BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024M07

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    336   9e-110   Solanum lycopersicum
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    335   1e-109   Solanum tuberosum [potatoes]
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    331   8e-108   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP13207.1|  unnamed protein product                                330   1e-107   Coffea canephora [robusta coffee]
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    330   1e-107   Nicotiana tomentosiformis
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    330   2e-107   Nicotiana sylvestris
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    328   7e-107   Nicotiana sylvestris
gb|EPS68501.1|  hypothetical protein M569_06265                         328   8e-107   Genlisea aurea
ref|XP_006416098.1|  hypothetical protein EUTSA_v10007514mg             323   1e-106   
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    327   2e-106   
ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    327   2e-106   Nicotiana tomentosiformis
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                327   3e-106   Erythranthe guttata [common monkey flower]
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    326   4e-106   Solanum lycopersicum
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    326   6e-106   Tarenaya hassleriana [spider flower]
emb|CAN62302.1|  hypothetical protein VITISV_023686                     325   1e-105   Vitis vinifera
ref|NP_001268094.1|  uncharacterized protein LOC100261274               325   1e-105   Vitis vinifera
emb|CBI23368.3|  unnamed protein product                                325   1e-105   Vitis vinifera
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    325   1e-105   Brassica rapa
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              323   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             324   2e-105   Capsella rubella
gb|AAZ43368.1|  AlaT1                                                   324   3e-105   Vitis labrusca [Concord grape]
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             324   3e-105   
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    324   3e-105   Camelina sativa [gold-of-pleasure]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 324   3e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             324   3e-105   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20108.1|  AT1G70580                                              324   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              324   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          323   5e-105   
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    323   7e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    323   7e-105   Camelina sativa [gold-of-pleasure]
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             323   9e-105   
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    322   1e-104   
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    323   1e-104   Gossypium arboreum [tree cotton]
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          322   1e-104   Arabidopsis lyrata subsp. lyrata
gb|AAL24255.1|  At1g23310/F26F24_4                                      322   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    322   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    322   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006438273.1|  hypothetical protein CICLE_v10031381mg             319   2e-104   
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    322   3e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB31174.1|  hypothetical protein B456_005G179600                    318   3e-104   Gossypium raimondii
ref|XP_002527918.1|  alanine aminotransferase, putative                 320   4e-104   
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    321   4e-104   Eucalyptus grandis [rose gum]
emb|CDY61225.1|  BnaC06g43710D                                          321   4e-104   Brassica napus [oilseed rape]
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    321   5e-104   Brassica rapa
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             321   5e-104   
emb|CDY41452.1|  BnaA08g20540D                                          321   6e-104   Brassica napus [oilseed rape]
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    321   6e-104   Camelina sativa [gold-of-pleasure]
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    320   6e-104   Brassica rapa
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           321   6e-104   Morus notabilis
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    321   7e-104   
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    320   8e-104   Nelumbo nucifera [Indian lotus]
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    320   9e-104   Cicer arietinum [garbanzo]
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    320   9e-104   Brassica rapa
ref|XP_006378236.1|  hypothetical protein POPTR_0010s05530g             315   9e-104   
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    320   1e-103   
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    320   1e-103   
emb|CDY66294.1|  BnaAnng22050D                                          320   1e-103   Brassica napus [oilseed rape]
gb|AAM61453.1|  putative alanine aminotransferase                       320   2e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KJB31170.1|  hypothetical protein B456_005G179600                    319   2e-103   Gossypium raimondii
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             319   2e-103   Citrus clementina [clementine]
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    319   2e-103   Elaeis guineensis
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    318   8e-103   Malus domestica [apple tree]
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    318   9e-103   Pyrus x bretschneideri [bai li]
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    318   9e-103   Prunus mume [ume]
ref|XP_004955316.1|  PREDICTED: glutamate--glyoxylate aminotransf...    319   1e-102   
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    317   1e-102   
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    317   2e-102   Setaria italica
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         317   2e-102   Jatropha curcas
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          316   3e-102   Amborella trichopoda
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    317   4e-102   
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             316   4e-102   Populus trichocarpa [western balsam poplar]
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             316   4e-102   Prunus persica
ref|NP_001237567.1|  alanine aminotransferase 2                         315   7e-102   
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    315   7e-102   Glycine max [soybeans]
ref|NP_001058716.1|  Os07g0108300                                       315   7e-102   
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                315   7e-102   Glycine soja [wild soybean]
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    315   1e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    315   1e-101   Brachypodium distachyon [annual false brome]
gb|AET06145.1|  PLP-dependent aminotransferase                          314   2e-101   Papaver somniferum
ref|XP_003613140.1|  Alanine aminotransferase                           314   2e-101   
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    314   2e-101   Fragaria vesca subsp. vesca
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             314   2e-101   Phaseolus vulgaris [French bean]
ref|XP_003613139.1|  Alanine aminotransferase                           314   2e-101   Medicago truncatula
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    314   3e-101   Elaeis guineensis
gb|AAO84040.1|  alanine aminotransferase                                314   3e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    313   4e-101   Populus trichocarpa [western balsam poplar]
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    313   5e-101   Populus euphratica
ref|NP_001151209.1|  alanine aminotransferase 2                         313   5e-101   
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    311   2e-100   
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       310   7e-100   
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    310   7e-100   
gb|KJB31175.1|  hypