGRLEIDCNSQGAGFVFASSEFTLEELGDL  121

Query  451  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
            + PNPAF+QL       +  + QPLC  QVTSF CGGFA G S +H+  DG   KMF EN
Sbjct  122  LSPNPAFQQLAVDKLPGLDDDKQPLCVFQVTSFNCGGFAFGMSNDHVLLDGLAAKMFREN  181

Query  631  LAA  639
            LA+
Sbjct  182  LAS  184



>ref|XP_011075071.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Sesamum 
indicum]
Length=453

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 136/188 (72%), Gaps = 6/188 (3%)
 Frame = +1

Query  88   YLKPETLHEDLKVTILDSGLIFPSQET----TKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            ++ P    +DLK+T  +S L+ PS++T       ++FLSNID++LN+++ TVHFF A+P 
Sbjct  3    FILPIPPMQDLKITFQESILVSPSKQTDDDDPNKSIFLSNIDQILNYNIPTVHFFKANPD  62

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            FPP+IV  ++K A +R+L  + Y F+AGR K N++  R+EI+CN+AGAGF VASS+++L+
Sbjct  63   FPPQIVPKRLKMALQRVLQVH-YHFMAGRFKLNQQLGRLEIDCNSAGAGFVVASSDYSLD  121

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  612
            D+GD VYPN  FRQL   + D +  E +QPLC  QVTSFKCGGF +G S NH+  DG+  
Sbjct  122  DLGDFVYPNLGFRQLAVQTLDNLGPEVEQPLCVFQVTSFKCGGFCIGMSTNHVLLDGASA  181

Query  613  KMFLENLA  636
            ++F+ENLA
Sbjct  182  QIFIENLA  189



>ref|XP_011100416.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Sesamum indicum]
Length=448

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 130/184 (71%), Gaps = 3/184 (2%)
 Frame = +1

Query  88   YLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPE  267
            ++ P    +DLK+ +  S L+ P+++T     FLSNID+ LN+D+ TVHFF A+P FPPE
Sbjct  3    FVLPVPPMQDLKLKLQQSTLVSPAKQTENQAFFLSNIDQFLNYDILTVHFFKANPDFPPE  62

Query  268  IVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGD  447
             VA ++K A  R+LV   YDFLAGRLK N  S R+EI+CN+AG GF VASSE +L+++GD
Sbjct  63   TVAKRLKMALERVLVP--YDFLAGRLKLNLHSGRLEIDCNSAGVGFVVASSECSLDELGD  120

Query  448  LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  624
            LV PN  FRQL   + D +  E DQ LC  +VTSFKCGGF++G S NH+ FDG   ++F+
Sbjct  121  LVCPNLGFRQLSVQTLDNLGPEVDQLLCVFKVTSFKCGGFSIGMSTNHVLFDGVSAQIFI  180

Query  625  ENLA  636
            ENLA
Sbjct  181  ENLA  184



>gb|AHA84252.1| omega-hydroxypalmitate O-feruloyl transferase [Phaseolus vulgaris]
Length=457

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 129/183 (70%), Gaps = 2/183 (1%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  276
            P  L EDLKVTI +  +IFPS+E  + +MF+SNIDKVL FDV+TVHFF A   FPP +V+
Sbjct  12   PTPLLEDLKVTIENCSMIFPSKEIQRKSMFVSNIDKVLTFDVETVHFFGAHRDFPPHLVS  71

Query  277  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  456
             ++KNA    LV   Y+FL GRLK   ES+R+EI+C++ GAGF VASSE+ L+ IGDL Y
Sbjct  72   ERLKNALEDALV--VYEFLGGRLKVCHESKRLEIDCSSEGAGFVVASSEYKLDQIGDLDY  129

Query  457  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
            PN AF QLV  +  F+ ++D PLC +QV S K GGF +  S +H +FDG  FK  L N+A
Sbjct  130  PNTAFAQLVHKNKSFLREDDDPLCVVQVASAKFGGFPISISAHHSTFDGLSFKSLLGNIA  189

Query  637  ALS  645
            +L+
Sbjct  190  SLA  192



>ref|XP_006858654.1| hypothetical protein AMTR_s00066p00062130 [Amborella trichopoda]
 gb|ERN20121.1| hypothetical protein AMTR_s00066p00062130 [Amborella trichopoda]
Length=549

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 127/180 (71%), Gaps = 2/180 (1%)
 Frame = +1

Query  106  LHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI  285
            L EDLKVTI  S ++ P ++T + +MFLSNID++L F+V+TVHFFPA+P +  +IV    
Sbjct  11   LVEDLKVTIERSSIVLPFEKTPRSSMFLSNIDQILTFNVETVHFFPANPEYHQKIVVELF  70

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            ++A  RLLV   YDF+AGRL  N+ S R EI+CN+AGA F VASS+    +IGDLVYPNP
Sbjct  71   ESALSRLLVP--YDFMAGRLHFNEHSRRFEIDCNSAGAEFIVASSDLTFLEIGDLVYPNP  128

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            AFRQ V    +     D PLC LQVT FKCGGF +G S NH +FDG   K F++NLA+L+
Sbjct  129  AFRQFVPQLSNSKDLADLPLCLLQVTWFKCGGFVMGLSTNHATFDGISAKTFIQNLASLT  188



>ref|XP_010255141.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=465

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            DLKVTI  S  + P+++T +  MFLSNID+ LNF  + + FF  +  +PP  V   ++ A
Sbjct  14   DLKVTIQRSFTVSPTEKTERRFMFLSNIDQGLNFRSEGLQFFKPNANYPPNTVIDILETA  73

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   YDFLAGRL+ N   +R+EI+CN+AG GF VA+S+ ++ +IGDL+YP+P F+
Sbjct  74   CQKILVP--YDFLAGRLRLNPHQDRLEIDCNSAGVGFVVATSDVSVAEIGDLLYPSPVFK  131

Query  475  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            QL+  + D +  +DQPLC LQVTSFKCGGFALG S NH  FDG  F++F+ENL+ ++
Sbjct  132  QLIAEALDTLGADDQPLCVLQVTSFKCGGFALGVSCNHALFDGISFRIFIENLSCVA  188



>gb|EYU34266.1| hypothetical protein MIMGU_mgv1a023386mg, partial [Erythranthe 
guttata]
Length=403

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +1

Query  163  ETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGR  342
            +T K ++FLSNID++LN+D+ T HFF A+P FPPE VA +++ A  ++LV   YDF+AGR
Sbjct  5    QTPKKSIFLSNIDQILNYDIPTAHFFKANPDFPPETVAERLRTALEKVLVP--YDFMAGR  62

Query  343  LKKNKESERVEIECNAAGAGFTVASSEFALEDIG--DLVYPNPAFRQLVTMSFDFVAKE-  513
            LK N+E  R+EI+CNAAGAGF VA S+ +L++IG  +LV PN  +RQL     D +  + 
Sbjct  63   LKLNRELGRLEIDCNAAGAGFVVAKSDVSLDEIGGENLVCPNLGYRQLAVQRLDSLPPDV  122

Query  514  DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            DQPLC  QVTSFKCGGFA+G S NHI FDG G K+FL NLA+ S
Sbjct  123  DQPLCVFQVTSFKCGGFAIGMSTNHILFDGLGAKVFLLNLASQS  166



>ref|XP_010110379.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXC26165.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=165

 Score =   178 bits (451),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 115/159 (72%), Gaps = 6/159 (4%)
 Frame = +1

Query  76   MG-ALYLKPE-TLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPAS  249
            MG ALY  P   L +DLKVT+ +S L+FPS+ET + TMFLSNID+VL FDVQTVHFFP  
Sbjct  1    MGTALYQNPPPDLLQDLKVTVHNSSLVFPSEETERKTMFLSNIDQVLTFDVQTVHFFPTH  60

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
              FPP++V  KIK    ++LV   YDFLAGRL  N ES R+EI+C+ +GAGF  ASSE++
Sbjct  61   KDFPPQLVTEKIKETLGKILVP--YDFLAGRLNLNAESGRLEIDCDGSGAGFVAASSEYS  118

Query  430  LEDIGDLVYPNPAFRQLVTMSFDFVAKE--DQPLCFLQV  540
            L+DIGDLVYPNPAF QLV  + D +  +   + LC LQV
Sbjct  119  LDDIGDLVYPNPAFSQLVCSTLDMLKPDVHHRLLCILQV  157



>gb|KFK22279.1| hypothetical protein AALP_AAs48576U000100 [Arabis alpina]
Length=159

 Score =   176 bits (446),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETTKH-TMFLSNIDKVLNFDVQTVHFFPASPGFPPEIV  273
            P  L +DLKVTI DS LIFPS+ET K  +MFLSN+D+VLNFDVQTVHFF  +  FPPEIV
Sbjct  9    PSLLLQDLKVTIKDSSLIFPSEETHKRKSMFLSNVDQVLNFDVQTVHFFRPNKDFPPEIV  68

Query  274  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  453
            + +++ A  R +  + Y+FLAGRL+ N  S R++++CN AGAGF  A+SE+ LE++G+LV
Sbjct  69   SEELRKALVRAM--DVYEFLAGRLRLNPSSGRLDVDCNGAGAGFVTAASEYTLEELGNLV  126

Query  454  YPNPAFRQLVTMSFDFVAKEDQPLCFLQVTS  546
            YPNPAF QLVT     + K+DQPL   QVT+
Sbjct  127  YPNPAFAQLVTSQLQSLPKDDQPLFAFQVTT  157



>gb|EYU39480.1| hypothetical protein MIMGU_mgv1a027110mg [Erythranthe guttata]
Length=399

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 119/158 (75%), Gaps = 12/158 (8%)
 Frame = +1

Query  178  TMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNK  357
            ++FLSNID+VLNF VQTVHFFPA+  FPPEIVA ++KNA  +++V   YDFLAG+L  N 
Sbjct  6    SIFLSNIDQVLNFHVQTVHFFPANVDFPPEIVAARLKNALEKVMV--PYDFLAGKLTLNH  63

Query  358  ESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQ  537
            ++ R+EIECN++      A++EF+L++IGDLVY NPAF QL+  + +    EDQPLC  Q
Sbjct  64   QTGRLEIECNSSSG----AAAEFSLDEIGDLVYLNPAFMQLIVHALE--KFEDQPLCVFQ  117

Query  538  ----VTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  639
                VTSFKCGGFALG S NH+ FDG  FK+FLENLA+
Sbjct  118  VCTKVTSFKCGGFALGISTNHVLFDGMSFKIFLENLAS  155



>gb|EYU39979.1| hypothetical protein MIMGU_mgv1a005557mg [Erythranthe guttata]
Length=479

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 128/179 (72%), Gaps = 5/179 (3%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  291
            +DLK+T  +S L+ P Q+T K + FLSNID++LN+ + TV FF A+P +PP++V+ ++K 
Sbjct  12   QDLKITFQESSLVLPLQQTEKRSFFLSNIDQILNYRIPTVSFFSANPDYPPQLVSERLKL  71

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            A +++LV   YDF+AGR K N+E+ R+EI+CN+AG GF VASSEF+L +IGDL+ PN  F
Sbjct  72   ALQKVLVP--YDFIAGRFKLNQETGRLEIDCNSAGVGFVVASSEFSLAEIGDLLSPNLGF  129

Query  472  RQLVTMSF-DFVAKEDQ--PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  639
            +QL   +  D +A  D   P   LQVTSFKCG FA+G S+NHI  DG   K F +NLA+
Sbjct  130  QQLAVHTLTDNLAPNDHANPPFILQVTSFKCGSFAIGMSVNHILLDGLSAKAFSQNLAS  188



>ref|XP_007161776.1| hypothetical protein PHAVU_001G097500g [Phaseolus vulgaris]
 gb|ESW33770.1| hypothetical protein PHAVU_001G097500g [Phaseolus vulgaris]
Length=194

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 112/168 (67%), Gaps = 2/168 (1%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  255
            MG   ++  +L +DLKVTI ++  IFPS+ET K T+FLSNIDKV+NFDV TVHFF A+  
Sbjct  1    MGTSCIESPSLVQDLKVTIHETSTIFPSKETEKKTLFLSNIDKVVNFDVDTVHFFSANKD  60

Query  256  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  435
            F P+ VA K+K A    LV   YDFLAGRL  N E++R+EI+CNA GA F VAS+   L 
Sbjct  61   FSPQKVAQKLKKALEDALVC--YDFLAGRLSLNPETKRLEIDCNAKGAVFVVASTHHMLT  118

Query  436  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTS  579
            +IGDL YPNPAF  LV  + DF+   D PLC LQV  F     A G S
Sbjct  119  EIGDLAYPNPAFAHLVHKTEDFLKPTDLPLCTLQVKCFHFCKSAFGNS  166



>ref|XP_011069456.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like, 
partial [Sesamum indicum]
Length=150

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 113/156 (72%), Gaps = 8/156 (5%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETT--KHTMFLSNIDKVLNFDVQTVHFFPAS  249
            MG L LKP    +DLKV I ++ LI PS   T    ++FLSNID+VLNF VQTVHFFPA+
Sbjct  1    MGTLDLKPAI--QDLKVAIQETTLIHPSSHGTLENKSIFLSNIDQVLNFHVQTVHFFPAN  58

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
            P FPPE    ++KNA  +++VA  YDFL GRLK N ++ R+EIEC+ +G GF VA++E++
Sbjct  59   PDFPPETTVARLKNALEKVMVA--YDFLGGRLKFNHQTGRLEIECSQSGVGFVVATTEYS  116

Query  430  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQ  537
            L+++GDLVYPNPAF QL+  + D    +DQPLC LQ
Sbjct  117  LDEVGDLVYPNPAFMQLIVQALD--KFDDQPLCVLQ  150



>ref|NP_001185318.1| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
 gb|ABE65741.1| transferase-like [Arabidopsis thaliana]
 gb|AEE34377.1| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
Length=166

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 117/156 (75%), Gaps = 4/156 (3%)
 Frame = +1

Query  76   MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  249
            MG+ Y + P  L EDLKVTI +S LIFPS+ET+ + +MFLSN+D++LNFDVQTVHFF  +
Sbjct  1    MGSSYQESPPLLLEDLKVTIKESTLIFPSEETSERKSMFLSNVDQILNFDVQTVHFFRPN  60

Query  250  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
              FPPE+V+ K++ A  +L+  + Y+FLAGRL+ +  S R++++CN AGAGF  A+S++ 
Sbjct  61   KEFPPEMVSEKLRKALVKLM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVTAASDYT  118

Query  430  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQ  537
            LE++GDLVYPNPAF QLVT     + K+DQPL   Q
Sbjct  119  LEELGDLVYPNPAFAQLVTSQLQSLPKDDQPLFVFQ  154



>gb|AAM65707.1| unknown [Arabidopsis thaliana]
Length=166

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 111/148 (75%), Gaps = 3/148 (2%)
 Frame = +1

Query  97   PETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIV  273
            P  L EDLKVTI +S LIFPS+ET+ + +MFLSN+D++LNFDVQTVHFF  +  FPPE+V
Sbjct  9    PPLLLEDLKVTIKESTLIFPSEETSERKSMFLSNVDQILNFDVQTVHFFRPNKEFPPEMV  68

Query  274  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  453
            + K++ A  +L+  + Y+FLAGRL  +  S R++++CN AGAGF  A+S++ LE++GDLV
Sbjct  69   SEKLRKALVKLM--DAYEFLAGRLCVDPSSGRLDVDCNGAGAGFVTAASDYTLEELGDLV  126

Query  454  YPNPAFRQLVTMSFDFVAKEDQPLCFLQ  537
            YPNPAF QLVT     + K+DQPL   Q
Sbjct  127  YPNPAFAQLVTSQLQSLPKDDQPLFVFQ  154



>ref|XP_006574746.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Glycine max]
Length=161

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 106/145 (73%), Gaps = 2/145 (1%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  291
            +DLKV I ++ +IFPS+E  + ++FLSNIDKVL+FDV+TVHFF A   FPP +V  ++KN
Sbjct  18   QDLKVIIHNASMIFPSKEIERKSLFLSNIDKVLSFDVETVHFFGAHKDFPPRVVNERLKN  77

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            A    LV   YDFL GRLK N +++R+E++CN+ GAGF VASSE+ L+ IGDL YPNPAF
Sbjct  78   ALEDALV--VYDFLGGRLKLNFDTKRLEMDCNSEGAGFVVASSEYNLDQIGDLDYPNPAF  135

Query  472  RQLVTMSFDFVAKEDQPLCFLQVTS  546
             QLV  + DF+   D PLC  Q ++
Sbjct  136  AQLVQKNKDFLKHGDVPLCVAQEST  160



>gb|KHN00652.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=159

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  291
            +DLKV I ++ +IFPS+E  + ++FLSNIDKVL+FDV+TVHFF A   FPP +V  ++KN
Sbjct  18   QDLKVIIHNASMIFPSKEIERKSLFLSNIDKVLSFDVETVHFFGAHKDFPPRVVNERLKN  77

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            A    LV   YDFL GRLK N +++R+E++CN+ GAGF VASSE+ L+ IGDL YPNPAF
Sbjct  78   ALEDALV--VYDFLGGRLKLNFDTKRLEMDCNSEGAGFVVASSEYNLDQIGDLDYPNPAF  135

Query  472  RQLVTMSFDFVAKEDQPLCFLQ  537
             QLV  + DF+   D PLC  Q
Sbjct  136  AQLVQKNKDFLKHGDVPLCVAQ  157



>emb|CDY07449.1| BnaA07g25280D [Brassica napus]
Length=185

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 5/143 (3%)
 Frame = +1

Query  106  LHEDLKVTILDSGLIFPSQETTKH---TMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  276
            L +DLKVTI ++ LIFP QET  H   +MFLSN+D+VLNFDVQTVHFF  +  FPPEIV+
Sbjct  12   LLQDLKVTIKEASLIFPFQETLTHERKSMFLSNVDQVLNFDVQTVHFFRPNKDFPPEIVS  71

Query  277  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  456
              ++ A  R +  + Y+FLAGRL+ N  S R++++CN AGAGF  A+SE+ LE++GDLVY
Sbjct  72   EMLRKALVRAM--DVYEFLAGRLRLNPSSGRLDVDCNGAGAGFVTAASEYTLEELGDLVY  129

Query  457  PNPAFRQLVTMSFDFVAKEDQPL  525
            PNPAF +LVT     + K+DQPL
Sbjct  130  PNPAFAKLVTSQLQTLPKDDQPL  152



>emb|CDY41783.1| BnaC02g13730D [Brassica napus]
Length=163

 Score =   163 bits (413),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 109/154 (71%), Gaps = 6/154 (4%)
 Frame = +1

Query  76   MGALYLKPETLH-EDLKVTILDSGLIFPSQETTKHT---MFLSNIDKVLNFDVQTVHFFP  243
            MGA Y +  +L  +DLKV I +S LIFPS+ET  H    MFLSN+D+VLNFDVQTVHFF 
Sbjct  1    MGASYQECSSLLLQDLKVAIKESYLIFPSEETLTHERKPMFLSNVDQVLNFDVQTVHFFR  60

Query  244  ASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSE  423
             +  +PPEIV+  ++ A  R +  + YD LAGRL+ N  S R+ ++CN AGAGF +A SE
Sbjct  61   PNKDYPPEIVSEMLRKAMVRAM--DAYDLLAGRLRLNPSSGRLNVDCNGAGAGFVMAESE  118

Query  424  FALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPL  525
            + LE++GDLVYPNPAF +LVT     + K+DQPL
Sbjct  119  YTLEELGDLVYPNPAFVELVTSQLQSLPKDDQPL  152



>ref|XP_006858657.1| hypothetical protein AMTR_s00066p00063330 [Amborella trichopoda]
 gb|ERN20124.1| hypothetical protein AMTR_s00066p00063330 [Amborella trichopoda]
Length=493

 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 127/196 (65%), Gaps = 4/196 (2%)
 Frame = +1

Query  58   LSFTAIMGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHF  237
            +S ++ + +L   P T    L +++     I+PS      T+FLSNID+ L F V+TVHF
Sbjct  1    MSSSSHIVSLKTPPTTRFPSLNLSLKPPTTIYPSSPARHETIFLSNIDQTLAFTVETVHF  60

Query  238  FPASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVAS  417
            F  +PGF P +V+  +K +  RLLV   Y F+AGRL+ N+++ R+E++ N+AGA F+ A 
Sbjct  61   FAPNPGFSPSLVSSILKTSLSRLLV--FYPFMAGRLRFNQDN-RLELDSNSAGAIFSEAF  117

Query  418  SEFALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISF  597
             +  L D+GDL YP+P FRQL     + +A ED PLC +Q+T+FKCGGF++G   NH + 
Sbjct  118  CDLNLSDVGDLTYPDPIFRQLFHRP-ENLAIEDLPLCQIQLTTFKCGGFSIGLGTNHTTL  176

Query  598  DGSGFKMFLENLAALS  645
            DG G   F++NLA+L+
Sbjct  177  DGIGASTFIKNLASLA  192



>gb|KGN61334.1| hypothetical protein Csa_2G091780 [Cucumis sativus]
Length=178

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 110/162 (68%), Gaps = 9/162 (6%)
 Frame = +1

Query  76   MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-----KHTMFLSNIDKVLNFDVQTVHF  237
            MG+ + K P  L +DLKV+I +  ++FPSQ  T      + +FL+NID+VLNF V+T+ F
Sbjct  1    MGSFHQKSPILLPQDLKVSIKECSVVFPSQLETDQKKKSNVLFLTNIDQVLNFSVETLQF  60

Query  238  FPASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVAS  417
            F     FP  ++  K+K  F +LLV   Y+ LAGRLK + E+ R+EI+CN AGAGF VAS
Sbjct  61   FSPHTKFPSHVIIEKMKTTFSKLLVP--YELLAGRLKVSHENGRLEIDCNGAGAGFVVAS  118

Query  418  SEFALEDIGDLVYPNPAFRQLVTMSFDFVAK-EDQPLCFLQV  540
            S++ L++IGDLVYPNPAF QLVT S   + K  DQPL  LQV
Sbjct  119  SDYCLDEIGDLVYPNPAFHQLVTKSLAALFKPHDQPLVILQV  160



>gb|EYU24129.1| hypothetical protein MIMGU_mgv1a020263mg [Erythranthe guttata]
Length=447

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 116/180 (64%), Gaps = 7/180 (4%)
 Frame = +1

Query  112  EDLKVTILDSG-LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIK  288
            +DLKV + +   L+ P+++T + ++FLSNID++ N+ V T HFF  +  FPP +VA ++K
Sbjct  11   QDLKVRVEEPIILVSPNEKTERRSIFLSNIDQMHNYYVCTAHFFNGNADFPPAVVAERLK  70

Query  289  NAFRRLLVANTYDFLAGRLKKNK---ESERVEIECNAAGAGFTVASSEFALEDIGD-LVY  456
                ++LV   YDF AGRLK N+      R+EI+C AAG GF VASSE++L D+GD  V+
Sbjct  71   MGLEKVLVP--YDFAAGRLKTNELDSTDRRLEIDCTAAGVGFVVASSEYSLHDLGDDFVF  128

Query  457  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
             N  F  L   +      ED+PLC  QVTSFKCGGFA+G   NH+ FDG G   F+ NLA
Sbjct  129  SNLGFHYLALDNLWPGDDEDRPLCIFQVTSFKCGGFAIGFVWNHVLFDGMGAGKFMANLA  188



>ref|XP_008780371.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase, partial [Phoenix 
dactylifera]
Length=154

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 102/148 (69%), Gaps = 5/148 (3%)
 Frame = +1

Query  103  TLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK  282
            +L +DLKVTIL S  ++PS++T + +MFLSNID+VLNFDV+TVHFF A+  FP   V  +
Sbjct  9    SLLQDLKVTILSSTTLYPSEKTERRSMFLSNIDQVLNFDVETVHFFAANLEFPSTAVVER  68

Query  283  IKNAFRRLLVANTYDFLAGRLK-KNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYP  459
            +  A  ++LV   YDFLAGRLK +  +  R+ I+CNAAG    VASSE  LE++GDL  P
Sbjct  69   LSPALEKVLVP--YDFLAGRLKVEPGDDGRLIIDCNAAGVELVVASSELKLEEVGDLECP  126

Query  460  NPAFRQLVTMSF--DFVAKEDQPLCFLQ  537
            N AFRQLV  +   + +A ED+ LC  Q
Sbjct  127  NSAFRQLVAKNIPDNGLALEDRLLCSFQ  154



>gb|EYU34261.1| hypothetical protein MIMGU_mgv11b021744mg [Erythranthe guttata]
Length=142

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 4/126 (3%)
 Frame = +1

Query  67   TAIMGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPA  246
            T IM AL   P    EDLKV   +S LIFP +ET K ++FLSNID++LN+D+ T HFF A
Sbjct  19   TIIMAAL--SPVPSMEDLKVKFQESSLIFPYKETPKKSIFLSNIDQILNYDIPTAHFFKA  76

Query  247  SPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEF  426
            +P FPPEI+A + K A  ++LV   YDF+AGRLK N+E  R+EI+CNAAGAGF VA S+ 
Sbjct  77   NPEFPPEIMAKRFKIALEKVLV--PYDFMAGRLKLNRELGRLEIDCNAAGAGFVVAKSDV  134

Query  427  ALEDIG  444
            +L++IG
Sbjct  135  SLDEIG  140



>gb|ABK24776.1| unknown [Picea sitchensis]
Length=463

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 116/190 (61%), Gaps = 7/190 (4%)
 Frame = +1

Query  82   ALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFP  261
            A+ L  E    DL++T+     ++P++ T + +MFLSNID+ L   V T+ FFPA     
Sbjct  2    AMALTQEDFVGDLEITMEAPFAVYPAEPTPRRSMFLSNIDQTLVSTVATITFFPACKQMS  61

Query  262  PEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDI  441
             + +  +  +A  +LLV   YDF+AGRL  N+E +R+EI+CN AG  F V +++  LE++
Sbjct  62   FDEIVQRYVDALGKLLVH--YDFVAGRLTLNEEDDRLEIDCNGAGVFFGVGTTDLTLEEL  119

Query  442  GDLVYPNPAFRQLVTMSFDFVAK---EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  612
             DL +PNPAFRQL+    D+V+    +D PL  LQ T FKCGGF +G  +NH  FDG   
Sbjct  120  KDLKFPNPAFRQLILQ--DYVSHSHLQDLPLLTLQATRFKCGGFTVGAGLNHCLFDGISS  177

Query  613  KMFLENLAAL  642
              F  NLA++
Sbjct  178  FDFTVNLASI  187



>ref|XP_002967754.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ31101.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=450

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 106/185 (57%), Gaps = 6/185 (3%)
 Frame = +1

Query  91   LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  270
            L+ E    DLKV +     + P+ ET + T+F+SNID+VL + V+TV+F+        E+
Sbjct  3    LQGEVRLSDLKVKVHKISTVVPAGETEQCTLFMSNIDQVLAYYVETVYFYDKGGDAAAEL  62

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
                ++ A  R+LV   Y FLAGR K N +  R+E+ECN  G  F  AS E  + D+GD+
Sbjct  63   ----LQEALGRVLV--PYHFLAGRFKLNPKLGRMELECNREGVSFAAASCELRVSDLGDI  116

Query  451  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
              PNP FR LV +  +  A  D PL  +QVT F CGGFA+G  M+H S DG G   F  N
Sbjct  117  SVPNPLFRNLVLLPDEGKALNDAPLITIQVTKFSCGGFAMGVYMSHASLDGIGALEFFMN  176

Query  631  LAALS  645
              +++
Sbjct  177  YCSVA  181



>ref|XP_002992378.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ06528.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=450

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 106/185 (57%), Gaps = 6/185 (3%)
 Frame = +1

Query  91   LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  270
            L+ E    DLKV +     + P+ ET + T+F+SNID+VL + V+TV+F+        E+
Sbjct  3    LQGEVRLSDLKVKVHKISTVVPAGETEQCTLFMSNIDQVLAYYVETVYFYDKGGDAAVEL  62

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
                ++ A  R+LV   Y FLAGR K N +  R+E+ECN  G  F  AS E  + D+GD+
Sbjct  63   ----LQEALGRVLVP--YHFLAGRFKLNPKLGRMELECNREGVSFAAASCELRVSDLGDI  116

Query  451  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
              PNP FR LV +  +  A  D PL  +QVT F CGGFA+G  M+H S DG G   F  N
Sbjct  117  SVPNPLFRNLVLLPDEGKALNDAPLITIQVTKFSCGGFAMGVYMSHASLDGIGALEFFMN  176

Query  631  LAALS  645
              +++
Sbjct  177  YCSVA  181



>gb|ABK24452.1| unknown [Picea sitchensis]
Length=241

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 115/196 (59%), Gaps = 10/196 (5%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPAS--  249
            MG+L +   +L   L V + +  ++  ++ T + ++FLSNID+V+ + V TV+F+     
Sbjct  1    MGSLAVAESSLITHLDVEVEEPEMVVQAEPTEECSLFLSNIDQVVAYVVDTVYFYTPQGE  60

Query  250  -PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEF  426
                    V G++K A  ++LV   Y F+AGRLK N E  R+EI+CN AGA F  A+ + 
Sbjct  61   DKSAASADVVGELKEALGKVLV--PYHFMAGRLKLNLEKGRLEIDCNRAGALFAAANCDL  118

Query  427  ALEDIGDLVYPNPAFRQLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISF  597
             L D+GD+ YPNP FR LV       A++   + PL  +QVT FKCGG  LG SMNH  F
Sbjct  119  NLSDLGDVTYPNPVFRNLVLQGVH--ARKFGANPPLLMMQVTRFKCGGVVLGMSMNHAMF  176

Query  598  DGSGFKMFLENLAALS  645
            DG G   F+ N ++++
Sbjct  177  DGVGAMEFMMNFSSIA  192



>ref|XP_002991188.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ07732.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=459

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 100/177 (56%), Gaps = 2/177 (1%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            DL++ +  S ++ P+Q     T+FLSNID+   + V++V+ F A+P    +  A  I+ A
Sbjct  8    DLQIEVGSSKIVAPAQAVEHSTLFLSNIDQEAMYKVESVYVFAANPERASDDPAEVIEAA  67

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              + LV  TY FLAGR   N +  R+E+ CN AG  F  A+S+  L D+GDL  PNPAFR
Sbjct  68   LAKTLV--TYYFLAGRFAPNAKEGRLEVNCNGAGVLFAAATSKLRLCDLGDLSVPNPAFR  125

Query  475  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L+    D +   + P    Q+T FKCGGF  G ++ H   DG     F +NL +++
Sbjct  126  SLLVQPSDSLGLFETPPATFQITRFKCGGFVFGMTIFHSLMDGVAITGFFDNLGSIA  182



>ref|XP_002991251.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ07679.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=459

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 99/177 (56%), Gaps = 2/177 (1%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            DL++ +  S ++ P+Q     T+FLSNID+   + V++V+ F A+P    +  A  I+ A
Sbjct  8    DLQIEVGSSKIVAPAQAVEHSTLFLSNIDQEAMYKVESVYVFAANPERESDDPAEVIEAA  67

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              + LV  TY FLAGR   N +  R+E+ CN AG  F  A+S+  L D+ DL  PNPAFR
Sbjct  68   LAKTLV--TYYFLAGRFAPNAKEGRLEVNCNGAGVLFAAATSKLRLSDLRDLSVPNPAFR  125

Query  475  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L+    D +   + P    Q+T FKCGGF  G ++ H   DG     F +NL +++
Sbjct  126  SLLVQPSDSLGLFETPPATFQITRFKCGGFVFGMTIFHSLMDGVAITGFFDNLGSIA  182



>ref|XP_011071659.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Sesamum indicum]
Length=463

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%), Gaps = 5/170 (3%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI----VAGKIKNAFRRLLV  312
            L+ P       T+FLSNID+ + F V+TV F+   P          +AGK+K A   +L+
Sbjct  24   LMSPRNPVPTETIFLSNIDQAVTFPVETVFFYEVPPNMASAASTVGIAGKVKKAVEEVLL  83

Query  313  ANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMS  492
               Y F+AGRL  + E++R+E+ CN AGA F  A S F L+D+G+L +PNP+F   V   
Sbjct  84   VPYY-FMAGRLNFSDETKRLELVCNNAGALFVSAKSRFCLKDLGNLSHPNPSFHHFVLRP  142

Query  493  FDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
              + +  +  L  +QVT F+CGGFALG + NH   DG        NLA++
Sbjct  143  GIYKSLAETALFTIQVTRFECGGFALGFTTNHAILDGKSASEMFHNLASI  192



>ref|XP_010930413.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=452

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 98/168 (58%), Gaps = 3/168 (2%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG--FPPEIVAGKIKNAFRRLLVAN  318
            L+ P   T   T++LSNID+ + F VQTV F+   PG   P   V  +++ +   +L+  
Sbjct  20   LVSPRNPTPTKTVYLSNIDQTVAFPVQTVFFYEVPPGGGIPTFDVTERVRISVSEVLLIP  79

Query  319  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  498
             Y F+AGRL  N +++R+E+ CN AG  F  A+S   L ++G+L  PNP+FR LV  +  
Sbjct  80   YY-FMAGRLNFNLQTKRLELVCNNAGVLFVGATSHLRLNELGNLSLPNPSFRHLVLQTEG  138

Query  499  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
            F +  + P+  +QVT FKCGGF++G   NH   DG       ENLA++
Sbjct  139  FESFAETPIFTIQVTRFKCGGFSIGFVTNHSILDGRSAAEMFENLASI  186



>ref|XP_010248037.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010248038.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Nelumbo nucifera]
Length=443

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 99/184 (54%), Gaps = 16/184 (9%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  300
            VT++D  +I P   T    +FLSNID  L    + V FF P +     E V    K+A R
Sbjct  6    VTMVDKAVIVPETPTEHRRVFLSNIDLTLVLYDEAVSFFEPPATEISFEEVCRCFKDALR  65

Query  301  RLLVANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  477
            R+LV   YDFLAGRL+   E   R+EI CN AG  F  A++   L  +GDL  P P F+Q
Sbjct  66   RMLV--EYDFLAGRLEPALEDGSRLEINCNGAGVVFVAATTSCKLCQLGDLRTPKPEFKQ  123

Query  478  LVTMSFDFVAKEDQ--------PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENL  633
            LVT    F+ +E++        PL  LQ+T F+CGG A     NH + DG G + F  N 
Sbjct  124  LVT----FLRQEEEKVLEFTEKPLILLQLTRFQCGGLAFANRSNHCTLDGVGVREFQINF  179

Query  634  AALS  645
            A+L+
Sbjct  180  ASLT  183



>ref|XP_008786402.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=452

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 98/168 (58%), Gaps = 3/168 (2%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG--FPPEIVAGKIKNAFRRLLVAN  318
            L+ P   T   T++LSNID+ + F VQTV F+   PG   P      +++ +   +L+  
Sbjct  20   LVSPRNPTPIKTVYLSNIDQTVAFPVQTVFFYEVPPGGGTPRFDATDRVRRSVSEVLLIP  79

Query  319  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  498
             Y F+AGRL  N +++R+E+ CN AG  F  A+S  +L ++G+L  PNP+FR LV  +  
Sbjct  80   YY-FMAGRLNFNLQTKRLELVCNNAGVLFAGATSSLSLNELGNLSLPNPSFRHLVLQTEG  138

Query  499  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
            F +  + P+  +QVT FKCGGF++G   NH   DG       ENLA++
Sbjct  139  FESLPETPIFTIQVTRFKCGGFSIGFVTNHSILDGRSAAEMFENLASI  186



>gb|EYU45561.1| hypothetical protein MIMGU_mgv1a005829mg [Erythranthe guttata]
Length=468

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 97/170 (57%), Gaps = 5/170 (3%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI---VAGKIKNAFRRLLVA  315
            L  PS      T+FLSNID+ L+F V+TV F+   P  P      +A +++ A  ++L+ 
Sbjct  22   LFSPSNPKPIKTIFLSNIDQTLSFPVETVFFYKVPPNMPSSSTADIAERVRKAVEKVLLI  81

Query  316  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSF  495
              Y F+AGRL  N +++R+E+ CN AGA F  A S F+++D+G L  PNP+F +LV    
Sbjct  82   PYY-FMAGRLNFNGDTKRLELICNNAGALFVSAESRFSVDDLGSLSQPNPSFHRLVHRQG  140

Query  496  DFVAKEDQPLCF-LQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
             +     +   F +QVT F+CGGFALG   NH   DG        NLA++
Sbjct  141  LYQKSLAETAVFTIQVTRFECGGFALGFMTNHAILDGKSASEMFNNLASI  190



>ref|XP_001752413.1| predicted protein [Physcomitrella patens]
 gb|EDQ82652.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 92/147 (63%), Gaps = 2/147 (1%)
 Frame = +1

Query  205  VLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIEC  384
            +L F V+T +F+ ++P    + VA  +K A  +LLV   YDFLAGR++ N++  R+EI+ 
Sbjct  1    MLAFTVETHYFYASNPEKSSDTVADTLKEALSKLLV--HYDFLAGRVRLNEQLMRMEIDR  58

Query  385  NAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGF  564
            N AGA F+ A+ +  L ++GD+  PNP FR+ V  +       D PL  +QVT+FKCGG 
Sbjct  59   NYAGAQFSTATCDLTLAELGDVSVPNPLFRKFVPQAHKATTIADIPLMMIQVTTFKCGGH  118

Query  565  ALGTSMNHISFDGSGFKMFLENLAALS  645
             +G  M+H+ +DG G   FL NL +++
Sbjct  119  CVGFGMSHLVWDGHGVVEFLFNLMSVA  145



>ref|XP_002970966.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ27564.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=439

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 94/166 (57%), Gaps = 3/166 (2%)
 Frame = +1

Query  148  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  327
            I P++ T   T+FLSN+D+ L F V+ +  +        ++V   ++NA    LV   Y 
Sbjct  15   IKPARPTKNQTIFLSNLDQQLFFHVEMLFMYDVQSPDTGDVV-DNVRNALAEALVP--YY  71

Query  328  FLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVA  507
            F AGR + N++ +R+E+ECN AGA F  A  +  + ++GDL  PNP FR+L+    D   
Sbjct  72   FAAGRFRVNEQEKRLEVECNGAGADFAGAYCDSTIAELGDLRIPNPDFRKLLVYPVDVKR  131

Query  508  KEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             ED PL  +QVT FKCGGF +G   +HI FDG     F  ++  +S
Sbjct  132  IEDIPLFSIQVTRFKCGGFIVGIYTSHIVFDGISGCQFFSDIGRIS  177



>ref|XP_002982104.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ16772.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=496

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 100/180 (56%), Gaps = 16/180 (9%)
 Frame = +1

Query  121  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFR  300
            ++ + +  L+ P+Q T    ++LSN D+ + F++++V+F+P SP    E V   ++ A  
Sbjct  13   EINVEELCLVAPAQATDDQPLYLSNYDQQVLFNLESVYFYPPSPHRSDENVVDVLRAALS  72

Query  301  RLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQL  480
            +LLV   Y F+AGRL+ N   +RVE++CN AGA F  A++   L D+ D     P    L
Sbjct  73   KLLVP--YHFMAGRLRMNAREKRVEVDCNRAGALFVAATTNVTLADLQD----GPT---L  123

Query  481  VTMSFDFVAKE-------DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  639
            V++  DF+          D PL  LQVT FKCGGF +G S NH    G+    FL NL A
Sbjct  124  VSLLKDFILHSPASHQVSDAPLLTLQVTKFKCGGFVVGISRNHALVGGTSGDDFLANLTA  183



>ref|XP_002962120.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ37380.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=439

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 94/166 (57%), Gaps = 3/166 (2%)
 Frame = +1

Query  148  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  327
            I P++ T   T+FLSN+D+ + F V+ +  +        ++V   ++NA    LV   Y 
Sbjct  15   IKPARPTKNQTIFLSNMDQQVFFHVEMLFMYDVQSPDTGDVV-DNVRNALAEALVP--YY  71

Query  328  FLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVA  507
            F AGR + N++ +R+E+ECN AGA F  A  +  + ++GDL  PNP FR+L+    D   
Sbjct  72   FAAGRFRVNEQEKRLEVECNGAGAHFAGAYCDSTIAELGDLRIPNPDFRKLLVYPVDVKK  131

Query  508  KEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             ED PL  +QVT FKCGGF +G   +H+ FDG     F  ++  +S
Sbjct  132  IEDIPLFSIQVTRFKCGGFIVGIYTSHVVFDGISGCQFFSDIGRIS  177



>ref|XP_002992205.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ06702.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=497

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 99/180 (55%), Gaps = 16/180 (9%)
 Frame = +1

Query  121  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFR  300
            ++ + +  L+ P+Q T    ++LSN D+ + F++++V+F+P SP    E V   ++ A  
Sbjct  13   EINVEELCLVAPAQATDDQPLYLSNYDQQVLFNLESVYFYPPSPHRSAENVVDVLRAALS  72

Query  301  RLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQL  480
            ++LV   Y F+AGRL+ N   +RVE++CN AGA F  A++   L D+ D     P    L
Sbjct  73   KVLVP--YHFMAGRLRMNAREKRVEVDCNRAGALFVAATTNVTLADLQD----GPT---L  123

Query  481  VTMSFDFVAKE-------DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  639
            V +  DF+          D PL  LQVT FKCGGF +G S NH    G+    FL NL A
Sbjct  124  VGLLKDFILHSPASHQVSDAPLLTLQVTKFKCGGFVVGISRNHALVGGASGDDFLANLTA  183



>ref|XP_004134484.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
 gb|KGN57097.1| hypothetical protein Csa_3G153710 [Cucumis sativus]
Length=458

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 94/166 (57%), Gaps = 5/166 (3%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ PS  T + T+FLSNID  + F V+TV+FF    G   E+ +  +K A   LLV   Y
Sbjct  21   LLSPSNPTPEETIFLSNIDVAVAFTVETVYFF--EDGSAAEM-SRIVKRALAILLVP--Y  75

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
             FLAGR + N+ES R+E+ CN AG  F  A S+  + D+GDL  PNP+F + V       
Sbjct  76   YFLAGRFQTNRESGRLELACNNAGVVFVNAKSKVRMRDLGDLSLPNPSFGRFVHRPGLHT  135

Query  505  AKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
               ++ L  +QVT F CGG+A+G   NH   DG       +NLA++
Sbjct  136  NLHERALFTVQVTEFVCGGYAIGMVTNHGVLDGKSAAEMFQNLASI  181



>ref|XP_004169053.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
Length=458

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 94/166 (57%), Gaps = 5/166 (3%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ PS  T + T+FLSNID  + F V+TV+FF    G   E+ +  +K A   LLV   Y
Sbjct  21   LLSPSNPTPEETIFLSNIDLAVAFTVETVYFF--EDGSAAEM-SRIVKRALAILLVP--Y  75

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
             FLAGR + N+ES R+E+ CN AG  F  A S+  + D+GDL  PNP+F + V       
Sbjct  76   YFLAGRFQTNRESGRLELACNNAGVVFVNAKSKVRMRDLGDLSLPNPSFGRFVHRPGLHT  135

Query  505  AKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
               ++ L  +QVT F CGG+A+G   NH   DG       +NLA++
Sbjct  136  NLHERALFTVQVTEFVCGGYAIGMVTNHGVLDGKSAAEMFQNLASI  181



>ref|XP_008438874.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis melo]
Length=462

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 95/166 (57%), Gaps = 5/166 (3%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ PS  T + T+FLSNID  + F V+TV+FF    G   E+ +  +K A   LLV   Y
Sbjct  21   LLSPSNPTPEETIFLSNIDLAVAFTVETVYFF--EDGSAAEM-SRIVKRALAILLVP--Y  75

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
             FLAGR + N+ES R+E+ CN AG  F  A S+  ++D+GDL  PNP+F + V       
Sbjct  76   YFLAGRFQTNRESGRLELACNNAGVLFVNAKSKVRMKDLGDLSLPNPSFGRFVHRPGLNT  135

Query  505  AKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
               ++ L  +QVT F CGG+A+G   NH   DG       +NLA++
Sbjct  136  NLHERALFTVQVTEFVCGGYAIGMVTNHGVLDGKAAAEMFQNLASI  181



>emb|CAT00085.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=262

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 92/159 (58%), Gaps = 6/159 (4%)
 Frame = +1

Query  178  TMFLSNIDKVLNFDVQTVHFF--PASPGFPPEIV--AGKIKNAFRRLLVANTYDFLAGRL  345
            T+FLSNID+ L F V+T+ FF  P++   P   +  A ++K A + LL    Y F+AGRL
Sbjct  36   TIFLSNIDQALVFPVETIFFFEDPSNVKNPSSTLNAAERVKEAVQVLL--GPYYFMAGRL  93

Query  346  KKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPL  525
              N+E++RVE+ CN AG  F  A+S+  L+++GDL  PNP F  L+     +    +  +
Sbjct  94   NFNQETKRVELLCNNAGVLFVSATSKLTLKELGDLSQPNPTFHHLIHRPGLYKGLLETAI  153

Query  526  CFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
              +QVT F CGG +LG + NH   DG        NLA++
Sbjct  154  FTIQVTRFGCGGLSLGFTTNHAILDGKSASDMFHNLASI  192



>gb|ABR16192.1| unknown [Picea sitchensis]
Length=440

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 99/176 (56%), Gaps = 8/176 (5%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  297
            L VT  +  ++ P++ T  H  FLSN+D+ +   VQTV+ F AS     E  +  I+ A 
Sbjct  17   LNVTRHEPTMVAPAEATENHVYFLSNLDQNIAVTVQTVYCFKASEEMGKERPSEVIREAL  76

Query  298  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  477
            R++LVA  Y  LAGR+  + E  ++ I C   GA F  A ++  +EDIGD+  P+P+  +
Sbjct  77   RKVLVA--YYPLAGRIGISPEG-KLNIHCTGEGAVFVEADADCVIEDIGDMTKPDPS--K  131

Query  478  LVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
            L  + ++    +   + P   +QVT+FKCGGF LG  MNH  FDG G   F+ + A
Sbjct  132  LECLVYNIPGAKNILEVPPLVVQVTTFKCGGFVLGLGMNHCMFDGIGAMEFVNSWA  187



>gb|KDP26368.1| hypothetical protein JCGZ_17526 [Jatropha curcas]
Length=451

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 98/181 (54%), Gaps = 8/181 (4%)
 Frame = +1

Query  121  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAF  297
            K+ +L+  ++ P + T +  +FLSNID  L    ++V FF P             + NA 
Sbjct  3    KLKLLEKVMVVPERPTNRKRIFLSNIDLSLVVYQESVSFFDPPKNKKSFSESCNSLYNAL  62

Query  298  RRLLVANTYDFLAGRLKKNKESE-RVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
            R+LLV   YDF AGRL    E++ R +IECN AG     A ++ AL  +G+L+ P P +R
Sbjct  63   RQLLVP--YDFFAGRLVTALENDNRFQIECNGAGVVVAAAKTDSALIQLGELLEPKPEYR  120

Query  475  QLVTMSFDFVAKE----DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
            QLV    +   +E    D+PL +LQ+T F CG  AL +  NH   DG     F +NLAAL
Sbjct  121  QLVAFLHEEGEEEMKIQDKPLLYLQLTEFACGCLALASRYNHCVVDGIAVGEFQKNLAAL  180

Query  643  S  645
            +
Sbjct  181  T  181



>ref|XP_009415665.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=451

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 100/173 (58%), Gaps = 8/173 (5%)
 Frame = +1

Query  142  GLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPP---EIVAGKIKNAFRRLLV  312
             L+ P       T+ LSNID+   F V+TV F+  +P       +I+    ++    LLV
Sbjct  24   ALLSPRNPMPLKTIHLSNIDQTAAFPVETVFFYETTPDGAESTFDIIERVKRSVSEELLV  83

Query  313  ANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMS  492
               Y F+AGR+  N E++R+E+ CN AGA F  A+S  +L+++GDL  PNP+F++LV  +
Sbjct  84   P--YYFMAGRVHFNVETKRLELVCNNAGALFAGATSSLSLKELGDLSAPNPSFQRLVLRA  141

Query  493  FDFVAKEDQPLCFLQ---VTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
             +F +  + P+  +Q   VT F+CGGF++G   NH   DG      L+NLAA+
Sbjct  142  EEFGSLPETPIFTIQSVKVTRFRCGGFSIGFMTNHSILDGKSAVEMLDNLAAI  194



>ref|XP_007035554.1| BAHD family acyltransferase, clade V, putative [Theobroma cacao]
 gb|EOY06480.1| BAHD family acyltransferase, clade V, putative [Theobroma cacao]
Length=451

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 89/157 (57%), Gaps = 3/157 (2%)
 Frame = +1

Query  178  TMFLSNIDKVLNFDVQTVHFFPASPGFPPEI--VAGKIKNAFRRLLVANTYDFLAGRLKK  351
            T+FLSNID+ + F V+TV FF   P        ++ ++K A   +L+   Y F+AGRL+ 
Sbjct  32   TIFLSNIDQAVCFAVETVFFFDLPPDKSSSTLGISLRVKQAVAEVLLGPYY-FMAGRLRF  90

Query  352  NKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCF  531
            NK++ R+++ CN AG  F  A+S   L+D+G+L  PN  F   V     + + ++  L  
Sbjct  91   NKQTNRLQLLCNNAGVLFVSATSRLRLKDLGNLSLPNSTFHHFVHRPGLYKSLDETALLT  150

Query  532  LQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
            +QVT F CGGF++G   NH   DG       ENLA++
Sbjct  151  IQVTRFACGGFSIGFVTNHAILDGKSASEMFENLASI  187



>ref|XP_002992754.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ06140.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=449

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 96/176 (55%), Gaps = 10/176 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  297
            L V I    L  P+  T +  +FL NID  + F V +++F+ +     P+++       F
Sbjct  6    LPVAIQSCSLALPAGPTPRAKIFLPNIDLTVVFMVDSIYFYSSGAADAPKVL-------F  58

Query  298  RRL--LVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            R L  ++   Y F AGRL  ++E++R+EI+ N+AG  F  A S+  + D+GDL  PN  +
Sbjct  59   RALQEVMVEFYPF-AGRLAVSEETQRLEIDANSAGVPFVEAVSDLNIADLGDLTLPNALY  117

Query  472  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  639
            R LV  + +     D PL  +QVT F CGGF+ G S+NH   DG     F+++L +
Sbjct  118  RNLVFTATNVKVLSDWPLATVQVTKFLCGGFSFGLSVNHALADGISIIDFMQHLTS  173



>ref|XP_010666009.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 87/168 (52%), Gaps = 4/168 (2%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI--VAGKIKNAFRRLLVAN  318
            L+ P     + TMFLSNID+ ++F V+T+ FF            +  +IK A   LL+  
Sbjct  20   LVSPKHPFPQETMFLSNIDQAVSFPVETLFFFNVQEDKKSSTSDITERIKKATSELLIP-  78

Query  319  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  498
             Y F++GRL  N E++R+E+ CN AG  F   +S  AL D+G+L  PNP F   +     
Sbjct  79   -YYFMSGRLSFNSETKRLELICNNAGISFVSGTSRLALTDLGNLSLPNPTFGHFLHRPGL  137

Query  499  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
            +    +  L  +QVT F CGGF +G   NH   DG        NLA+L
Sbjct  138  YKNLAETTLLTIQVTRFSCGGFCVGFLTNHAILDGKAASQMFLNLASL  185



>ref|XP_007140651.1| hypothetical protein PHAVU_008G130300g [Phaseolus vulgaris]
 gb|ESW12645.1| hypothetical protein PHAVU_008G130300g [Phaseolus vulgaris]
Length=440

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 96/181 (53%), Gaps = 8/181 (4%)
 Frame = +1

Query  121  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAF  297
            K+ +++  +I P Q T +  MFLSNID  L     +  FF P S       +  K+  A 
Sbjct  3    KIELVEKIVIVPEQPTPRKRMFLSNIDLSLVVYQDSASFFDPPSTQMSFSEICNKLYTAL  62

Query  298  RRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             ++L+   YDF+AGRL  + +E++R EI+CN AG     A ++  L D G +  PNP  +
Sbjct  63   SKMLM--QYDFMAGRLVPSLEETQRFEIDCNGAGIVVAAARTDRKLSDFGVISAPNPELK  120

Query  475  QLVTMSFDFVAKE----DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
            +LV    +   +E    ++PL  LQ+T F CG  AL +  NH + DG   + F  NL AL
Sbjct  121  ELVVFLHEGCDQETDLKEKPLASLQLTQFGCGSLALASHYNHCTLDGFAIRDFEVNLGAL  180

Query  643  S  645
            +
Sbjct  181  T  181



>dbj|BAK06725.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97840.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=433

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 103/191 (54%), Gaps = 25/191 (13%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNID-KVLNFDVQTVHFFPASPG------------F  258
            +KV ++D+ L+ PS+ T +HT++LSN+D  V       V+++P+  G            F
Sbjct  1    MKVEVVDTRLVTPSEPTPRHTLWLSNLDLAVPKTHTPLVYYYPSPAGDGDGGEKEAEGFF  60

Query  259  PPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALED  438
             PE    +++ A  R LV   +  LAGR+    E  R+EI+CN  GA F VA ++F  ++
Sbjct  61   APE----RLREALARALV--PFYPLAGRMAAGPEG-RLEIDCNGEGALFVVARADFTGDE  113

Query  439  IGDLVYPNPAFRQLVTMSFDFVAKEDQP--LCFLQVTSFKCGGFALGTSMNHISFDGSGF  612
            +     P+P  R+L+     F A  D P  L  +QVT  KCGG A+GT M+H++ DG+G 
Sbjct  114  MFRDFEPSPEARRLLV---PFAASGDPPCLLAMVQVTFLKCGGVAVGTGMHHVTMDGAGA  170

Query  613  KMFLENLAALS  645
              F+     L+
Sbjct  171  IQFIRTWTTLA  181



>ref|XP_001755199.1| predicted protein [Physcomitrella patens]
 gb|EDQ80143.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 98/175 (56%), Gaps = 4/175 (2%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRR  303
            V + D  ++ P + T K T++LSNID +L   + T   +  +     E +   ++ AF +
Sbjct  25   VQVHDVKVLNPIEPTEKATLYLSNIDLLLVQPIDTFFVYAPNEERDTESLFAVLEEAFLK  84

Query  304  LLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLV  483
            LLV   Y F+AGR+++++E  R++++CN AGAGF  ASS   L DIGDL   NP FR+L+
Sbjct  85   LLVP--YHFMAGRIEESEEG-RLQLKCNRAGAGFVTASSPQTLADIGDLRVMNPDFRKLM  141

Query  484  TMSFDFVA-KEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
                       D+ L  +QVT F+CGGF +G  MNH   DG    +   +  AL+
Sbjct  142  PAPKGVQGVMNDEFLLRVQVTRFRCGGFTVGFRMNHAMCDGVSTTLLFRSFCALA  196



>ref|XP_002962552.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ36015.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=449

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 95/174 (55%), Gaps = 6/174 (3%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  297
            L VT+       P+  T +  +FL NID  + F V +++F+ +     P+++   ++ A 
Sbjct  6    LPVTLQSCSSALPAGPTPRAKIFLPNIDLTVVFMVDSIYFYSSGAADAPKVLFRALQEA-  64

Query  298  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  477
                +   Y F AGRL  ++E++R+EI+ N+AG  F  A S+  + D+GDL  PN  +R 
Sbjct  65   ----MVEFYPF-AGRLAVSEETQRLEIDANSAGVPFVEAVSDLNIADLGDLTLPNALYRN  119

Query  478  LVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  639
            LV  + +     D PL  +QVT F CGGF+ G S+NH   DG     F+++L +
Sbjct  120  LVFTATNVKVLSDWPLATVQVTKFLCGGFSFGLSVNHALADGISIIDFMQHLTS  173



>ref|XP_010259678.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=447

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 91/169 (54%), Gaps = 5/169 (3%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF---PASPGFPPEIVAGKIKNAFRRLLVA  315
            L  P   T    +FLSNID+ + F V+TV FF   P    +  +I     K+    LL+ 
Sbjct  20   LFSPKNPTPVEKVFLSNIDQAVAFPVETVFFFEVPPCKTSWTLDISERMKKSVSEVLLIP  79

Query  316  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSF  495
              Y F+AGRL  N E++R+E+ C+ AG  F  A S   L+++G+L  PN  F  L+    
Sbjct  80   --YYFMAGRLNFNLETKRLELVCSNAGVPFVSAKSRLTLQELGNLSLPNSTFHHLIHRPD  137

Query  496  DFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
              ++  ++P+  +QVT F+CGGF++G   NH   DG       +NLA++
Sbjct  138  RSLSLSEKPIFTIQVTRFECGGFSIGFMTNHSVLDGKSAGEMFQNLASI  186



>gb|KHN41391.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=442

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 97/181 (54%), Gaps = 8/181 (4%)
 Frame = +1

Query  121  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAF  297
            ++ +++  +I P Q T +  MFLSNID  L     +  FF P S       + GK+ +A 
Sbjct  3    EIELVEKVVIAPEQPTPRKRMFLSNIDLSLVVYQDSASFFDPPSTQMSFGEICGKLYSAL  62

Query  298  RRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             ++LV   YDF+AGRL  + +E+ R EI+CN AG     A ++  L + G +  PNP  R
Sbjct  63   GKMLV--QYDFMAGRLVPSLEETHRFEIDCNGAGIVVVAARTDRKLSEFGVISAPNPELR  120

Query  475  QLVTMSFDFVAKE----DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
            +LV    +   +E    ++ L  LQ+T F CG  AL +  NH + DGS  + F  NL AL
Sbjct  121  ELVVFLQEEGDQETDMKERSLASLQLTQFGCGSLALASRYNHCTLDGSAIRDFEVNLGAL  180

Query  643  S  645
            +
Sbjct  181  T  181



>ref|XP_003551391.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=441

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 97/181 (54%), Gaps = 8/181 (4%)
 Frame = +1

Query  121  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAF  297
            ++ +++  +I P Q T +  MFLSNID  L     +  FF P S       + GK+ +A 
Sbjct  3    EIELVEKVVIAPEQPTPRKRMFLSNIDLSLVVYQDSASFFDPPSTQMSFGEICGKLYSAL  62

Query  298  RRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             ++LV   YDF+AGRL  + +E+ R EI+CN AG     A ++  L + G +  PNP  R
Sbjct  63   GKMLV--QYDFMAGRLVPSLEETHRFEIDCNGAGIVVVAARTDRKLSEFGVISAPNPELR  120

Query  475  QLVTMSFDFVAKE----DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
            +LV    +   +E    ++ L  LQ+T F CG  AL +  NH + DGS  + F  NL AL
Sbjct  121  ELVVFLQEEGDQETDMKERSLASLQLTQFGCGSLALASRYNHCTLDGSAIRDFEVNLGAL  180

Query  643  S  645
            +
Sbjct  181  T  181



>emb|CAN63569.1| hypothetical protein VITISV_043430 [Vitis vinifera]
Length=392

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 88/168 (52%), Gaps = 18/168 (11%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF--PASPGFPPEIVAGKIKNAFRRLLVAN  318
            L+ P       T+FLSNID  + F V+T+ FF  P S     E ++ ++K A   +L+  
Sbjct  42   LVSPKNPIPFETVFLSNIDLAVTFPVETLFFFEVPPSKCSSTEDISERVKRAVAEVLLV-  100

Query  319  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  498
             Y FLAGRL  N ES+R+E+ CN AG  F  A+S   L+D+G+   PNP FR  V     
Sbjct  101  LYYFLAGRLYFNHESKRLELLCNNAGVLFVRATSGLMLKDLGNHSLPNPIFRYFVHWP--  158

Query  499  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
                         VT F+CGGF++G   NH   DG      L+NLA++
Sbjct  159  -------------VTRFRCGGFSIGIVTNHGVLDGRSAVEMLQNLASI  193



>ref|XP_002966887.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ31486.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=434

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 94/174 (54%), Gaps = 5/174 (3%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRR  303
            V I  S L+ P+    + T++LSNID  + F V+ +  + +     P     K++    +
Sbjct  2    VVIQSSELVTPALPLERRTLYLSNIDHQVFFHVEWIMVYDSIDN--PRDWIEKLRECLAK  59

Query  304  LLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR-QL  480
            +LV   Y FLAG  K N E+ R+EI+CN AG  FT AS +  +  + +L  P+P FR +L
Sbjct  60   ILVP--YYFLAGSFKLNDENGRLEIDCNGAGVVFTRASMDATIAQLHNLRDPDPLFRKEL  117

Query  481  VTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
            +T+  +  + +D PL  LQ   F+CGG ALG   +H++ DG     FL +   +
Sbjct  118  ITLPRNVESIQDLPLLTLQARKFQCGGIALGICASHVAMDGFSAYNFLHDYTKI  171



>ref|XP_002961124.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ38663.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=434

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 94/174 (54%), Gaps = 5/174 (3%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRR  303
            V I  S L+ P+    + T++LSNID  + F V+ +  + +     P     K++    +
Sbjct  2    VVIQSSELVTPALPLERRTLYLSNIDHQVFFHVEWIMVYDSIDN--PRDWIEKLRECLAK  59

Query  304  LLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR-QL  480
            +LV   Y FLAG  K N E+ R+EI+CN AG  FT AS +  +  + +L  P+P FR +L
Sbjct  60   ILVP--YYFLAGSFKLNDENGRLEIDCNGAGVVFTRASMDATIAQLHNLRDPDPLFRKEL  117

Query  481  VTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
            +T+  +  + +D PL  LQ   F+CGG ALG   +H++ DG     FL +   +
Sbjct  118  ITLPRNVESIQDLPLLTLQARKFQCGGIALGICASHVAMDGFSAYNFLHDYTKI  171



>gb|KEH22614.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=438

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 93/180 (52%), Gaps = 8/180 (4%)
 Frame = +1

Query  121  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAF  297
            ++ +++  +I P Q T +  MFLSNID  L     +  FF P S       +  K+  A 
Sbjct  3    RIELVEKVVIVPEQPTPRKRMFLSNIDLSLVVYQDSSSFFDPPSNQMSFSEICSKLYGAL  62

Query  298  RRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             ++LV   YDF+AGRL  + +E  R EI+CN AG     A ++  L + G +  PNP  R
Sbjct  63   GKMLVH--YDFMAGRLVPSLEEHNRFEIDCNDAGIVVVAAKTDRKLSEFGVISAPNPELR  120

Query  475  QLVTM---SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            +LV       D   KE +PL  LQ+T F CG  AL +  NH   DG   + F  NLA+L+
Sbjct  121  ELVVFLHGDEDTNLKE-KPLASLQLTQFGCGSLALASHYNHCILDGKAVREFEANLASLT  179



>ref|XP_004973560.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=432

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 102/185 (55%), Gaps = 15/185 (8%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNID-KVLNFDVQTVHFFPAS---PGFPPE---IVA  276
            +KV ++++ L+ PS++T +  ++LSN+D  V       V+++PAS    G  PE     A
Sbjct  1    MKVDVMETTLVAPSEDTPRRELWLSNLDLAVPKTHTPLVYYYPASELGAGVGPEGSFFAA  60

Query  277  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  456
             ++K A  R LV   +  LAGRL    E  R++I+CNA GA F VA ++FA +++     
Sbjct  61   ERLKAALARALV--PFYPLAGRLGVG-EGGRLQIDCNAEGALFVVAQADFAGDNVFRDYE  117

Query  457  PNPAFRQLVTMSFDFVAKEDQP--LCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
            P+P  R+   M   FV   D P  +   QVT  KCGG  LGT ++H++ DG G   F++ 
Sbjct  118  PSPEVRR---MFVPFVPSGDPPCVMAMFQVTFLKCGGVVLGTGIHHVALDGMGAFHFIQT  174

Query  631  LAALS  645
               +S
Sbjct  175  WTGVS  179



>ref|XP_008223321.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=441

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 104/184 (57%), Gaps = 11/184 (6%)
 Frame = +1

Query  106  LHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLN-FDVQTVHFF-PASP-GFPPEIV  273
            + E + V + +S ++ P++E+T +  ++LSN D +   F + TV+F+ P+S   F     
Sbjct  1    MAEKVTVRVRESTMVKPAEESTPRSPLWLSNSDLMFPPFHISTVYFYRPSSEHNF---FD  57

Query  274  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  453
             G +K A  + LV   +  LAGRLK N +SER+EI+CNA G  F VA S  AL+D G+  
Sbjct  58   VGVLKQALSKALVP--FYPLAGRLKLNDQSERLEIDCNAEGVLFVVAESSSALDDFGNFA  115

Query  454  YPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENL  633
             P P F +L+  + D+      P+  LQVT FKCGG +LG  M H   DG+    F+   
Sbjct  116  -PTPDFNKLIP-TVDYSEISLYPILVLQVTYFKCGGASLGVGMEHRIVDGTSGLHFVNTW  173

Query  634  AALS  645
            + ++
Sbjct  174  SDIA  177



>ref|XP_004956854.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=430

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 99/188 (53%), Gaps = 19/188 (10%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNID-KVLNFDVQTVHFFPASPGFP--------PEI  270
            +KV +L++ L+ PS+ T +H + LSN+D  V       V+++P  P  P        P  
Sbjct  1    MKVEVLETTLVTPSEATPRHALRLSNLDLAVPKTHTPLVYYYPKPPAGPDAGAEGGSPFF  60

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
               ++++A  R LV   +  LAGRL       R+EI+C   GA F VA ++FA +++   
Sbjct  61   EPARLRDALARALV--PFYPLAGRLAAGPGG-RIEIDCTGEGALFAVARADFAGDEVFRD  117

Query  451  VYPNPAFRQLVTMSFDFVAKEDQPLCFL---QVTSFKCGGFALGTSMNHISFDGSGFKMF  621
              P+P  R+L+       A+  +P C L   Q+T  KCGG  +GT M+H++ DG+G   F
Sbjct  118  FEPSPEARRLLVP----FAESGEPPCVLAMVQITFLKCGGVTVGTGMHHVTMDGAGAFQF  173

Query  622  LENLAALS  645
            +    AL+
Sbjct  174  IRTWTALA  181



>emb|CBI33005.3| unnamed protein product [Vitis vinifera]
Length=457

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 98/188 (52%), Gaps = 18/188 (10%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  291
            ED+K  +++  ++ P   T +  +FLSNID  L    ++V FF       P      +  
Sbjct  19   EDVK--LVERMMVLPETPTPRRRVFLSNIDLTLVAYQESVSFFD------PPANQMSLSE  70

Query  292  AFRRLL-----VANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLV  453
            AF RL      V  +YDFLAGRL  + E S R+EI+CN AG     A+++  +  +G+L+
Sbjct  71   AFHRLCRAISQVLVSYDFLAGRLVPSLEASNRLEIDCNNAGFVVAAATTKTTVSQLGELM  130

Query  454  YPNPAFRQLVTM----SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMF  621
             P P F +LV      + D +  +D+PL F Q+T F CGG ALG+   H   DG      
Sbjct  131  APKPEFERLVAFLREEAEDELELKDKPLGFFQLTQFGCGGLALGSRYYHCILDGVAIHDL  190

Query  622  LENLAALS  645
              NLA+L+
Sbjct  191  EMNLASLT  198



>ref|XP_003578136.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=433

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 101/191 (53%), Gaps = 25/191 (13%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNID-KVLNFDVQTVHFFPASPG------------F  258
            +KV +++S L+ PS+ T +H ++LSN+D  V       V+++PA               F
Sbjct  1    MKVEVVESTLVAPSEATPRHALWLSNLDLAVPKTHTPLVYYYPAPAAPDADGGEDAEGFF  60

Query  259  PPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALED  438
             PE    +++ A  R LV   +  LAGR+       R+EI+CN  GA F VA ++F  ++
Sbjct  61   APE----RLREALARALV--PFYPLAGRMAVGPGG-RLEIDCNGEGALFVVARADFTGDE  113

Query  439  IGDLVYPNPAFRQLVTMSFDFVAKEDQP--LCFLQVTSFKCGGFALGTSMNHISFDGSGF  612
            +     P+P  R+L+     F A  D P  L  +QVT  KCGG A+GT M+H++ DG+G 
Sbjct  114  MFRDFEPSPEARRLLV---PFAASGDPPCVLAMVQVTFLKCGGVAVGTGMHHVTMDGAGA  170

Query  613  KMFLENLAALS  645
              F+    +L+
Sbjct  171  IQFIRTWTSLA  181



>gb|ABR16860.1| unknown [Picea sitchensis]
Length=447

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 96/179 (54%), Gaps = 8/179 (4%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKV--LNFDVQTVHFFPASPGFPPEIVAGKIKN  291
            L VT L   ++ P++ T K  ++LSNID    +    QT+H + A P     + A  I++
Sbjct  10   LSVTTLQPIMVTPAENTPKEILYLSNIDSQAGVRATCQTLHVYGACPKNH-AVPAHVIRH  68

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            A  + LV   Y   AGR+++N +  ++E+ C   GA F   S+  +LE++G L    P  
Sbjct  69   AISKALV--YYYPFAGRMRENADG-KLEVWCTGEGAVFVEGSANCSLEEVGYLAQLTPCL  125

Query  472  RQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            +QLV   +  V K  D P   +QVT F+CGGF LG  ++H   DG GF  FL  +A L+
Sbjct  126  KQLV-YDYPMVYKHHDIPPLVIQVTRFRCGGFVLGLGVSHCMSDGLGFSQFLNAIADLA  183



>ref|XP_007215405.1| hypothetical protein PRUPE_ppa005943mg [Prunus persica]
 gb|EMJ16604.1| hypothetical protein PRUPE_ppa005943mg [Prunus persica]
Length=436

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 101/180 (56%), Gaps = 11/180 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  294
            L+V   +  L+ P++ET K   FLSN+D+ +   V+T++ F +      +  AG+ IKN+
Sbjct  14   LRVKQGEPTLVSPAEETEKGLYFLSNLDQNIAVTVRTIYCFKSDDKGNDK--AGEVIKNS  71

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +EDIGD+  P+P   
Sbjct  72   LKKVLVH--YYPLAGRLTISSEGKLI-VDCTGEGAVFVEAEADCRIEDIGDITKPDP--E  126

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + +D    +   + P    QVT FKCGGFALG  MNH  FDG G   F+ + A ++
Sbjct  127  TLGQLVYDVPGAKNILELPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWAKIA  186



>ref|XP_002303052.1| hypothetical protein POPTR_0002s24610g [Populus trichocarpa]
 gb|EEE82325.1| hypothetical protein POPTR_0002s24610g [Populus trichocarpa]
Length=441

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 95/185 (51%), Gaps = 18/185 (10%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAG------KI  285
            V +++  +I P   T +  +FLSN+D  L    ++V F+      PPE           +
Sbjct  4    VKLVEKVVIVPEMPTNRRRIFLSNLDLPLVAYQESVSFYD-----PPENKISFSESYNTL  58

Query  286  KNAFRRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPN  462
              A R LLV   YDF AGRL    +++ R+EI+CN AG     A +E  L  +G L  P 
Sbjct  59   YRALRSLLVP--YDFFAGRLVPALEDNSRLEIDCNGAGIVVAAARTETRLSQLGGLFAPK  116

Query  463  PAFRQLVTM----SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
            P F+QLV        D +  +D+PL ++Q+T F CG  AL +  NH   DG+  + F +N
Sbjct  117  PDFKQLVAFLREEGEDEMEFKDKPLLYIQLTQFGCGSLALASRYNHCVLDGAAARDFEKN  176

Query  631  LAALS  645
            LAA +
Sbjct  177  LAAFT  181



>ref|XP_004491723.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=437

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 91/176 (52%), Gaps = 4/176 (2%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  300
            + +++  +I P + T    MFLSNID  L     +  FF P S       +  K+ +A  
Sbjct  5    IELIEKVVIVPEKPTPCKRMFLSNIDLSLVVYQDSASFFDPPSNQMQFSEICNKLYSALG  64

Query  301  RLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  477
            ++LV   YDF+AGRL  + +E  R EI+CN AG     A ++  L + G +  PNP  R+
Sbjct  65   KMLVH--YDFMAGRLVPSFEEKNRFEIDCNDAGIVVAAAKTDRRLCEFGVISAPNPELRE  122

Query  478  LVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            LV    +    ++ PL  LQ+T F CG  AL +  NH   DG   + F  NLA+L+
Sbjct  123  LVVFLHEETDLKETPLVSLQLTQFGCGSLALSSHYNHCILDGIAVREFEANLASLT  178



>ref|XP_007161685.1| hypothetical protein PHAVU_001G089700g [Phaseolus vulgaris]
 gb|ESW33679.1| hypothetical protein PHAVU_001G089700g [Phaseolus vulgaris]
Length=430

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 98/180 (54%), Gaps = 11/180 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI-KNA  294
            L V + +  L+ P++ET K   FLSN+D+ +   V+TV+ F    G      AGK+ KNA
Sbjct  9    LSVKLGEPTLVPPAEETKKGLYFLSNLDQNIAVIVRTVYCFKT--GERGNEKAGKVLKNA  66

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A +  ++E+IGD+  P+P   
Sbjct  67   LKKVLVH--YYPLAGRLTISSEGKLI-VDCTGEGALFVEAEANCSMEEIGDITKPDPG--  121

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + +D    +     P    QVT FKCGGFALG  MNH  FDG G   F+ +   ++
Sbjct  122  TLGKLVYDIPGAKHILQMPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWGQVA  181



>gb|ACI28534.1| shikimate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=434

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 95/175 (54%), Gaps = 5/175 (3%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFPASPGFPPEIVAGKIKNAFR  300
            + + DS ++ PS+E T+ T++ SN+D V+ NF   +V+F+ ++ G      A  +K A  
Sbjct  3    INVRDSTMVRPSEEVTRRTLWNSNVDLVVPNFHTPSVYFYRSNNGTSNFFDAKIMKEALS  62

Query  301  RLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQL  480
            ++LV   +  +AGRL+++ E  RVEI+C+  G  F  A +   ++D GD   P    RQL
Sbjct  63   KVLVP--FYPMAGRLRRD-EDGRVEIDCDGQGVLFVEADTGAVIDDFGDFA-PTLELRQL  118

Query  481  VTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            +         E  PL  LQVT FKCGG +LG  M H   DG+    F+   + ++
Sbjct  119  IPAVDYSRGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVA  173



>gb|ACI16630.1| shikimate O-hydroxycinnamoyltransferase [Trifolium pratense]
Length=434

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 95/175 (54%), Gaps = 5/175 (3%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFPASPGFPPEIVAGKIKNAFR  300
            + + DS ++ PS+E T+ T++ SN+D V+ NF   +V+F+ ++ G      A  +K A  
Sbjct  3    INVRDSTMVRPSEEVTRRTLWNSNVDLVVPNFHTPSVYFYRSNNGTSNFFDAKIMKEALS  62

Query  301  RLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQL  480
            ++LV   +  +AGRL+++ E  RVEI+C+  G  F  A +   ++D GD   P    RQL
Sbjct  63   KVLVP--FYPMAGRLRRD-EDGRVEIDCDGQGVLFVEADTGAVIDDFGDFA-PTLELRQL  118

Query  481  VTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            +         E  PL  LQVT FKCGG +LG  M H   DG+    F+   + ++
Sbjct  119  IPAVDYSRGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVA  173



>ref|XP_002988757.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ10268.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=440

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 90/163 (55%), Gaps = 5/163 (3%)
 Frame = +1

Query  154  PSQETTKHTMFLSNIDKVLNFDVQTVHFFPA-SPGFPPEIVAGKIKNAFRRLLVANTYDF  330
            P   T   T+FL N+++ L F V+ +  +   SPG     VA  +++A +++LV   Y F
Sbjct  15   PPISTPCTTLFLHNLEQQLFFPVEMLFSYKVDSPG-STRNVAHVVRDALQQVLVP--YYF  71

Query  331  LAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAK  510
            +AGR++ N+E  RVE++CN AG  F  AS    + D GDL  PNP+ R  +    +   +
Sbjct  72   VAGRIRVNEEQGRVELDCNGAGVLFASASCSSTIRDAGDLRMPNPSARNFLVFPTEMPTE  131

Query  511  -EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
              D PL  +QVT F CGGF +G   +H  FDG+    F + +A
Sbjct  132  ICDVPLVTIQVTRFICGGFIVGILASHAIFDGTAGCEFYDAIA  174



>ref|XP_008231077.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Prunus mume]
Length=436

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 101/180 (56%), Gaps = 11/180 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  294
            L+V   +  L+ P++ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK++
Sbjct  14   LRVKQGEPTLVSPAEETEKGLYFLSNLDQNIAVTVRTIYCFKSDDKGNDK--AGEVIKDS  71

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +EDIGD+  P+P   
Sbjct  72   LKKVLV--YYYPLAGRLTISSEGKLI-VDCTGEGAVFVEAEADCRIEDIGDITKPDP--E  126

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + +D    +   + P    QVT FKCGGFALG  MNH  FDG G   F+ + A ++
Sbjct  127  TLGKLVYDVPGTKNILELPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWAKIA  186



>ref|XP_008379094.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Malus domestica]
Length=445

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 101/180 (56%), Gaps = 11/180 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  294
            L+V   +  L+ P+ ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  23   LRVKQGEPTLVPPAVETEKGLYFLSNLDQNIAVTVRTIYCFKSDAKGNDK--AGEVIKDA  80

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A ++ A+E+IGD+  P+P   
Sbjct  81   LKKVLVH--YYPLAGRLAISAEGKLI-VDCTGEGAVFVEAEADCAIEEIGDITKPDP--E  135

Query  475  QLVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + +D    ++    P    QVT FKCGGFALG  MNH  FDG G   F+ + A ++
Sbjct  136  TLGKLVYDVPGAKNMLEIPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWAKIA  195



>ref|XP_011024641.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
Length=441

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 95/185 (51%), Gaps = 18/185 (10%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAG------KI  285
            V +++  +I P   T +  +FLSN+D  L    ++V F+      PPE           +
Sbjct  4    VKLVEKVVIVPEMLTNRRRIFLSNLDLPLVAYQESVSFYD-----PPENKISFSESYNTL  58

Query  286  KNAFRRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPN  462
              A R LLV   YDF AGRL    +++ R+EI+CN AG     A ++  L  +G L  P 
Sbjct  59   YRALRSLLVP--YDFFAGRLVPALEDNSRLEIDCNGAGIVVAAARTDTRLSQLGGLFAPK  116

Query  463  PAFRQLVTM----SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
            P F+QLV        D +  +D+PL ++Q+T F CG  AL +  NH   DG+  + F +N
Sbjct  117  PDFKQLVAFLREEGEDEMEFKDKPLLYIQLTQFGCGSLALASRYNHCVLDGAAARDFEKN  176

Query  631  LAALS  645
            LAA +
Sbjct  177  LAAFT  181



>gb|KJB70702.1| hypothetical protein B456_011G088000 [Gossypium raimondii]
Length=432

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 92/167 (55%), Gaps = 9/167 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L++P+++T K   FLSN+D+ +   V+T++ F +         A  IK+A R++L  + Y
Sbjct  20   LVYPAEDTEKGLYFLSNLDQNIAVIVRTIYCFKSDEKGNGN-AAQVIKDALRKVL--SHY  76

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + E + + ++CN  GA F  A +   +E+IGD+  P+P    L  + +D  
Sbjct  77   YPLAGRLTISSEGKLI-VDCNGEGAVFVEAEANCKMEEIGDITKPDP--ESLGKLVYDIP  133

Query  505  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
              +   + PL   QVT F+CGGF LG  MNH  FDG G   F+ +  
Sbjct  134  GAKSILEMPLLVAQVTKFQCGGFVLGLCMNHCMFDGIGAMEFVNSWG  180



>ref|XP_002986294.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ12503.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=440

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 90/163 (55%), Gaps = 5/163 (3%)
 Frame = +1

Query  154  PSQETTKHTMFLSNIDKVLNFDVQTVHFFPA-SPGFPPEIVAGKIKNAFRRLLVANTYDF  330
            P   T   T+FL N+++ L F V+ +  +   SPG     VA  +++A +++LV   Y F
Sbjct  15   PPISTPCTTLFLHNLEQQLFFPVEMLFSYKVDSPG-STRNVAHVVRDALQQVLVP--YYF  71

Query  331  LAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAK  510
            +AGR++ N+E  RVE++CN AG  F  AS    + D GDL  PNP+ R  +    +   +
Sbjct  72   VAGRIRVNEEQGRVELDCNGAGVLFASASCSSTIRDAGDLRMPNPSARNFLVFPTEMPME  131

Query  511  -EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
              D PL  +QVT F CGGF +G   +H  FDG+    F + +A
Sbjct  132  ICDVPLVTIQVTRFICGGFIVGILASHAIFDGTAGCEFYDAIA  174



>gb|KJB70701.1| hypothetical protein B456_011G088000 [Gossypium raimondii]
Length=443

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 92/167 (55%), Gaps = 9/167 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L++P+++T K   FLSN+D+ +   V+T++ F +         A  IK+A R++L  + Y
Sbjct  31   LVYPAEDTEKGLYFLSNLDQNIAVIVRTIYCFKSDEKGNGN-AAQVIKDALRKVL--SHY  87

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + E + + ++CN  GA F  A +   +E+IGD+  P+P    L  + +D  
Sbjct  88   YPLAGRLTISSEGKLI-VDCNGEGAVFVEAEANCKMEEIGDITKPDP--ESLGKLVYDIP  144

Query  505  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
              +   + PL   QVT F+CGGF LG  MNH  FDG G   F+ +  
Sbjct  145  GAKSILEMPLLVAQVTKFQCGGFVLGLCMNHCMFDGIGAMEFVNSWG  191



>gb|ABR16341.1| unknown [Picea sitchensis]
Length=461

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 96/191 (50%), Gaps = 6/191 (3%)
 Frame = +1

Query  76   MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVL----NFDVQTVHFFP  243
            M  L++K       L V +L   ++ PS+ + K  ++LSN+D  L     FD   V+   
Sbjct  1    MENLHMKEYCSQVQLTVNVLGFVMVPPSRPSPKTILYLSNLDDHLIVRRRFDTLLVYNNG  60

Query  244  ASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSE  423
            +   F  +     I++A  ++L  + Y  LAGR+++ ++  ++E+EC   GA F  AS+ 
Sbjct  61   SDNFFASQNPVKVIRDALSQVL--SYYYPLAGRVRRAEDGRKLEVECTGEGALFVEASTH  118

Query  424  FALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
              L  +G+L    P+F QL          EDQP    QVT F CGGF +G S NH   DG
Sbjct  119  NTLSLLGELKELKPSFEQLFFQFPPTAEVEDQPPLIFQVTRFDCGGFVVGVSFNHCLCDG  178

Query  604  SGFKMFLENLA  636
             G   FL+ LA
Sbjct  179  RGAAQFLKGLA  189



>ref|XP_002962972.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ36435.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=453

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 99/187 (53%), Gaps = 13/187 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG-FPPEI--------  270
            L++   +  +I P+  T K  ++L+N D+ + F V+ +  +    G +  ++        
Sbjct  6    LQINTEEPEVIKPASPTKKCALYLNNFDQQVFFHVEMLLVYDVGHGEYSIQLGDDLRDDG  65

Query  271  --VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIG  444
              +  +++ A  + LVA  Y   AGR + N+E  R+EI+C   GA   VA S  ++ ++G
Sbjct  66   GAMIERLREALSKALVA--YYPAAGRYRINEEEARLEIDCGEQGALLAVARSSSSIAELG  123

Query  445  DLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  624
            DL  PNP FR+L+       + E+ PL  +QVT F+CGGF LG  ++H+  DG     FL
Sbjct  124  DLDAPNPEFRRLLLYPKSVKSMEEVPLLTVQVTRFRCGGFILGFFISHVVMDGISISDFL  183

Query  625  ENLAALS  645
             + A ++
Sbjct  184  HDFATIT  190



>ref|XP_009378002.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=444

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 101/180 (56%), Gaps = 11/180 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  294
            L+V   +  L+ P+ ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  22   LRVKQGEPTLVSPAVETEKGLYFLSNLDQNIAVTVRTIYCFKSDDKGNDQ--AGEVIKDA  79

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A ++ A+E+IGD+  P+P   
Sbjct  80   LKKVLVH--YYPLAGRLSISAEGKLI-VDCTGEGAIFVEAEADCAIEEIGDITKPDP--E  134

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + +D    +   + P   +QVT FKCGGF+LG  MNH  FDG G   F+ +   ++
Sbjct  135  TLGRLVYDVPGAKNILEMPPLVVQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGKIA  194



>ref|XP_004511192.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Cicer arietinum]
Length=1049

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 91/176 (52%), Gaps = 4/176 (2%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  300
            + +++  +I P + T    MFLSNID  L     +  FF P S       +  K+ +A  
Sbjct  5    IELIEKVVIVPEKPTPCKRMFLSNIDLSLVVYQDSASFFDPPSNQMQFSEICNKLYSALG  64

Query  301  RLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  477
            ++LV   YDF+AGRL  + +E  R EI+CN AG     A ++  L + G +  PNP  R+
Sbjct  65   KMLVH--YDFMAGRLVPSFEEKNRFEIDCNDAGIVVAAAKTDRRLCEFGVISAPNPELRE  122

Query  478  LVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            LV    +    ++ PL  LQ+T F CG  AL +  NH   DG   + F  NLA+L+
Sbjct  123  LVVFLHEETDLKETPLVSLQLTQFGCGSLALSSHYNHCILDGIAVREFEANLASLT  178



>emb|CDX97133.1| BnaC09g44920D [Brassica napus]
Length=93

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +1

Query  76   MGALYLKPETLH-EDLKVTILDSGLIFPSQETTKH---TMFLSNIDKVLNFDVQTVHFFP  243
            MG  Y +  +L   DLKVT+ +S   FPS+ET  H   +MFLSN+D+VLN DVQTVHFF 
Sbjct  1    MGDSYQESSSLLLHDLKVTVKESSRFFPSEETLTHERKSMFLSNVDQVLNIDVQTVHFFQ  60

Query  244  ASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRL  345
             +  +PPE+VA K+K A  R +  + Y+FLAG L
Sbjct  61   QNKEYPPEVVAEKVKKALVRAM--DVYEFLAGYL  92



>ref|XP_004507045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Cicer arietinum]
Length=449

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 97/181 (54%), Gaps = 12/181 (7%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFF---PASPGFPPEIVAGK  282
            ++ + + DS ++ PS E T+ T++ SN+D V+ NF   +V+F+    AS  F  +I    
Sbjct  13   EMIINVRDSTMVRPSDEVTRRTVWNSNVDLVVPNFHTPSVYFYRTNSASNFFDAKI----  68

Query  283  IKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPN  462
            IK A  ++LV   +  +AGRL+++ E  RVEI+CN  G  F  A +   ++D GD   P 
Sbjct  69   IKEALSKVLVP--FYPMAGRLRRD-EDGRVEIDCNGQGVLFIEADTGVVIDDFGDFA-PT  124

Query  463  PAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
               RQL+         E  PL  LQVT FKCGG +LG  M H   DG+    F+   + +
Sbjct  125  LKLRQLIPAVDYSQGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDV  184

Query  643  S  645
            +
Sbjct  185  A  185



>ref|XP_003553956.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=432

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 94/178 (53%), Gaps = 11/178 (6%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFP-ASPGFPPEIVAGKIKN  291
             L V + +  L+ P++ET K   FLSN+D+ +   V+TV+ F  A  G   E     IKN
Sbjct  10   QLSVKLSEPTLVPPAEETKKGLYFLSNLDQNIAVIVRTVYCFKTAERG--NEKAGEVIKN  67

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            A +++LV   Y  LAGRL  + E + + ++C   GA    A +  ++E+IGD+  P+P  
Sbjct  68   ALKKVLV--YYYPLAGRLTISSEGKLI-VDCTGEGALLVEAEANCSMEEIGDITKPDPG-  123

Query  472  RQLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
              L  + +D    +     P    QVT FKCGGFALG  MNH  FDG G   F+ +  
Sbjct  124  -TLGKLVYDIPGAKHILQMPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWG  180



>ref|XP_010479238.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=428

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 99/180 (55%), Gaps = 12/180 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKV-LNFDVQTVHFFPASPG---FPPEIVAGKI  285
            +K+ I DS ++ P+ ET    ++ S++D +   +   TV+F+  +     F P++    +
Sbjct  1    MKINIRDSTIVRPAAETPVTKLWNSHVDLIDAKYHTPTVYFYRPTGANNFFDPQV----L  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K+A  + LV  T+  +AGRLKK+ +  R+EI+CN AG  F VA +  A++D+GD   P+ 
Sbjct  57   KDALSKALV--TFYPMAGRLKKDDDG-RIEIDCNGAGVLFVVADTPSAIDDLGDFA-PSL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
               QL+      V  +  PL  LQVT FKCGG +LG  M H   DGS    F+   + ++
Sbjct  113  TLCQLIPNVDYSVGVQTLPLLVLQVTFFKCGGASLGVGMQHHVADGSSALHFINTWSDMA  172



>ref|XP_004507046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Cicer arietinum]
Length=436

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 95/178 (53%), Gaps = 12/178 (7%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFF---PASPGFPPEIVAGKIKN  291
            + + DS ++ PS E T+ T++ SN+D V+ NF   +V+F+    AS  F  +I    IK 
Sbjct  3    INVRDSTMVRPSDEVTRRTVWNSNVDLVVPNFHTPSVYFYRTNSASNFFDAKI----IKE  58

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            A  ++LV   +  +AGRL+++ E  RVEI+CN  G  F  A +   ++D GD   P    
Sbjct  59   ALSKVLVP--FYPMAGRLRRD-EDGRVEIDCNGQGVLFIEADTGVVIDDFGDFA-PTLKL  114

Query  472  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            RQL+         E  PL  LQVT FKCGG +LG  M H   DG+    F+   + ++
Sbjct  115  RQLIPAVDYSQGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVA  172



>ref|XP_009403058.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=434

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 99/178 (56%), Gaps = 14/178 (8%)
 Frame = +1

Query  133  LDSGLIFPSQETTKHTMFLSNIDKVLNFD-VQTVHFFPASPGFPPEIVAG------KIKN  291
            ++SG++ P++ET  H+++LSN+D ++      TV+F+P S   P   + G       +K 
Sbjct  4    IESGMVVPAEETPTHSIWLSNLDLLVGRSHTPTVYFYPPSAARP---IGGFSFAVEALKA  60

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            A  ++LV   +  LAGRL  +  + RVEI+C   GA F VA S  A++D+ D   P+   
Sbjct  61   ALAKVLV--PFYPLAGRLGLDP-AGRVEIQCTGEGALFMVARSASAMDDVLDDFAPSDTI  117

Query  472  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            RQ++  S +       PL  +QV  FKCGG  LG +++H + DG G   F+ + + ++
Sbjct  118  RQMLVPSVE-SGNAPCPLVMVQVILFKCGGVCLGVAVHHTAADGLGALHFVNSWSDIA  174



>ref|XP_008381165.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=441

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 91/171 (53%), Gaps = 17/171 (10%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKV-LNFDVQTVHFF--------PASPGFPPEI  270
            + V++ ++ ++ P++E  K  +++SN+D V L+    +V+F+        P SP F PE+
Sbjct  3    VNVSVRETTIVKPAEEXPKQVLWMSNLDLVILSKHTPSVYFYRRSQTGGHPTSPFFDPEL  62

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
            + G +  A         +  LAGRL++N E+ R EI CN  G  F VA +   LE+ GD 
Sbjct  63   LKGALSKALV------PFYPLAGRLQQN-ETGRSEINCNGEGVLFVVAETASVLENFGDF  115

Query  451  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
              P P FR+L+ +          PL  +QVT FKCGG +LG  + H   DG
Sbjct  116  A-PTPEFRKLIPVVDYSAGISTYPLFVVQVTYFKCGGVSLGVXLEHRVADG  165



>gb|KDP41799.1| hypothetical protein JCGZ_26817 [Jatropha curcas]
Length=434

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 89/163 (55%), Gaps = 9/163 (6%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P +ET K   FLSN+D+ +   V+TV+ F ++        A  I+NA +++LV   Y
Sbjct  21   LVTPEEETEKGLYFLSNLDQNIAVIVRTVYCFKSNEEGNAN-SAEVIRNALKKVLVH--Y  77

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + E + + + CN  GA F  A +  A+E+IGD+  P+P    L  + +D  
Sbjct  78   YPLAGRLTISSEGKLI-VNCNGEGAVFVEAEANCAMEEIGDITKPDP--DTLGKLVYDIP  134

Query  505  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  624
              +   + P    QVT FKCGGF LG  MNH  FDG G   F+
Sbjct  135  GAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFV  177



>ref|XP_008341279.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Malus 
domestica]
Length=444

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 100/181 (55%), Gaps = 11/181 (6%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKN  291
            +L+V      L+ P+ ET K   FLSN+D+ +   V+T++ F +      E  AG+ IK+
Sbjct  21   ELRVKQGXPTLVSPAVETEKGLYFLSNLDQNIAVTVRTIYCFKSVDKGNDE--AGEVIKD  78

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
            A +++LV   Y  LAGRL  + E + + ++C   GA F  A ++ A+E+IGD   P+P  
Sbjct  79   ALKKVLVH--YYPLAGRLAISAEGKLI-VDCTGEGAVFVEAETDCAIEEIGDTTXPDP--  133

Query  472  RQLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
              L  + +D    +   + P   +QVT FKCGGF+LG  MNH  FDG G   F+ +   +
Sbjct  134  ETLGKLVYDVPGAKNILEMPPLVVQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGKI  193

Query  643  S  645
            +
Sbjct  194  A  194



>gb|AFF57839.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
1 [Pyrus x bretschneideri]
Length=441

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 96/185 (52%), Gaps = 17/185 (9%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKV-LNFDVQTVHFFPASPG--------FPPEI  270
            + V++ +S ++ P++ET K  +++SN+D V L     +V+F+  S          F P +
Sbjct  3    VNVSVRESTIVKPTEETPKQVLWMSNLDLVILGKHTPSVYFYRRSQTGSHHGNSFFDPAV  62

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
                +K A  + LV   +  LAGRL++N E+ R EI CN  G  F VA + F LED GD 
Sbjct  63   ----LKRALAKALVP--FYPLAGRLQQN-ETGRSEINCNGEGVLFVVAETAFVLEDFGDF  115

Query  451  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
              P P FR+L+ +          PL  +QVT FKCGG +LG  + H   DG     F+  
Sbjct  116  A-PTPEFRKLIPVVDYSAGISTYPLLVVQVTYFKCGGVSLGVGLEHRVADGCSGLHFVNT  174

Query  631  LAALS  645
             + ++
Sbjct  175  WSDIA  179



>gb|AGJ03151.1| hydroxycinnamoyltransferase [Populus trichocarpa]
Length=432

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 90/167 (54%), Gaps = 9/167 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P++ET K   FLSN+D+ +   V+T++ F  S     E     IKNA +++LV   Y
Sbjct  20   LVPPAEETEKGLYFLSNLDQNIAVIVRTIYCF-KSEEKGNENAGEVIKNALKKVLVH--Y  76

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + E++ + I C   GA F  A +  ALE+IGD+  P+P    L  + +D  
Sbjct  77   YPLAGRLTISSEAKLI-INCTGEGAVFVEAEANCALEEIGDITKPDP--DTLGKLVYDIP  133

Query  505  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
              +   + P    QVT F CGGFALG  MNH  FDG G   F+ +  
Sbjct  134  GAKNILEMPPLVAQVTKFTCGGFALGLCMNHCMFDGIGAMEFVNSWG  180



>ref|XP_008777439.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Phoenix 
dactylifera]
Length=431

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 97/177 (55%), Gaps = 11/177 (6%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNID-KVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFR  300
            V IL++GL+ PS +T KH ++LSN+D  V      TV+F+  + G P    A  +K A  
Sbjct  5    VEILETGLVTPSDDTPKHEIWLSNLDLLVARGHTPTVYFYRPN-GAPNFFSAEAMKAALG  63

Query  301  RLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQL  480
            + LV   +  LAGRL  ++E  RVEI+C   G  F VA S+  +++ GD   P+   RQL
Sbjct  64   KALV--PFYPLAGRLGVSREG-RVEIQCTGEGVLFVVARSDSTVDEFGDFA-PSTEMRQL  119

Query  481  VTMSFDFVAKEDQP--LCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            +  S   V   D P  L   QVT FKCGG  LG +++H + DG G   F  + A ++
Sbjct  120  LVPS---VESGDPPCILVMFQVTFFKCGGVCLGAAVHHTAADGLGALHFANSWAEIA  173



>ref|XP_002298644.2| hypothetical protein POPTR_0001s33390g [Populus trichocarpa]
 gb|EEE83449.2| hypothetical protein POPTR_0001s33390g [Populus trichocarpa]
Length=442

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 90/167 (54%), Gaps = 9/167 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P++ET K   FLSN+D+ +   V+T++ F  S     E     IKNA +++LV   Y
Sbjct  30   LVPPAEETEKGLYFLSNLDQNIAVIVRTIYCF-KSEEKGNENAGEVIKNALKKVLVH--Y  86

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + E++ + I C   GA F  A +  ALE+IGD+  P+P    L  + +D  
Sbjct  87   YPLAGRLTISSEAKLI-INCTGEGAVFVEAEANCALEEIGDITKPDP--DTLGKLVYDIP  143

Query  505  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
              +   + P    QVT F CGGFALG  MNH  FDG G   F+ +  
Sbjct  144  GAKNILEMPPLVAQVTKFTCGGFALGLCMNHCMFDGIGAMEFVNSWG  190



>ref|XP_004304535.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=445

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 98/177 (55%), Gaps = 11/177 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  294
            L+V   +  L+ P++ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  21   LRVKQGEPTLVSPAEETDKGLYFLSNLDQNIAVIVRTIYCFKSDEKDNSK--AGEVIKDA  78

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +EDIGD+  P+P   
Sbjct  79   LKKVLV--HYYPLAGRLAISSEGKLI-VDCTGEGAVFVEAEADCTIEDIGDITKPDP--E  133

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
             L  + +D    +   + P    QVT FKCGGF+LG  MNH  FDG G   F+ +  
Sbjct  134  TLGKLVYDIPGAKNILEVPPLVAQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWG  190



>emb|CAT00082.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=432

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 92/170 (54%), Gaps = 9/170 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            LI P++ET K   FLSN+D+ +   V+T++ F +      E V G I++A  ++LV   Y
Sbjct  20   LIPPAEETQKGLYFLSNLDQNIAVIVRTIYCFKSGEKGNEEAV-GMIRDALSKVLV--QY  76

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + E + + ++C   GA F  A ++  +EDIGD   P+P    L  + +D  
Sbjct  77   HPLAGRLTISPEGKLI-VDCTGEGAVFVEAEADCTIEDIGDNTKPDPV--TLGKLVYDVP  133

Query  505  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
              ++    P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++
Sbjct  134  GAKNVLEIPPLAAQVTKFKCGGFVLGLCMNHCIFDGIGAMEFVNSWGEVA  183



>ref|XP_007038058.1| HXXXD-type acyl-transferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY22559.1| HXXXD-type acyl-transferase family protein isoform 2 [Theobroma 
cacao]
Length=433

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 88/156 (56%), Gaps = 11/156 (7%)
 Frame = +1

Query  148  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  327
            + P++ET K   +LSN+D+ +   ++T++FF  S     E     +KN   ++LV   Y 
Sbjct  21   VLPAEETEKGLYYLSNLDQNIAVIIRTIYFF-RSESKGNEDAVEVVKNGLSKILV---YH  76

Query  328  F-LAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
            + LAGRL  + E + + ++C   GA F  A +   LE+IGD+  P+PA   L  + ++  
Sbjct  77   YPLAGRLTISSEGKLI-VDCTEEGAVFVEAEANCGLEEIGDITKPDPA--TLGKLVYEIP  133

Query  505  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDG  603
              ++    PL  +QVT FKCGGFA+G SMNH   DG
Sbjct  134  GAQNLLEIPLLVIQVTKFKCGGFAIGMSMNHCMLDG  169



>ref|XP_011468200.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=435

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 98/177 (55%), Gaps = 11/177 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  294
            L+V   +  L+ P++ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  11   LRVKQGEPTLVSPAEETDKGLYFLSNLDQNIAVIVRTIYCFKSDEKDNSK--AGEVIKDA  68

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +EDIGD+  P+P   
Sbjct  69   LKKVLVH--YYPLAGRLAISSEGKLI-VDCTGEGAVFVEAEADCTIEDIGDITKPDP--E  123

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
             L  + +D    +   + P    QVT FKCGGF+LG  MNH  FDG G   F+ +  
Sbjct  124  TLGKLVYDIPGAKNILEVPPLVAQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWG  180



>ref|XP_002512898.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49401.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=433

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 90/167 (54%), Gaps = 9/167 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P ++T K   FLSN+D+ +   V+TV+ F +        V   IKNA +++LV   Y
Sbjct  20   LVAPEKDTEKGLYFLSNLDQNIAVIVRTVYCFKSDEKGNENSVE-VIKNALKKVLVH--Y  76

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + E + + I C   GA F  A +  ALE+IGD+  P+P    L  + +D  
Sbjct  77   YPLAGRLTISSEGKLI-INCTGEGAVFVEAEANCALEEIGDITKPDP--HTLGKLVYDIP  133

Query  505  AKED---QPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
              ++    P    QVT+FKCGGFALG  MNH  FDG G   F+ +  
Sbjct  134  DAKNILQMPPLVAQVTNFKCGGFALGLCMNHCMFDGIGAMEFVNSWG  180



>ref|XP_011011266.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=433

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 100/178 (56%), Gaps = 7/178 (4%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +KV   +S ++ P QE  K +++LSN+D +   + + TV+ +  + G      A  +K A
Sbjct  1    MKVNTKESIIVRPVQEMPKQSLWLSNMDLLHPRYYLPTVYLYKPN-GSANFFEATVLKEA  59

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              R+LV   +  +AGRL ++ E+ R+EI CN  G  F VA ++   E++G+ + P+   R
Sbjct  60   LGRVLVP--FYPVAGRLARD-ENGRIEINCNGEGVLFVVADTDSTTEELGEFM-PSMELR  115

Query  475  QLV-TMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            QL+ T+  +       PL  LQVTSFKCGG  LG   +H   DG+G   F+ + AAL+
Sbjct  116  QLIPTVDSNLEDISPNPLLLLQVTSFKCGGVCLGVGWHHTLADGTGALHFINSWAALA  173



>ref|XP_009365251.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 96/185 (52%), Gaps = 17/185 (9%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKV-LNFDVQTVHFF--------PASPGFPPEI  270
            + V++ ++ ++ P++ET K  +++SN+D V L+    +V+F+        P SP F P +
Sbjct  3    VNVSMRETTIVKPAEETPKQVLWMSNLDLVILSKHTPSVYFYRRSQTGGHPTSPFFDPAL  62

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
            + G +  A         +  LAGRL++N E+ R EI CN  G  F VA +   LE+ GD 
Sbjct  63   LKGALSKALV------PFYPLAGRLQQN-ETGRSEINCNGEGVLFAVAETASVLENFGDF  115

Query  451  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
              P P FR+L+ +          PL  +QVT FKCGG +LG  + H   DG     F+  
Sbjct  116  A-PTPEFRKLIPVVDYSAGISTYPLFVVQVTYFKCGGVSLGVGLEHRVADGCSGLHFVNT  174

Query  631  LAALS  645
             + ++
Sbjct  175  WSDIA  179



>ref|XP_003549071.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=434

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 92/168 (55%), Gaps = 11/168 (7%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI-KNAFRRLLVANT  321
            L+ P++ET K   FLSN+D+ +   V+TV+ F        +  AG++ KNA R++LV   
Sbjct  21   LVPPAEETKKGLYFLSNLDQNIAVIVRTVYCFKTDERGNEK--AGEVMKNALRKVLVH--  76

Query  322  YDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDF  501
            Y  LAGRL  + E + + ++C   GA F  A +  ++E+IGD+  P+P    L  + +D 
Sbjct  77   YYPLAGRLTISSEGKLI-VDCTGEGALFVEAEANCSMEEIGDITKPDPG--TLGMLVYDI  133

Query  502  VAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
               +     P    QVT FKCGGFALG  MNH  FDG G   F+ +  
Sbjct  134  PEAKHILQMPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWG  181



>ref|XP_009344220.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=444

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 100/180 (56%), Gaps = 11/180 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  294
            L+V   +  L+ P+ ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  22   LRVKQGEPTLVSPAVETEKGLYFLSNLDQNIAVTVRTIYCFKSDDKENDQ--AGEVIKDA  79

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A ++ A+E IGD+  P+P   
Sbjct  80   LKKVLVH--YFPLAGRLAISAEGKLI-VDCTGEGAVFVEAEADCAIEQIGDITKPDP--E  134

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + +D    +   + P   +QVT FKCGGF+LG  MNH  FDG G   F+ +   ++
Sbjct  135  TLGRLVYDVPGAKNILEMPPLVVQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGKIA  194



>ref|XP_008804093.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=442

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 97/180 (54%), Gaps = 9/180 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +L V   +  L+ P++ET K   FLSN+D+ +   VQT++ F A      E  A  IK A
Sbjct  20   ELSVKQGEPTLVPPAEETEKGLYFLSNLDQNIAVLVQTIYCFRAE-DRGNERAAEVIKEA  78

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              ++LV   Y  LAGRL  + E + + ++C   GA F  A ++  LEDIGD+  P+P+  
Sbjct  79   LSKVLVH--YHPLAGRLTMSSEGKLI-VDCMGEGAVFVEAEADCRLEDIGDIAKPDPSM-  134

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + ++    +   + P    QVT F+CGGF LG +MNH  FDG G   F+ +   ++
Sbjct  135  -LGKLVYNVPGAKNILEIPPLVAQVTKFQCGGFILGLTMNHCMFDGLGAMEFVNSWGEIA  193



>emb|CDY05770.1| BnaC07g00330D [Brassica napus]
Length=433

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 91/166 (55%), Gaps = 12/166 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ I DS ++ P+ ET    ++ SN+D V+  F   +V+F+    AS  F P++    +
Sbjct  1    MKINIRDSTMVRPAAETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQV----M  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K A  + LV   +  +AGRLK++ +  R+EI+CNAAG  F VA +   ++D GD   P  
Sbjct  57   KEALAKALVP--FYPMAGRLKRDDDG-RIEIDCNAAGVLFVVADTPSVIDDFGDFA-PTL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
              RQL+            PL  LQVT FKCGG +LG  M H + DG
Sbjct  113  ELRQLIPEVDHSPGIHSFPLLVLQVTYFKCGGASLGVGMQHHAADG  158



>ref|XP_002521072.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF41223.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=439

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 94/183 (51%), Gaps = 9/183 (5%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIK  288
            EDLK  +++  +I P   T +  +FLSNID  L    ++V FF P             + 
Sbjct  2    EDLK--LVEKVVITPENPTDRRRIFLSNIDLSLVVYQESVSFFDPPLSKLSFSESCNNLC  59

Query  289  NAFRRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            +A  +LLV   YDF AGRL    ++ +R EI+CN AGA    A +   L  +G+L+ P  
Sbjct  60   SALGKLLVP--YDFFAGRLVPALEDKDRFEIDCNGAGAVVAAAKTSSTLSQLGELLAPKE  117

Query  466  AFRQLVTMSFD---FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
             FRQLV    D    V  +D+PL  LQ+T F CG  A+G   NH   DG+ F  F  N A
Sbjct  118  EFRQLVAFLQDESEQVELQDKPLLHLQLTQFACGSLAVGIRYNHAIMDGTAFSEFKTNWA  177

Query  637  ALS  645
            A S
Sbjct  178  AFS  180



>gb|ADD62404.1| fatty omega-hydroxyacid/fatty alcohol 0-hydroxycinnamoyl transferase 
1 [Quercus suber]
Length=419

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 92/168 (55%), Gaps = 11/168 (7%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P++ET K   FLSN+D+ +   V+T++ F  S     E     I+NA  ++LV   Y
Sbjct  6    LVPPAEETEKGLYFLSNLDQNIAVIVRTIYCF-KSDEIGNEKAWEVIRNALEKVLVH--Y  62

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP-AFRQLVTMSFDF  501
              LAGRL  + E + + ++CN  GA F  A +  ++++IGD+  P+P   R+LV   +D 
Sbjct  63   YPLAGRLTISSEGKLI-VDCNGEGAIFVEAEANCSMKEIGDITKPDPETLRKLV---YDI  118

Query  502  VAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
               +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +  
Sbjct  119  PGAKNILEVPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWG  166



>ref|XP_007038057.1| HXXXD-type acyl-transferase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY22558.1| HXXXD-type acyl-transferase family protein, putative isoform 
1 [Theobroma cacao]
Length=519

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 89/156 (57%), Gaps = 11/156 (7%)
 Frame = +1

Query  148  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  327
            + P++ET K   +LSN+D+ +   ++T++FF +      + V   +KN   ++LV   Y 
Sbjct  107  VLPAEETEKGLYYLSNLDQNIAVIIRTIYFFRSESKGNEDAVE-VVKNGLSKILV---YH  162

Query  328  F-LAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
            + LAGRL  + E + + ++C   GA F  A +   LE+IGD+  P+PA   L  + ++  
Sbjct  163  YPLAGRLTISSEGKLI-VDCTEEGAVFVEAEANCGLEEIGDITKPDPA--TLGKLVYEIP  219

Query  505  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDG  603
              ++    PL  +QVT FKCGGFA+G SMNH   DG
Sbjct  220  GAQNLLEIPLLVIQVTKFKCGGFAIGMSMNHCMLDG  255



>ref|XP_008464403.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Cucumis 
melo]
Length=433

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 91/167 (54%), Gaps = 9/167 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            LI P++ET K   FLSN+D+ +   V+T++ F  S     E  A  IK+A  ++LV   Y
Sbjct  20   LITPAEETPKGLYFLSNLDQNIAVIVRTIYSF-KSESRGNEDAAQVIKDALSKVLVH--Y  76

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + + + + ++C A GA F  A ++ ++EDIGD+  P+P    L  + +D  
Sbjct  77   YPLAGRLTISSDKKLI-VDCTAEGAVFVEAEADCSIEDIGDITKPDP--DTLGKLVYDIP  133

Query  505  AKED---QPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
               +    P    QVT FKCGGF +G  MNH  FDG G   F+ +  
Sbjct  134  GATNILQMPPLVAQVTKFKCGGFVVGLCMNHCMFDGIGAMEFVNSWG  180



>ref|XP_010479240.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 94/166 (57%), Gaps = 12/166 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ ILDS ++ P+ ET    ++ S++D ++  +   +V+F+    AS  F P++    +
Sbjct  1    MKINILDSTIVRPAAETPTTNLWNSHVDLIIAKYHTPSVYFYRPTGASNFFDPQV----L  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K+A  + LV   +  +AGRLKK+ +  R+EI+CN AG  F VA +   ++D+G+   P+ 
Sbjct  57   KDALSKALVP--FYPMAGRLKKDNDG-RIEIDCNGAGVLFVVADTPSVIDDLGEFA-PSL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
              RQL+      V     PL  LQVT FKCGG +LG  M H   DG
Sbjct  113  TLRQLIPDVDYSVGVHTLPLLVLQVTFFKCGGASLGVGMQHHVADG  158



>ref|XP_006381775.1| hypothetical protein POPTR_0006s17880g, partial [Populus trichocarpa]
 gb|ERP59572.1| hypothetical protein POPTR_0006s17880g, partial [Populus trichocarpa]
Length=451

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 95/177 (54%), Gaps = 7/177 (4%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFD-VQTVHFFPASPGF--PPEIVAGKIKNA  294
            VTI  S ++ P++ T    + LS +D++     V T++F+  SP +  P   V   +K++
Sbjct  5    VTIKGSYIVKPAKPTWTGRVSLSELDQIGTITYVPTIYFYKPSPNWLTPSNDVVNDLKDS  64

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             R +LV   +  LAGRL       R+E+ECNA G  FT A SE  LED+GD + P+  ++
Sbjct  65   LRDVLVP--FYLLAGRLHWIGRG-RLELECNAMGVMFTEAESESKLEDLGDFL-PSSEYK  120

Query  475  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L+      V   D PL  +Q+T F+CGG +L  +++H   DG     F+   A ++
Sbjct  121  YLIPNVDYTVPIHDLPLLLVQLTKFQCGGISLSLTISHAVVDGQSALHFMSEWARIA  177



>gb|KEH21938.1| omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
Length=437

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 92/173 (53%), Gaps = 9/173 (5%)
 Frame = +1

Query  136  DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVA  315
            +  L+ PS+ET K   FLSN+D+ +   V+TV+ F        E     IK+A + +LV 
Sbjct  20   EPALVPPSEETKKGMYFLSNLDQNIAVIVRTVYCFKNQEK-GNENACEVIKDALKNVLVH  78

Query  316  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSF  495
              Y  LAGRL  + E + + ++C   GA F  A +  ++E+IGD+  P+P  R L  + +
Sbjct  79   --YYPLAGRLSISSEGKLI-VDCTGEGALFVEAEANCSMEEIGDITKPDP--RTLGMLVY  133

Query  496  DFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            D    +     P    Q+T FKCGGF+LG  MNH  FDG G   F+ +   L+
Sbjct  134  DIPDAKHILQMPPLVAQLTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGELA  186



>ref|XP_004138033.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
 gb|KGN63464.1| hypothetical protein Csa_1G001360 [Cucumis sativus]
Length=433

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 91/167 (54%), Gaps = 9/167 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            LI P++ET K   FLSN+D+ +   V+T++ F  S     E  A  IK+A  ++LV   Y
Sbjct  20   LITPAEETPKGLYFLSNLDQNIAVIVRTIYSF-KSESRGNEDAAQVIKDALSQVLVH--Y  76

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + + + + ++C A GA F  A ++ ++EDIGD+  P+P    L  + +D  
Sbjct  77   YPLAGRLTISSDKKLI-VDCTAEGAVFVEAEADCSIEDIGDITKPDP--DTLGKLVYDIP  133

Query  505  AKED---QPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
               +    P    QVT FKCGGF +G  MNH  FDG G   F+ +  
Sbjct  134  GATNILQMPPLVAQVTKFKCGGFVVGLCMNHCMFDGIGAMEFVNSWG  180



>ref|XP_004293649.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011460376.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 96/182 (53%), Gaps = 9/182 (5%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  297
            + V +++S +I P+ ET + +++LSNID V+        +    P    ++    +K+A 
Sbjct  3    VNVRLMESTVIRPATETPRQSLWLSNIDLVMTSAHTPSIYIYNKPKGADKVDMAVLKDAL  62

Query  298  RRLLVANTYDFLAGRLKK-----NKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPN  462
             + LV   +  LAGRLK+     ++   R+EI+CNA GA F VA S   ++D+GD   P 
Sbjct  63   SKALVP--FYPLAGRLKQKMDEGDQGRRRLEIDCNAEGALFVVADSSSCIDDLGDFA-PT  119

Query  463  PAFRQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  639
            P F + +  + D+       PL  +Q T FKCGG ALG  ++H+  DG     F+   + 
Sbjct  120  PEFGRGLLPTVDYSGGISSYPLLLVQTTYFKCGGVALGVRLDHLLADGLSALHFINTWSD  179

Query  640  LS  645
            ++
Sbjct  180  IA  181



>gb|KJB54981.1| hypothetical protein B456_009G057200 [Gossypium raimondii]
Length=436

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 99/181 (55%), Gaps = 8/181 (4%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFD-VQTVHFFPASPGFPPEIVAGKI-  285
             D+++TI +S +++P++ET KH ++ SN++ ++    V TV+FF   P         ++ 
Sbjct  2    RDMEITIKESSMVYPAEETPKHRLWSSNLELLMTLHHVPTVYFF--RPNGSSNFFDTRVL  59

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALED-IGDLVYPN  462
            K A  ++LV   +  +AGRL ++ E+ R+EI CN  GA F  A +++ ++D IGD +  +
Sbjct  60   KEALSKVLVP--FYPMAGRLGRD-ENGRIEIVCNGKGALFLEAETDYVIDDLIGDTMINS  116

Query  463  PAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
                +LV     F      PL  +QVT FKCGG   G  + H   DG     F+ +LA +
Sbjct  117  SELWRLVPKVDYFADISSYPLILVQVTRFKCGGVGFGIGIQHTLADGPTSVHFINSLAEM  176

Query  643  S  645
            +
Sbjct  177  A  177



>ref|XP_009381344.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=379

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 92/172 (53%), Gaps = 9/172 (5%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  297
            L V   ++ L+ P +ET +   FLSN+D+ +   V+TV+ F  SP    E     I+ A 
Sbjct  21   LSVEQGEASLVPPEKETERVLYFLSNLDQNIAVIVRTVYCF-KSPDQGNEKAGDVIREAL  79

Query  298  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  477
             ++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +E IGD+  P+P+   
Sbjct  80   SKVLV--HYYPLAGRLTVSSERKLI-VDCTGEGAVFVEAIADCEMEQIGDIAKPDPSM--  134

Query  478  LVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  624
            L  + +D    ++    P    QVT FKCGGF LG +MNH  FDG G   F+
Sbjct  135  LGKLVYDVPGAKNMLEIPPLVAQVTKFKCGGFILGLAMNHCMFDGLGAMEFV  186



>dbj|BAJ89613.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86428.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 89/169 (53%), Gaps = 5/169 (3%)
 Frame = +1

Query  145  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANT  321
            L+ P++ T T    +LSN+D+ +   VQTV+ F    G   E  A  +++A  R+LV   
Sbjct  30   LVSPAEATPTGKQYYLSNLDQNIAVIVQTVYCFKCPSGRGNEGAADALRSALARVLV--H  87

Query  322  YDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-FRQLVTMSFD  498
            Y  LAGRL  ++E  ++ +EC   G  F  A +   L  IGDL  P+PA   QLV     
Sbjct  88   YHPLAGRLGISREM-KLTVECTGEGVPFVEAEAACDLALIGDLSTPDPAALGQLVYSVPG  146

Query  499  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
                 + P    QVT FKCGGF+LG  MNH  FDG G   F+ + A ++
Sbjct  147  AKNILEMPPMTAQVTRFKCGGFSLGLGMNHCMFDGLGAMEFVNSWAEMA  195



>ref|XP_004516455.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=436

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 91/168 (54%), Gaps = 11/168 (7%)
 Frame = +1

Query  154  PSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFRRLLVANTYDF  330
            P +ET K   FLSN+D+ +   V+TV+ F  A  G   E     IKNA +++LV   Y  
Sbjct  26   PYEETKKGMYFLSNLDQNIAVIVRTVYCFEKAEKG--NENCFEVIKNALKKVLV--DYYP  81

Query  331  LAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAK  510
            LAGRL  ++E + + ++C   GA F  A +   +E+IGD+  P+P  R L  + +D    
Sbjct  82   LAGRLSISEEGKLI-VDCTGEGALFVEAEANCLMEEIGDITKPDP--RTLGMLVYDIPGA  138

Query  511  E---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            +     P    QVT FKCGGF+LG  MNH  FDG G   F+ +   ++
Sbjct  139  KHILQMPPLVAQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGEVA  186



>ref|XP_002462397.1| hypothetical protein SORBIDRAFT_02g024990 [Sorghum bicolor]
 gb|EER98918.1| hypothetical protein SORBIDRAFT_02g024990 [Sorghum bicolor]
Length=453

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 94/197 (48%), Gaps = 25/197 (13%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNID-KVLNFDVQTVHFF------------------  240
            + V ++ S L+ PS+ T +  ++LSN+D    N    TV+FF                  
Sbjct  1    MAVEVVTSELVAPSETTPRRALWLSNLDLAARNGYTPTVYFFRRRCPQPQDGSGGDDDDR  60

Query  241  -PASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESE-RVEIECNAAGAGFTVA  414
             P  P   P+  +  +  A     +   Y F AGRL+  ++ + R EI+CNAAGA F VA
Sbjct  61   APQQPS--PDFFSADVLRAALAAALVQFYPF-AGRLRAGRDDDGRAEIDCNAAGALFVVA  117

Query  415  SSEFALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHIS  594
             S  ALED  D   P+ A        +D  A  D PL  LQVT F+CGG  LGT+M+   
Sbjct  118  RSAAALEDF-DGFAPSKAMNDTFVPKYDSTAGPDAPLLLLQVTFFRCGGVTLGTAMHPFV  176

Query  595  FDGSGFKMFLENLAALS  645
             DG     F+   A+++
Sbjct  177  IDGRSAFHFIRTWASIA  193



>ref|XP_002894568.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70827.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 91/166 (55%), Gaps = 12/166 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ I DS ++ P+ ET    ++ SN+D V+  F   +V+F+    AS  F P+I    +
Sbjct  1    MKINIRDSTMVRPAAETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQI----M  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K+A  + LV   +  +AGRLK++ +  R+EI+CN AG  F VA +   ++D GD   P  
Sbjct  57   KDALSKALVP--FYPMAGRLKRDDDG-RIEIDCNGAGVLFVVADTPSVIDDFGDFA-PTL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
              RQL+            PL  LQVT FKCGG +LG  M H + DG
Sbjct  113  NLRQLIPDVDHSAGIHSFPLLVLQVTFFKCGGASLGVGMQHHAADG  158



>ref|XP_010926850.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=490

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 96/180 (53%), Gaps = 9/180 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +L V   +  L+ P++ET K   FLSN+D+ +   VQT++ F A      E  A  IK A
Sbjct  68   ELSVKQGEPTLVPPAKETEKGLYFLSNLDQNIAVIVQTIYCFRAE-DRGNEGAAVAIKEA  126

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              ++LV   Y  LAGRL    E + + ++C   GA F  A ++  LEDIGD+  P+P+  
Sbjct  127  LSKVLVH--YHPLAGRLTICSEGKLI-VDCTGEGAVFVEAEADCRLEDIGDIAKPDPSM-  182

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + ++    +   + P    QVT F+CGGF LG +MNH  FDG G   F+ +   ++
Sbjct  183  -LGKLVYNIPGAKNILEIPPLVAQVTKFQCGGFILGLAMNHCMFDGLGAMEFVNSWGEIA  241



>ref|XP_009346788.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=445

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 99/180 (55%), Gaps = 11/180 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  294
            L+V   +  L+ P+ ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  23   LRVKQGEPTLVPPAVETEKGLYFLSNLDQNIAVTVRTIYCFKSDAKGNDK--AGEVIKDA  80

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +E+IGD+  P+P   
Sbjct  81   LKKVLVH--YYPLAGRLAISAEGKLI-VDCTGEGAVFVEAEADCVIEEIGDITKPDP--E  135

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + +D    +   + P    QVT FKCGGFALG  MNH  FDG G   F+ +   ++
Sbjct  136  TLGKLVYDVPGAKTILEIPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWGKIA  195



>ref|XP_011045747.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Populus 
euphratica]
Length=442

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 89/165 (54%), Gaps = 5/165 (3%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P++ET K   FLSN+D+ +   V+T++ F  S     E     IKNA +++LV   Y
Sbjct  30   LVPPAEETEKGLYFLSNLDQNIAVIVRTIYCF-KSEEKGNENAGEVIKNALKKVLVH--Y  86

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP-AFRQLVTMSFDF  501
              LAGRL  + E++ + I C   GA F  A +  A+++IGD+  P+P    +LV    D 
Sbjct  87   YPLAGRLTISSEAKLI-INCTGEGAVFVEAEANCAMKEIGDITKPDPETLGKLVYEIPDA  145

Query  502  VAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
                + P    QVT F CGGFALG  MNH  FDG G   F+ +  
Sbjct  146  KNILEMPPLVAQVTKFTCGGFALGLCMNHCMFDGIGAMEFVNSWG  190



>emb|CDO98678.1| unnamed protein product [Coffea canephora]
Length=432

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 91/170 (54%), Gaps = 9/170 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            LI P++ET K   FLSN+D+ +   V+T++ F +      E V   IK+A  ++LV   Y
Sbjct  20   LIPPAEETQKGLYFLSNLDQNIAVIVRTIYCFKSGEKGNEEAVR-MIKDALSKVLV--QY  76

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + E + + ++C   GA F  A ++  +EDIGD   P+P    L  + +D  
Sbjct  77   HPLAGRLTISPEGKLI-VDCTGEGAVFVEAEADCTIEDIGDNTKPDPV--TLGKLVYDVP  133

Query  505  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
              ++    P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++
Sbjct  134  GAKNVLEIPPLAAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGEVA  183



>gb|KHG19404.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Gossypium arboreum]
Length=433

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 98/178 (55%), Gaps = 6/178 (3%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFD-VQTVHFFPASPGFPPEIVAGKIKNA  294
            +++TI +S ++ P++ET KH ++ SN++ ++    V TV+FF  + G       G +K A
Sbjct  1    MEITIKESSMVHPAEETPKHRLWSSNLELLMTLHHVPTVYFFRPN-GSSNFFDTGVLKEA  59

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALED-IGDLVYPNPAF  471
              ++LV   +  +AGRL ++ E+ R+EI CN  GA F  A +++ ++D IGD +  +   
Sbjct  60   LSKVLVP--FYPMAGRLGRD-ENGRIEIVCNGKGALFLEAETDYVIDDLIGDTMINSSEL  116

Query  472  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             +LV     F      PL  +QVT FKCGG   G  + H   DG     F+ +LA ++
Sbjct  117  WRLVPKVDYFADISSYPLILVQVTRFKCGGVGFGIGIQHTLADGPASVHFINSLAEMA  174



>gb|EMT14263.1| Taxadien-5-alpha-ol O-acetyltransferase [Aegilops tauschii]
Length=421

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 92/178 (52%), Gaps = 5/178 (3%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            + V   +  L+ P++ T T    +LSN+D+ +   VQTV+ F    G   E  A  +++A
Sbjct  9    MSVKRREPTLVSPAEATPTGEQYYLSNLDQNIAVIVQTVYCFKCPSGRGNEGAADVLRDA  68

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-F  471
              R+LV   Y  LAGRL  + E  ++ +EC   G  F  A +   L  IGDL  P+PA  
Sbjct  69   LARVLV--HYHPLAGRLGISPEM-KLTVECTGEGVPFVEAEAACDLALIGDLSTPDPAAL  125

Query  472  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             QLV          + P    QVT FKCGGF+LG +MNH  FDG G   F+ + A ++
Sbjct  126  GQLVYSVPGAKNILEMPPMTAQVTRFKCGGFSLGLAMNHCMFDGLGAMEFVNSWAEMA  183



>ref|XP_003634222.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
Length=433

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 93/177 (53%), Gaps = 9/177 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +L V   +  L+ P+++T K   FLSN+D+ +   V+T++ F  S     E  A  IK+A
Sbjct  11   ELSVKQEEPTLVPPAEDTEKGLYFLSNLDQNIAVIVRTIYCF-KSEAKGNERAAEIIKDA  69

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              ++LV   Y  LAGRL  + E + + ++C   GA F  A +  A+E+IGD+  P+P   
Sbjct  70   LSKVLVH--YYPLAGRLTISSEGKLI-VDCTGEGAVFVEAEANCAVEEIGDITKPDPV--  124

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
             L  + +D        + P    QVT FKCGGF LG  MNH  FDG G   F+ +  
Sbjct  125  TLGKLVYDIPGARNILETPPLVAQVTKFKCGGFVLGLCMNHCIFDGLGAMEFVNSWG  181



>ref|XP_007031933.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY02859.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=506

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 90/167 (54%), Gaps = 9/167 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P++ET K   FLSN+D+ +   V+T++ F  S     E     +K+A R++LV   Y
Sbjct  31   LVCPAEETEKGLYFLSNLDQNIAVIVRTIYCF-KSDEKGNENAGEVVKDALRKVLVH--Y  87

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + E + + ++CN  GA F  A +   +E+IGD+  P+P    L  + +D  
Sbjct  88   YPLAGRLTISSEGKLI-VDCNGEGAVFVEAEANCKMEEIGDITKPDP--ETLGKLVYDIP  144

Query  505  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
              +   + P    QVT F+CGGF LG  MNH  FDG G   F+ +  
Sbjct  145  GAKNILEIPPLVAQVTKFQCGGFVLGLCMNHCMFDGIGAMEFVNSWG  191



>ref|XP_006392548.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
 gb|ESQ29834.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
Length=433

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 91/166 (55%), Gaps = 12/166 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ I DS ++ P+ ET    ++ SN+D ++  F   +V+F+    +S  F PE+    +
Sbjct  1    MKINIRDSTMVRPAAETPSTYLWNSNVDLIIPRFHTPSVYFYRPTGSSNFFDPEV----M  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K A  + LV   +  +AGRLK++ +  R+EI+CNAAG  F VA +   ++D GD   P  
Sbjct  57   KEALSKALVP--FYPMAGRLKRDDDG-RIEIDCNAAGVLFVVADTPSVIDDFGDFA-PTL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
              RQL+            PL  LQVT FKCGG +LG  M H + DG
Sbjct  113  NLRQLIPDVDHSPGIHSFPLLVLQVTFFKCGGASLGVGMQHHAADG  158



>ref|XP_009383405.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=432

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 97/180 (54%), Gaps = 7/180 (4%)
 Frame = +1

Query  106  LHEDLKVTIL--DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAG  279
            L E  ++T+   +  L+ P++ET K   FL+N+D+ +   VQT++ F  S     E+ A 
Sbjct  5    LREKFELTVRQGEPTLVPPAEETEKGFYFLTNLDQNIAVIVQTIYCF-KSEEKGNEMAAE  63

Query  280  KIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYP  459
             IK+A  ++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +ED+GD+  P
Sbjct  64   VIKDALAQVLV--RYYPLAGRLTISNEGKLI-VDCTREGAVFVEAEADCKMEDVGDITKP  120

Query  460  NP-AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
            +P    +LV          + PL   QVT F CGGF LG +MNH  FDG G   F+ +  
Sbjct  121  DPDTLGKLVYSVPGAKNILEMPLLAAQVTKFSCGGFILGLAMNHCMFDGLGAMEFVNSWG  180



>ref|XP_008237042.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=446

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 104/185 (56%), Gaps = 12/185 (6%)
 Frame = +1

Query  106  LHEDLKVTILDSGLIFPSQETT-KHTMFLSNID-KVLNFDVQTVHFFPAS--PGFPPEIV  273
            + E + V+I +S ++ P++E+T + +++LSN+D +    D  TV+F+ ++    F   +V
Sbjct  1    MAEKVTVSIKESTMVKPAEESTPRGSLWLSNLDLEYSRHDTSTVYFYRSTGDENFFDLVV  60

Query  274  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  453
               +K A  + LV   +  +AGR K N ++ R+EI+CNA G  F VA S  A++D GD V
Sbjct  61   ---LKQALSKALVP--FYPMAGRYKLNDQNGRMEIDCNAEGVLFVVAESISAIDDFGDFV  115

Query  454  YPNPAFRQLVTMSFDFVAKEDQ-PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
              NP  R+L+    D+       P    QVT FKCGG +LG SM+H   DG     F+  
Sbjct  116  L-NPNLRELIP-GVDYAGGISSFPFFAFQVTYFKCGGVSLGVSMDHTVADGFSALHFVNT  173

Query  631  LAALS  645
             +A++
Sbjct  174  WSAIA  178



>ref|XP_008778437.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=432

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 91/167 (54%), Gaps = 9/167 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P++ET K   +LSN+D+ +   VQTV+ F  S     E VA  IK A  ++LV   Y
Sbjct  20   LVPPAEETDKGLYYLSNLDQNIAVIVQTVYCF-KSDDKGKERVAEVIKEALAKVLV--QY  76

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  + + + + + C   GA F  A+++  +EDIGD+  P+P    L  + ++  
Sbjct  77   YPLAGRLTISSKGKLI-VNCTGEGAVFVEATADCEMEDIGDITKPDPM--TLGKLVYNIP  133

Query  505  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
              +   + P    QVT FKCGGF LG +MNH  FDG G   F+ +  
Sbjct  134  GAKNILEIPPLVAQVTKFKCGGFILGLAMNHCMFDGLGAMEFVNSWG  180



>ref|XP_010500346.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=472

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 100/181 (55%), Gaps = 14/181 (8%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ I DS +I P+ ET    ++ SN+D ++  F   +V+F+     S  F P++    +
Sbjct  42   MKINIRDSTIIRPAAETPVTNLWNSNVDLIIPRFHTPSVYFYRPTGVSNFFDPQV----L  97

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K+A  + LV   +  +AGRLK++ +  R+EI+CN AG  F VA +   ++D+GD   P+ 
Sbjct  98   KDALSKALVP--FYPIAGRLKRDNDG-RIEIDCNGAGVLFVVADTPSVIDDLGDFA-PSL  153

Query  466  AFRQLVTMSFDFVAKEDQ-PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
              RQL+    D+ A     PL  LQVT F+CGG +LG  + H   DGS    F+   + +
Sbjct  154  TLRQLIP-DVDYSAGVHTFPLLVLQVTFFRCGGASLGVGLQHHVADGSSALHFINTWSDM  212

Query  643  S  645
            +
Sbjct  213  A  213



>ref|NP_199704.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
 sp|Q9FI78.1|HST_ARATH RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Arabidopsis thaliana]
 dbj|BAB10316.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 dbj|BAE98378.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 gb|ABH04595.1| At5g48930 [Arabidopsis thaliana]
 gb|AED95744.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
Length=433

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 90/166 (54%), Gaps = 12/166 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ I DS ++ P+ ET    ++ SN+D V+  F   +V+F+    AS  F P++    +
Sbjct  1    MKINIRDSTMVRPATETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQV----M  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K A  + LV   +  +AGRLK++ +  R+EI+CN AG  F VA +   ++D GD   P  
Sbjct  57   KEALSKALVP--FYPMAGRLKRDDDG-RIEIDCNGAGVLFVVADTPSVIDDFGDFA-PTL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
              RQL+            PL  LQVT FKCGG +LG  M H + DG
Sbjct  113  NLRQLIPEVDHSAGIHSFPLLVLQVTFFKCGGASLGVGMQHHAADG  158



>gb|AAM61215.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
Length=433

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 90/166 (54%), Gaps = 12/166 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ I DS ++ P+ ET    ++ SN+D V+  F   +V+F+    AS  F P++    +
Sbjct  1    MKINIRDSTMVRPATETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQV----M  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K A  + LV   +  +AGRLK++ +  R+EI+CN AG  F VA +   ++D GD   P  
Sbjct  57   KEALSKALVP--FYPMAGRLKRDDDG-RIEIDCNGAGVLFVVADTPSVIDDFGDFA-PTL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
              RQL+            PL  LQVT FKCGG +LG  M H + DG
Sbjct  113  NLRQLIPEVDHSTGIHSFPLLVLQVTFFKCGGASLGVGMQHHAADG  158



>ref|XP_010273688.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=454

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 94/177 (53%), Gaps = 5/177 (3%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  297
            +KVT+  +  + P + T  H + LS ID+   +      +F    G P    A  +K A 
Sbjct  2    VKVTLKSTYTVKPIESTPIHRLDLSEIDQAKAWTHSPTVYFYRPNGQPNFFSAETVKTAL  61

Query  298  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  477
             + LV   +  LAGR++K+KE  R+E+ CN  GA F  A S+  ++D+GD   P    R 
Sbjct  62   SQALVQ--FYPLAGRIEKDKEG-RLELNCNEKGALFVEAKSDSDIDDLGDFA-PTSELRG  117

Query  478  LVT-MSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            LV  + ++     + PL  +Q+TSF+CGG  LG  ++HI  DG+   +F+ + A ++
Sbjct  118  LVPYVDYNETHISEWPLVLVQITSFRCGGICLGLGISHIVADGAAAMLFVTSWAQIA  174



>ref|XP_009381343.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=442

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 93/174 (53%), Gaps = 9/174 (5%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  297
            L V   ++ L+ P +ET +   FLSN+D+ +   V+TV+ F  SP    E     I+ A 
Sbjct  21   LSVEQGEASLVPPEKETERVLYFLSNLDQNIAVIVRTVYCF-KSPDQGNEKAGDVIREAL  79

Query  298  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  477
             ++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +E IGD+  P+P+   
Sbjct  80   SKVLVH--YYPLAGRLTVSSERKLI-VDCTGEGAVFVEAIADCEMEQIGDIAKPDPSM--  134

Query  478  LVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
            L  + +D    ++    P    QVT FKCGGF LG +MNH  FDG G   F+ +
Sbjct  135  LGKLVYDVPGAKNMLEIPPLVAQVTKFKCGGFILGLAMNHCMFDGLGAMEFVNS  188



>ref|XP_009102018.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=433

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 90/166 (54%), Gaps = 12/166 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ I DS ++ P+ ET    ++ SN+D V+  F   +V+F+    AS  F P    G +
Sbjct  1    MKINIRDSTMVRPAGETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDP----GVM  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K A  + LV   +  +AGRLK++ +  R+EI+CNAAG  F VA +   ++D GD   P  
Sbjct  57   KEALAKALVP--FYPMAGRLKRDDDG-RIEIDCNAAGVLFVVADTPSLIDDFGDFA-PTL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
              RQL+            PL  LQVT FKCGG +LG  M H + DG
Sbjct  113  DLRQLIPDVDHSPGIHSFPLLVLQVTYFKCGGASLGVGMQHHAADG  158



>ref|XP_007200675.1| hypothetical protein PRUPE_ppa015918mg [Prunus persica]
 gb|EMJ01874.1| hypothetical protein PRUPE_ppa015918mg [Prunus persica]
Length=439

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 93/185 (50%), Gaps = 19/185 (10%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  300
            V +++  +I P +      +FLSNID  L    +TV FF P S G      +    + FR
Sbjct  4    VKLVEKVVIAPEKPKQPRRLFLSNIDLGLVVYQETVIFFDPPSNGMS---FSEAYHSLFR  60

Query  301  RL--LVANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
             L  L+A  YDFLAGRL  + E S R EIECN AG     A ++  L+++G+L+ P   F
Sbjct  61   TLGPLLAE-YDFLAGRLVPSLEDSNRFEIECNGAGVVVAAARTDTKLDELGELLVPKKEF  119

Query  472  RQLVTMSFDFVAKEDQ-------PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
            RQ V     F+ +ED+       PL   Q T   CG     +  NH + DG   + F  N
Sbjct  120  RQFVA----FLLQEDEEMDLKDMPLVSFQFTQLGCGSLVFASRFNHCAVDGVAVREFEAN  175

Query  631  LAALS  645
            LAAL+
Sbjct  176  LAALT  180



>gb|ACN28372.1| unknown [Zea mays]
 gb|AFW84462.1| transferase [Zea mays]
Length=453

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 93/171 (54%), Gaps = 10/171 (6%)
 Frame = +1

Query  145  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEI----VAGKIKNAFRRL  306
            L+ P++ T T    +LSN+D+ +   VQTV+ + P+SPG         VAG +++A  R+
Sbjct  31   LVPPAEATPTGGQYYLSNLDQNIAVIVQTVYCYKPSSPGGGEGKEDVDVAGALRDALARV  90

Query  307  LVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-FRQLV  483
            LV   Y  LAGRL  + E  ++ +E    GA F  A +   L+ +GDL  P+PA   QLV
Sbjct  91   LV--HYHPLAGRLGVSPEM-KLTVELTGEGAVFVEADAACDLDAVGDLTKPDPAALGQLV  147

Query  484  TMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
                      + P    QVT FKCGGFALG +MNH  FDG G   F+ + A
Sbjct  148  YSVPGAKHILEMPPMTAQVTRFKCGGFALGLAMNHCMFDGIGAMEFVNSWA  198



>emb|CDY31956.1| BnaA07g00390D [Brassica napus]
Length=433

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 90/166 (54%), Gaps = 12/166 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ I DS ++ P+ ET    ++ SN+D V+  F   +V+F+    AS  F P    G +
Sbjct  1    MKINIRDSTMVRPAGETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDP----GVM  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K A  + LV   +  +AGRLK++ +  R+EI+CNAAG  F VA +   ++D GD   P  
Sbjct  57   KEALAKALVP--FYPMAGRLKRDDDG-RIEIDCNAAGVLFVVADTPSLIDDFGDFA-PTL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
              RQL+            PL  LQVT FKCGG +LG  M H + DG
Sbjct  113  DLRQLIPDVDHSPGIHSFPLLVLQVTYFKCGGASLGVGMQHHAADG  158



>ref|XP_007214866.1| hypothetical protein PRUPE_ppa019948mg [Prunus persica]
 gb|EMJ16065.1| hypothetical protein PRUPE_ppa019948mg [Prunus persica]
Length=449

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 102/186 (55%), Gaps = 16/186 (9%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLN-FDVQTVHFFPASPG-----FPPEI  270
            + + V+I DS ++ P++E+T + +++LSN+D V   F   +V+F+  S G     F PE 
Sbjct  3    KKVTVSIRDSSMVKPAEESTPRGSLWLSNLDLVFPPFHTPSVYFYRPSCGHEHNFFHPE-  61

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
                +K A  + LV   +  +AGRLK N +  R+E++CNA G  F VA S   ++D GD 
Sbjct  62   ---ALKQALIKALVP--FYPMAGRLKLNDQDGRLEVDCNAEGVLFVVAESFSTVDDFGDF  116

Query  451  VYPNPAFRQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLE  627
              P+P F  L+    D+ A     P+  LQVT FKCGG +LG ++ H   DG     F+ 
Sbjct  117  A-PSPNFLPLIP-PIDYAAGISAYPILVLQVTYFKCGGVSLGVAIEHRIADGVSALHFVN  174

Query  628  NLAALS  645
              + ++
Sbjct  175  TWSRIA  180



>ref|XP_004971119.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Setaria italica]
Length=437

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 91/167 (54%), Gaps = 6/167 (4%)
 Frame = +1

Query  136  DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVA  315
            +  L+ P+ ET K + +LSN+D+ +   VQTV+ F A+ G      +G +K +  ++LV 
Sbjct  13   EPALVPPAAETPKGSYYLSNLDQNIAVIVQTVYCFRAAGGDDGRSASGVLKESLAKVLV-  71

Query  316  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSF  495
              Y  LAGRL  + E  ++ ++    GA F  A ++  + DIGD+  P+PA    +  S 
Sbjct  72   -HYYPLAGRLTVSGEG-KLAVDLTGEGAVFVEAEADCDMADIGDVAEPDPAVLGKLVYSV  129

Query  496  DFVAKE--DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
               AK   + PL   QVT FKCGGF LG ++NH  FDG     F+ +
Sbjct  130  PG-AKNILEMPLLAAQVTKFKCGGFVLGLAINHCMFDGVSAMQFVNS  175



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 96/178 (54%), Gaps = 8/178 (4%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFPASPGFPPEIVAGK-IKN  291
            +K+++ +S ++ P++ET +  ++ SN+D V+ NF   +V+F+   P    +    K +K+
Sbjct  1    MKISVKESTMVRPAEETPRIRLWNSNVDLVVPNFHTPSVYFY--RPNGADDFFESKALKD  58

Query  292  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  471
               R LV   +  +AGRL ++ E  R+EI+CN AG     A S+  ++D GD   P    
Sbjct  59   GLSRALVP--FYPMAGRLTRD-EDGRIEIDCNGAGVLLVEAESDGFVDDFGDFA-PTLEL  114

Query  472  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            RQL+         E  PL  LQVT FKCGG +LG  M H + DG+    F+   + ++
Sbjct  115  RQLIPTVDYSQGIESYPLLVLQVTHFKCGGVSLGVGMQHHAADGASGLHFINTWSDMA  172



>ref|XP_011073101.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Sesamum indicum]
 ref|XP_011073102.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Sesamum indicum]
Length=432

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 94/180 (52%), Gaps = 9/180 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +L V      L+ P++ET K   FLSN+D+ +   V+T++ F +      + V   IKNA
Sbjct  10   ELSVKQGQPTLVPPAEETMKGFYFLSNLDQNIAVIVRTIYCFKSEERGNEDAVE-VIKNA  68

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              ++LV   Y  LAGRL  + E + + ++C   GA F  A +E  L+ +GD+  P+P   
Sbjct  69   LSKVLVH--YYPLAGRLTISPEMKLI-VDCTGEGAVFVEAEAECELQKLGDITKPDPV--  123

Query  475  QLVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + +D    E+    P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++
Sbjct  124  TLGKLVYDIPGAENVLQIPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGEIA  183



>ref|XP_010479239.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 99/181 (55%), Gaps = 14/181 (8%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ I DS ++ P+ ET    ++ SN+D ++  F   +V+F+    AS  F P++    +
Sbjct  1    MKINIRDSTVVRPAAETPVINLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQV----L  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K A  + LVA  +  +AGRLK++ +  R+EI+CN  G  F VA +   ++D GD   P+ 
Sbjct  57   KEALSKALVA--FYPIAGRLKRDNDG-RIEIDCNGEGVLFVVADTPSVIDDFGDFA-PSL  112

Query  466  AFRQLVTMSFDFVAKEDQ-PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  642
              RQL+    D+ A     PL  LQVT FKCGG +LG  + H   DGS    F+   + +
Sbjct  113  TLRQLIP-DVDYSAGVHTFPLLVLQVTFFKCGGASLGVGLQHHVADGSSALHFINTWSDM  171

Query  643  S  645
            +
Sbjct  172  A  172



>ref|XP_009354208.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 95/185 (51%), Gaps = 17/185 (9%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKV-LNFDVQTVHFFPASPG--------FPPEI  270
            + V++ +S ++ P++ET K  +++SN+D V L     +V+F+  S          F P +
Sbjct  3    VNVSVRESTIVKPTEETPKQVLWMSNLDLVILGKHTPSVYFYRRSQTGSHHGNSFFDPAV  62

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
                +K A  + LV   +  LAGRL++N E+ R EI CN  G  F VA +   LED GD 
Sbjct  63   ----LKRALAKALVP--FYPLAGRLQQN-ETGRSEINCNGEGVLFVVAETASVLEDFGDF  115

Query  451  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  630
              P P FR+L+ +          PL  +QVT FKCGG +LG  + H   DG     F+  
Sbjct  116  A-PTPEFRKLIPVVDYSAGISTYPLLVVQVTYFKCGGVSLGVGLEHRVADGCSGLHFVNT  174

Query  631  LAALS  645
             + ++
Sbjct  175  WSDIA  179



>ref|XP_009600109.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nicotiana tomentosiformis]
Length=433

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 88/163 (54%), Gaps = 9/163 (6%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P++ET K   +LSN+D+ +   V+T++ F +        V   IK A  ++LV   Y
Sbjct  21   LVSPAEETDKGLYYLSNLDQNIAVPVRTIYCFKSEEKRNENAVE-VIKEALSKVLVH--Y  77

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  ++E + + + C+  GA +  A +  ++EDIGD+  P+P    L  + +D  
Sbjct  78   YPLAGRLTISQEGKLI-VNCSGEGAVYVEAEANCSIEDIGDITKPDPV--TLGKLVYDIP  134

Query  505  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  624
              +   + P    QVT FKCGGF LG  MNH  FDG G   F+
Sbjct  135  GAKNILEMPPLIAQVTGFKCGGFVLGLCMNHCMFDGIGAMEFV  177



>ref|XP_002300751.1| transferase family protein [Populus trichocarpa]
 gb|EEE80024.1| transferase family protein [Populus trichocarpa]
Length=444

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 96/173 (55%), Gaps = 17/173 (10%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNID--KVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVAN  318
            LIFPS  T KH+++LSN+D  K L F ++ ++ F  S      I    +K +  ++LV  
Sbjct  18   LIFPSSPTPKHSLYLSNLDDQKFLRFSIKYLYLFKKS------ISLDILKYSLSKVLVH-  70

Query  319  TYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDL-VYPNPAFRQLVTMS  492
             Y  LAGRL+ + E  +++E++CN  GA F  A  +   E+  DL + PN ++R+L+   
Sbjct  71   -YYPLAGRLRASTEVDQKLEVDCNGEGAVFAEAFMDITAEEFLDLSMKPNKSWRKLL---  126

Query  493  FDFVAKE--DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            +   A+   D P   +QVT+ +CGG  + TS+NH   DG G   FL   A ++
Sbjct  127  YRVEAQSFLDIPPLVVQVTTLRCGGMIVCTSINHCVCDGIGTSQFLHAWAQIT  179



>ref|XP_010652628.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Vitis vinifera]
Length=454

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 98/202 (49%), Gaps = 32/202 (16%)
 Frame = +1

Query  112  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  291
            ED+K  +++  ++ P   T +  +FLSNID  L    ++V FF       P      +  
Sbjct  2    EDVK--LVERMMVLPETPTPRRRVFLSNIDLTLVAYQESVSFFD------PPANQMSLSE  53

Query  292  AFRRLL-----VANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLV  453
            AF RL      V  +YDFLAGRL  + E S R+EI+CN AG     A+++  +  +G+L+
Sbjct  54   AFHRLCRAISQVLVSYDFLAGRLVPSLEASNRLEIDCNNAGFVVAAATTKTTVSQLGELM  113

Query  454  YPNPAFRQLVTM----SFDFVAKEDQPLCFLQV--------------TSFKCGGFALGTS  579
             P P F +LV      + D +  +D+PL F QV              T F CGG ALG+ 
Sbjct  114  APKPEFERLVAFLREEAEDELELKDKPLGFFQVLSVFWFRVYVSWQLTQFGCGGLALGSR  173

Query  580  MNHISFDGSGFKMFLENLAALS  645
              H   DG        NLA+L+
Sbjct  174  YYHCILDGVAIHDLEMNLASLT  195



>gb|KDO63871.1| hypothetical protein CISIN_1g014029mg [Citrus sinensis]
Length=432

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 90/177 (51%), Gaps = 9/177 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +L V   +  L+ P+++T K   FLSN+D+ +   V+T++ F  S     E     IKNA
Sbjct  10   ELNVKQGEPTLVKPAEDTEKGLYFLSNLDQNIAVIVRTIYCF-KSDEKGNEKAGEVIKNA  68

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              ++LV   Y  LAGRL  + E + + I C   GA F  A +   LE IGD+  P+P   
Sbjct  69   LEKVLVH--YYPLAGRLTISSEGKLI-INCTGEGAVFVEAEANCVLEKIGDITKPDP--E  123

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
             L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+   A
Sbjct  124  TLGKLVYDIPGAKNILEMPPLAAQVTRFKCGGFVLGLCMNHCMFDGIGAMEFVNAWA  180



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 93/176 (53%), Gaps = 8/176 (5%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFPASPGFPPEIVAGKI-KNAF  297
            + + DS ++ PS+E T+ T++ SN+D V+ NF   +V+F+   P         K+ K A 
Sbjct  3    INVRDSTMVRPSEEVTQRTVWNSNVDLVVPNFHTPSVYFY--RPNGASNFFDAKVLKEAL  60

Query  298  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  477
             ++LV   +  +AGRL+++ E  RVEI+C+  G  F  A +   ++D GD   P    RQ
Sbjct  61   SKVLVP--FYPMAGRLRRD-EDGRVEIDCDGQGVLFVEADTGGVVDDFGDFA-PTLELRQ  116

Query  478  LVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            L+         E  PL  LQVT FKCGG +LG  M H   DG+    F+   + ++
Sbjct  117  LIPAVDYSRGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVA  172



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 89/165 (54%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFF--PASPGFPPEIVAGKIK  288
            +K+ + DS L+ P+  T   +++ SNID V+ NF   +V+F+   A+  F     AG +K
Sbjct  1    MKINVKDSTLVRPAAATPMVSLWNSNIDLVVPNFHTPSVYFYRPTAADNF---FDAGVLK  57

Query  289  NAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA  468
             A  R LV   +  +AGRLK++ E  RVEI+CNA G  F  A S+  ++D GD   P   
Sbjct  58   AALGRALVP--FYPMAGRLKRD-EDGRVEIDCNAEGVLFVEAESDGVVDDFGDFA-PTLE  113

Query  469  FRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
             R+L+            PL  LQVT FKCGG +LG  M H   DG
Sbjct  114  LRRLIPAVDYSQGISTYPLLVLQVTHFKCGGVSLGVGMQHHVADG  158



>ref|XP_006447016.1| hypothetical protein CICLE_v10015302mg [Citrus clementina]
 gb|ESR60256.1| hypothetical protein CICLE_v10015302mg [Citrus clementina]
Length=432

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 90/177 (51%), Gaps = 9/177 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +L V   +  L+ P+++T K   FLSN+D+ +   V+T++ F  S     E     IKNA
Sbjct  10   ELNVKQGEPTLVKPAEDTEKGLYFLSNLDQNIAVIVRTIYCF-KSDEKGNEKAGEVIKNA  68

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              ++LV   Y  LAGRL  + E + + I C   GA F  A +   LE IGD+  P+P   
Sbjct  69   LEKVLVH--YYPLAGRLTISSEGKLI-INCTGEGAVFVEAEANCVLEKIGDITKPDP--E  123

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
             L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+   A
Sbjct  124  TLGKLVYDIPGAKNILEMPPLAAQVTRFKCGGFVLGLCMNHCMFDGIGAMEFVNAWA  180



>ref|XP_007216058.1| hypothetical protein PRUPE_ppa017691mg [Prunus persica]
 gb|EMJ17257.1| hypothetical protein PRUPE_ppa017691mg [Prunus persica]
Length=443

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 95/169 (56%), Gaps = 8/169 (5%)
 Frame = +1

Query  106  LHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLN-FDVQTVHFFPASPGFPPEIVAG  279
            + E + V+I +S ++ P++E+T + +++LSN D     F   +V+F+ +S G       G
Sbjct  1    MAEKVMVSIRESTMVRPAEESTPRGSLWLSNSDLAFPPFHTSSVYFYKSS-GEHNFFDKG  59

Query  280  KIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYP  459
             +K A  + LV   +  +AGR K N ++ RVEI+CNA G  F VA S  A++D GD   P
Sbjct  60   VLKQALGKALVP--FYPMAGRFKLNDQNGRVEIDCNAEGVVFVVAESSSAVDDFGDFA-P  116

Query  460  NPAFRQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
             P F  L+  + D+       P+  LQ+T FKCGG +LG  M+H   DG
Sbjct  117  TPDFLTLIP-TIDYSGGISSYPILALQITYFKCGGVSLGVGMDHRVADG  164



>ref|XP_006303737.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
 gb|EOA36635.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
Length=426

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 97/167 (58%), Gaps = 14/167 (8%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFF-PASPG--FPPEIVAGKI  285
            +K+ I DS ++ P+ ET   +++ SN+D ++  F   +V+F+ P S    F P++    +
Sbjct  1    MKINIRDSTIVRPAGETPITSLWNSNVDLIIPRFHTPSVYFYRPTSDSNFFNPQV----L  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K+A  ++LV   +  +AGRLK+  + +R++I+CN+AG  F VA +   ++D GD   P  
Sbjct  57   KDALSKVLVP--FYPVAGRLKRGND-DRIKIDCNSAGVLFVVADTPSVIDDFGDFA-PTL  112

Query  466  AFRQLVTMSFDFVAKEDQ-PLCFLQVTSFKCGGFALGTSMNHISFDG  603
            A RQL+    D+ A     PL  LQVT F+CGG +LG  M H   DG
Sbjct  113  ALRQLIP-GVDYSAGIHTFPLLVLQVTFFRCGGVSLGVGMQHHLNDG  158



>ref|XP_006470104.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
Length=442

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 90/177 (51%), Gaps = 9/177 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +L V   +  L+ P+++T K   FLSN+D+ +   V+T++ F +      E     IKNA
Sbjct  20   ELNVKQGEPTLVKPAEDTEKGLYFLSNLDQNIAVIVRTIYCFKSDEK-GNEKAGEVIKNA  78

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              ++LV   Y  LAGRL  + E + + I C   GA F  A +   LE IGD+  P+P   
Sbjct  79   LEKVLVH--YYPLAGRLTISSEGKLI-INCTGEGAVFVEAEANCVLEKIGDITKPDP--E  133

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
             L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+   A
Sbjct  134  TLGKLVYDIPGAKNILEMPPLAAQVTRFKCGGFVLGLCMNHCMFDGIGAMEFVNAWA  190



>ref|XP_010249109.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
 ref|XP_010249110.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=432

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 90/173 (52%), Gaps = 9/173 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +L V   +  L+ P +ET K   FLSN+D+ +   V+T++ F  S     E  A  IK A
Sbjct  10   ELNVKQGEPTLVPPVEETQKGLYFLSNLDQNIAVIVRTIYCF-KSEEMGNERAANIIKEA  68

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              ++LV   Y  LAGRL  + E + + ++C   GA F  A +   LEDIGD   P+P   
Sbjct  69   LAKVLVH--YYPLAGRLTISSEGKLI-VDCTGDGAIFVEAEANCTLEDIGDTTKPDPV--  123

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  624
             L  + +D    +   + P    QVT+FKCGGF LG  +NH  FDG G   F+
Sbjct  124  TLGKLVYDIPGAKNILEIPPLVAQVTTFKCGGFVLGLGINHCMFDGLGAMEFI  176



>ref|XP_002325143.2| transferase family protein [Populus trichocarpa]
 gb|EEF03708.2| transferase family protein [Populus trichocarpa]
Length=455

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 93/177 (53%), Gaps = 8/177 (5%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDKVLNF-DVQTVHFFPASPGFPPE--IVAGKIKNA  294
            VTI  S ++ P++ T    + LS  D++     V T++F+ +SP +P +   +   +K++
Sbjct  3    VTIKSSHVVKPAKPTWTGRVSLSEWDQIGTVTHVPTIYFYKSSPKWPTQSNAIINNLKDS  62

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
                LV   +  LAGRL       R+E+ECNA G   T A SE  LED+GDL   +P ++
Sbjct  63   LSHALVP--FYLLAGRLHWIGRG-RLELECNAMGVTLTEAESESKLEDLGDLT--SPEYQ  117

Query  475  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L+      V   + PL  +Q+T F+CGG +LG  ++H   DG     F+   A +S
Sbjct  118  YLIPNVDYTVPLHELPLLLVQLTIFQCGGISLGLRISHAVVDGKSALQFMSEWARIS  174



>emb|CAT00088.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=232

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 94/177 (53%), Gaps = 6/177 (3%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +K+ + +S ++ P+QET    ++ SN+D V+ NF   +V+F+  + G      A  +K+A
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPT-GSSNFFDAKVLKDA  59

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              R LV   +  +AGRLK++ E  R+EIECN  G  F  A S+  ++D GD   P    R
Sbjct  60   LSRALVP--FYPMAGRLKRD-EDGRIEIECNGEGVLFVEAESDGVVDDFGDFA-PTLELR  115

Query  475  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            +L+             L  LQVT FKCGG +LG  M H + DG     F+ + + ++
Sbjct  116  RLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINSWSDMA  172



>ref|XP_008228829.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=443

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 94/169 (56%), Gaps = 8/169 (5%)
 Frame = +1

Query  106  LHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLN-FDVQTVHFFPASPGFPPEIVAG  279
            + E + V+I +S ++ P++E+T + +++LSN D     F   +V+F+ +S G       G
Sbjct  1    MAEKVMVSIRESTMVRPAEESTPRGSLWLSNSDLAFPPFHTSSVYFYRSS-GKHNFFDKG  59

Query  280  KIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYP  459
             +K A  + LV   +  +AGR K N ++ RVEI+CNA G  F VA S  A++D GD   P
Sbjct  60   VLKQALGKALVP--FYPMAGRFKLNGQNGRVEIDCNAEGVVFVVAESSSAIDDFGDFA-P  116

Query  460  NPAFRQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
             P F  L+  + D+       P+  LQ+T FKCGG +LG  M H   DG
Sbjct  117  TPDFLTLIP-TIDYSGGISSYPILVLQITYFKCGGVSLGVGMEHRVADG  164



>emb|CDX71341.1| BnaC07g06200D [Brassica napus]
Length=95

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +1

Query  295  FRRLLV--ANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA  468
             R+ LV   + Y+  AGR++ N  S  ++++CN AGAGF +A SE+ LE++GDLVYPNP+
Sbjct  2    LRKALVRAMDVYELFAGRIRLNPSSGSLDVDCNGAGAGFVMAESEYTLEELGDLVYPNPS  61

Query  469  FRQLVTMSFDFVAKEDQPLCFLQVTS  546
              +LVT+    + K+DQPL   QVT+
Sbjct  62   CAKLVTIQLQSLPKDDQPLFAFQVTN  87



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 89/163 (55%), Gaps = 6/163 (4%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +K+ + +S ++ P+QET +  ++ SN+D V+ NF   +V+F+  + G      A  +K+A
Sbjct  1    MKIEVKESTMVRPAQETPRRNLWNSNVDLVVPNFHTPSVYFYRPT-GSSNFFDAKVLKDA  59

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              R LV   +  +AGRLK++ E  R+EIECN  G  F  A S+  ++D GD   P    R
Sbjct  60   LSRALVP--FYPMAGRLKRD-EDGRIEIECNGEGVLFVEAESDGVVDDFGDFA-PTLELR  115

Query  475  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
            +L+             L  LQVT FKCGG +LG  M H + DG
Sbjct  116  RLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMQHHAADG  158



>gb|KJB19785.1| hypothetical protein B456_003G119000 [Gossypium raimondii]
 gb|KJB19786.1| hypothetical protein B456_003G119000 [Gossypium raimondii]
Length=433

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 86/155 (55%), Gaps = 9/155 (6%)
 Frame = +1

Query  148  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  327
            + P++ET K   +L N+D+ +   ++T++ F  S     E  A ++KN   R+LV   + 
Sbjct  21   VLPAEETKKGLYYLGNLDQNIAVIIRTIYLF-KSESKGNEDAAEQVKNGLSRILVH--HH  77

Query  328  FLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVA  507
             LAGRL  + E + + ++C   GA F  A +   +E++GD+  P+P    L  + ++   
Sbjct  78   PLAGRLTISSEGKLI-VDCTGEGAVFVEAEANCGIEEMGDITKPDPNI--LGKLVYEISG  134

Query  508  KEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDG  603
             ++    PL  +QVT FKCGGF++G SMNH   DG
Sbjct  135  AQNLLEIPLLVIQVTKFKCGGFSIGMSMNHCMLDG  169



>gb|KCW60630.1| hypothetical protein EUGRSUZ_H03354 [Eucalyptus grandis]
Length=433

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 92/177 (52%), Gaps = 9/177 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
             L VT  +  L+ P++ET     FLSN+D+ +   ++T++ F  S     E V   IK A
Sbjct  11   QLCVTQGEPTLVTPAEETENGLYFLSNLDQNIAVIIRTIYCF-KSIEKGNEHVGEVIKGA  69

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A +   LE+IGD+  P+P   
Sbjct  70   LKKVLVH--YYPLAGRLTISPEGKLI-VDCTGEGAIFVEAEANCTLEEIGDITKPHP--E  124

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
             L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +  
Sbjct  125  TLGKLVYDVPGAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWG  181



>ref|XP_010024179.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Eucalyptus 
grandis]
 gb|KCW60629.1| hypothetical protein EUGRSUZ_H03354 [Eucalyptus grandis]
Length=443

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 92/177 (52%), Gaps = 9/177 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
             L VT  +  L+ P++ET     FLSN+D+ +   ++T++ F  S     E V   IK A
Sbjct  21   QLCVTQGEPTLVTPAEETENGLYFLSNLDQNIAVIIRTIYCF-KSIEKGNEHVGEVIKGA  79

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
             +++LV   Y  LAGRL  + E + + ++C   GA F  A +   LE+IGD+  P+P   
Sbjct  80   LKKVLVH--YYPLAGRLTISPEGKLI-VDCTGEGAIFVEAEANCTLEEIGDITKPHP--E  134

Query  475  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
             L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +  
Sbjct  135  TLGKLVYDVPGAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWG  191



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 91/169 (54%), Gaps = 9/169 (5%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF--PASPGFPPEIVAGKIKNAFRRLLVAN  318
            ++ P++ET K  ++ SNID++    + +V+F+    S  F        +K +  + LV  
Sbjct  10   IVEPAEETPKKILWTSNIDQLFKLLIPSVYFYRPDGSTNF---FDVKAMKESLSKALV--  64

Query  319  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  498
            ++  +AGRLK+N E  RVE +CN  G     A +E +L+D+GD   P    RQL+    +
Sbjct  65   SFYPMAGRLKRN-EDGRVETDCNGKGVLLVEAETETSLDDLGDF-RPTTELRQLIPRVDN  122

Query  499  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             +     PL  LQVT FKCGG ++G  M H + DG+    F+ + + ++
Sbjct  123  PMDISPYPLLLLQVTYFKCGGVSVGVGMEHTATDGASGTHFINSWSEIA  171



>ref|XP_011073100.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X1 [Sesamum indicum]
Length=490

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 93/180 (52%), Gaps = 9/180 (5%)
 Frame = +1

Query  115  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +L V      L+ P++ET K   FLSN+D+ +   V+T++ F  S     E     IKNA
Sbjct  68   ELSVKQGQPTLVPPAEETMKGFYFLSNLDQNIAVIVRTIYCF-KSEERGNEDAVEVIKNA  126

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              ++LV   Y  LAGRL  + E + + ++C   GA F  A +E  L+ +GD+  P+P   
Sbjct  127  LSKVLVH--YYPLAGRLTISPEMKLI-VDCTGEGAVFVEAEAECELQKLGDITKPDPV--  181

Query  475  QLVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L  + +D    E+    P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++
Sbjct  182  TLGKLVYDIPGAENVLQIPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGEIA  241



>emb|CDY31377.1| BnaA07g03120D [Brassica napus]
Length=93

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +1

Query  295  FRRLLVA--NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA  468
             R+ LV   + Y+FLAGR++ N  S  ++++CN AGAGF VA SE+ LE++GDLVYPNP+
Sbjct  2    LRKALVRAMDVYEFLAGRIRLNPSSGSLDVDCNGAGAGFVVAKSEYTLEELGDLVYPNPS  61

Query  469  FRQLVTMSFDFVAKEDQPLCFLQVTS  546
              +LVT     + K+DQP    QV +
Sbjct  62   CAKLVTSELQSLPKDDQPFFPFQVKA  87



>ref|XP_006303767.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
 gb|EOA36665.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
Length=430

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 91/166 (55%), Gaps = 12/166 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFPA---SPGFPPEIVAGKI  285
            +K+ I DS ++ P+ ET   +++ SN+D ++  +   +V+F+     S  F P++    +
Sbjct  1    MKIKIQDSTMVRPAAETPITSLWNSNVDLIMAKYHTPSVYFYRPTGDSSFFDPQV----L  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K+A  + LV   +  +AGRLKK+ +  R+EI+CN AG  F VA +  A++D GD   P P
Sbjct  57   KDALSKALVP--FYPVAGRLKKDDDG-RIEIDCNGAGVLFVVADTPSAIDDFGDFA-PTP  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  603
                L+      +     PL  LQVT FKCGG +LG  M H   DG
Sbjct  113  TLGLLIPHVDYSIGVHTFPLLVLQVTFFKCGGASLGVGMQHHVADG  158



>ref|NP_001151137.1| LOC100284770 [Zea mays]
 gb|ACG41733.1| anthranilate N-benzoyltransferase protein 1 [Zea mays]
Length=433

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 99/194 (51%), Gaps = 28/194 (14%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNID-KVLNFDVQTVHFFPASPG-------------  255
            +KV ++++ L+ PS+ T +H ++LSN+D  V       V+++P   G             
Sbjct  1    MKVEVVETTLVPPSEATPRHALWLSNLDLAVPKTHTPLVYYYPRPAGAGAGEEGKGEGEG  60

Query  256  --FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  429
              F P     +++ A  R LV   +  LAGRL       R+EI+C   GA F VA ++F 
Sbjct  61   SFFDP----ARLREALSRALV--PFYPLAGRLAAGPGG-RLEIDCTGEGALFCVARADFT  113

Query  430  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQP--LCFLQVTSFKCGGFALGTSMNHISFDG  603
             +++     P+P  R+L+     F A  D P  L  +QVT  KCGG A+GT M+H++ DG
Sbjct  114  GDEMFADFEPSPEARRLLV---PFAASGDPPCVLAMVQVTFLKCGGVAVGTGMHHVTMDG  170

Query  604  SGFKMFLENLAALS  645
            +G   F+    AL+
Sbjct  171  AGAIQFIRAWTALA  184



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 98/180 (54%), Gaps = 12/180 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFP---ASPGFPPEIVAGKI  285
            +K+ + +S ++ P++ET +  ++ SN+D V+ NF   +V+F+    A+  F P++    +
Sbjct  1    MKIEVRESTMVRPAEETPRINLWNSNVDLVVPNFHTPSVYFYRPNGAANFFDPKV----M  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K+A  R LV   +  + GRLK++ E  R+EI+C   G  F  A S+  ++D GD   P  
Sbjct  57   KDALSRALVP--FYPMGGRLKRD-EDGRIEIDCQGQGVLFVEAESDGVIDDFGDFA-PTL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
              R+L+      +  E   L  LQVT FKCGG +LG  M H + DG+    F+   + L+
Sbjct  113  ELRKLIPAVDYTLGIESYSLLVLQVTYFKCGGVSLGVGMQHHAADGASGLHFINTWSDLA  172



>ref|XP_002277474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
 emb|CBI36545.3| unnamed protein product [Vitis vinifera]
Length=433

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 93/177 (53%), Gaps = 5/177 (3%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFPASPGFPPEIVAGKIKNA  294
            +K+ +    ++ P++ T KHT+++SN+D V+    V TV+ +  +        A ++K A
Sbjct  1    MKIEVKKWSMVCPAKHTPKHTLWMSNLDSVVPRIHVPTVYLYKPNAFCSNFFDASRLKEA  60

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
                LV   +  +AGRL  +    R++I CN  G  F  A ++  ++D+GD   P+   R
Sbjct  61   LSNALV--QFYPVAGRLGLDANG-RIQINCNGEGVLFQEAEADAIIDDLGDFT-PSHRLR  116

Query  475  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             L+ +          PL  LQVT FKCGG  LG +++H+  DGSG   F+ + + ++
Sbjct  117  HLIPVVDHSAHISSYPLLLLQVTYFKCGGVCLGVAIHHMVADGSGCIHFINSWSDIT  173



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 100/192 (52%), Gaps = 11/192 (6%)
 Frame = +1

Query  40   FWFSCFL-SFTAIMGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVL-N  213
            FW S  L  F    G    +   +  D+ V++ +S ++ P+ ET  H ++ SN+D V+ +
Sbjct  32   FWLSFLLWGFRRTAGRSDTRGNIVWFDMIVSVRESTMVRPAGETRIHALWNSNVDLVVPS  91

Query  214  FDVQTVHFFPASPGFPPEIVAGKI-KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNA  390
                +V+F+   P   P+    K+ K    + LV   +  +AGRL+++ E  R+EI+CNA
Sbjct  92   MHTPSVYFY--RPNGSPDFFDPKVLKEGLSKALVP--FYPMAGRLRRD-EDGRIEIDCNA  146

Query  391  AGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFA  567
             G  F  A +  A++D GD   P    R+L+  + D+ A     PL  LQVT FKCGG +
Sbjct  147  EGVLFVEAETSSAVDDFGDFA-PTLELRKLIP-AVDYSAGLSTYPLLVLQVTYFKCGGVS  204

Query  568  LGTSMNHISFDG  603
            LG  M H   DG
Sbjct  205  LGVGMQHHVADG  216



>ref|NP_001275190.1| feruloyl transferase [Solanum tuberosum]
 gb|ACS70946.1| feruloyl transferase [Solanum tuberosum]
Length=433

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 89/163 (55%), Gaps = 9/163 (6%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P++ET K   +LSN+D+ +   V+T++ F  S     E  A  +K+A  ++LV   Y
Sbjct  21   LVAPAEETEKGQYYLSNLDQNIAVPVRTIYCF-KSEEKGNENAAEVMKDALSKVLVH--Y  77

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  ++E + + ++C+  GA F  A +   +EDIGD   P+P    L  + +D  
Sbjct  78   YPLAGRLTISQEMKLI-VDCSGEGAVFVEAEANCNIEDIGDNTKPDPV--TLGKLVYDIP  134

Query  505  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  624
              +   + P    QVT FKCGGF LG  MNH  FDG G   F+
Sbjct  135  GAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFV  177



>ref|XP_008353756.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=441

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 98/186 (53%), Gaps = 19/186 (10%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKV-LNFDVQTVHFFPASPG--------FPPEI  270
            + V++ +S ++ P++ET K  +++SN+D V L     +V+F+  S          F P +
Sbjct  3    VDVSVRESTIVKPTEETPKQVLWMSNLDLVILGKHTPSVYFYRRSQTGSHQGNSFFDPAV  62

Query  271  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  450
                +K A  + LV   +  LAGRL++N E+ R EI CN  G  F VA +   L+D GD 
Sbjct  63   ----LKRALAKALVP--FYPLAGRLQQN-ETGRSEINCNGEGVLFVVAETTSVLDDFGDF  115

Query  451  VYPNPAFRQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLE  627
              P P FR+L+ +  D+ A     PL  +QVT FKCGG +LG  + H   DG     F+ 
Sbjct  116  A-PTPEFRKLIPV-IDYSAGISTYPLLVVQVTYFKCGGVSLGVGLEHRVADGCSGLHFVN  173

Query  628  NLAALS  645
              + ++
Sbjct  174  TWSDIA  179



>ref|XP_006347627.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Solanum 
tuberosum]
Length=433

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 89/163 (55%), Gaps = 9/163 (6%)
 Frame = +1

Query  145  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  324
            L+ P++ET K   +LSN+D+ +   V+T++ F  S     E  A  +K+A  ++LV   Y
Sbjct  21   LVAPAEETEKGQYYLSNLDQNIAVPVRTIYCF-KSEEKGNENAAEVMKDALSKVLVH--Y  77

Query  325  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  504
              LAGRL  ++E + + ++C+  GA F  A +   +EDIGD   P+P    L  + +D  
Sbjct  78   YPLAGRLTISQEMKLI-VDCSGEGAVFVEAEANCNIEDIGDNTKPDPV--TLGKLVYDIP  134

Query  505  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  624
              +   + P    QVT FKCGGF LG  MNH  FDG G   F+
Sbjct  135  GAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFV  177



>ref|XP_011092043.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=464

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 97/180 (54%), Gaps = 9/180 (5%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDK--VLNFDVQTVHFF--PASPGFPPEIVAGKI  285
            +KV +  S L+ PS+ T    M L+ +D+  VL   V T++F+  P +   P + +   +
Sbjct  3    IKVILNSSCLVQPSERTCNGCMPLTELDQAGVLTH-VPTIYFYRPPQNWLTPKDTIFTTL  61

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            + + RR+LV   +  LAGRL+   +  R+E++CN  GA    A  E  L D+GDL  P+P
Sbjct  62   RTSLRRVLVH--FYPLAGRLRW-LDGARLELDCNGKGAQLIEAHCEATLNDLGDLT-PSP  117

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             FR L+      V  E+ PL  +Q+T F+CGG +L  +++H   DG     F+   A L+
Sbjct  118  HFRYLIPQINYMVPIEEIPLLCVQLTKFRCGGISLSYTISHAVADGQSAFHFISEWARLA  177



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 100/192 (52%), Gaps = 11/192 (6%)
 Frame = +1

Query  40   FWFSCFL-SFTAIMGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVL-N  213
            FW S  L  F    G    +   +  D+ V++ +S ++ P+ ET  H ++ SN+D V+ +
Sbjct  37   FWLSFLLWGFRRTAGRSDTRGNIVWFDMIVSVRESTMVRPAGETRIHALWNSNVDLVVPS  96

Query  214  FDVQTVHFFPASPGFPPEIVAGKI-KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNA  390
                +V+F+   P   P+    K+ K    + LV   +  +AGRL+++ E  R+EI+CNA
Sbjct  97   MHTPSVYFY--RPNGSPDFFDPKVLKEGLSKALVP--FYPMAGRLRRD-EDGRIEIDCNA  151

Query  391  AGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFA  567
             G  F  A +  A++D GD   P    R+L+  + D+ A     PL  LQVT FKCGG +
Sbjct  152  EGVLFVEAETSSAVDDFGDFA-PTLELRKLIP-AVDYSAGLSTYPLLVLQVTYFKCGGVS  209

Query  568  LGTSMNHISFDG  603
            LG  M H   DG
Sbjct  210  LGVGMQHHVADG  221



>ref|XP_007011892.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase, 
putative [Theobroma cacao]
 gb|EOY29511.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase, 
putative [Theobroma cacao]
Length=442

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 97/176 (55%), Gaps = 9/176 (5%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFD-VQTVHFFPASPGFPPEIVAGKIKNA  294
            +++T   S +++P++ET KH ++ SN++ ++    V TV+FF  + G      A  +  A
Sbjct  1    MEITTKKSTMVYPAEETQKHRLWSSNLELLMTLHHVPTVYFFRPN-GSSNFFNAQVLMEA  59

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALED-IGDLVYPNPAF  471
              ++LV   +  +AGRL ++ E  RVEI CNA GA F  A ++  ++D IGD +  +  +
Sbjct  60   LSKVLVP--FYPMAGRLARD-EKGRVEINCNAEGALFVEAETDVVIDDLIGDTIRSSELW  116

Query  472  RQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  636
            R + T+  D+ A     PL  LQVT FKCGG  LG  + H   DG     F+ + A
Sbjct  117  RLVPTV--DYAADISSYPLTLLQVTKFKCGGVCLGIGLQHTLADGPAGIHFINSWA  170



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 94/178 (53%), Gaps = 11/178 (6%)
 Frame = +1

Query  124  VTILDSGLIFPSQETTKHTMFLSNIDK-VLNFDVQTVHFFPA--SPGFPPEIVAGKIKNA  294
            + + +S  + P++ T + T+++SN D+ V    + TV+FF +  S GF        +K A
Sbjct  11   INVKESTTVGPAEPTPERTLWISNADQLVRRAHIPTVYFFTSDGSTGF---FNLHLLKQA  67

Query  295  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  474
              ++LV   +   AGRL +N +  R+EI CN  G  F  A +   ++D GD   P+P  R
Sbjct  68   LSKVLVP--FYPTAGRLNRNDQDGRLEINCNGEGVLFVEAETNSVIDDFGDFT-PSPVLR  124

Query  475  QLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
            QL+  + D+       PL  LQVT F+CGG  LG  M+H   DG+    F+ + + ++
Sbjct  125  QLIP-AVDYSKDISSYPLLLLQVTRFRCGGVCLGVGMHHSLVDGTSDIHFINSWSDMA  181



>ref|NP_001150433.1| LOC100284063 [Zea mays]
 gb|ACG39079.1| anthranilate N-benzoyltransferase protein 1 [Zea mays]
Length=436

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 96/179 (54%), Gaps = 12/179 (7%)
 Frame = +1

Query  121  KVTILDSGLIFPSQETTKHTMFLSNID-KVLNFDVQTVHFFPASPG---FPPEIVAGKIK  288
            +V ++D+ L+ PS+ET +  ++LSN+D  V       V+++PA PG   F P+    +++
Sbjct  4    QVVVVDTALVAPSEETPRQPLWLSNLDLAVPRTHTPLVYYYPA-PGTGSFAPD----RLR  58

Query  289  NAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA  468
             A    LV   +  LAGRL    +  R++IECN+ GA F VA+++    D+ D   P+  
Sbjct  59   AALGAALV--PFYPLAGRLGVGPDG-RLQIECNSKGALFVVANADLTGADVFDDYEPSSE  115

Query  469  FRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
             R       +     + P+   QVT  KCGG  LGT+++H + DG G   F++  + ++
Sbjct  116  IRNTFVPLGESGEANNSPISMFQVTFLKCGGVVLGTAIHHAAMDGVGAFQFMQTWSGVA  174



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 96/180 (53%), Gaps = 12/180 (7%)
 Frame = +1

Query  118  LKVTILDSGLIFPSQETTKHTMFLSNIDKVL-NFDVQTVHFFPASPG---FPPEIVAGKI  285
            +K+ + +S L+ P+  T   T++ SN+D V+ N  + TV+F+  +     F P +    +
Sbjct  1    MKIYVKESALVLPAAVTPCVTLWNSNVDLVVCNIHIPTVYFYGPTGAVNFFDPAV----L  56

Query  286  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  465
            K A  R LV   +  +AGRLK++K+  R+EI+CNA G  F  A S+  ++D GD   P  
Sbjct  57   KAALGRALVP--FYPVAGRLKRDKDG-RIEIDCNAEGVLFVEAESDAVVDDFGDFA-PTL  112

Query  466  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  645
              R+L+            PL  LQVT FKCGG +LG  ++HI  DG     F+   + ++
Sbjct  113  ELRRLIPPVDYSQGISTFPLVVLQVTRFKCGGVSLGVGIHHIVADGLSALHFINTWSDMA  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000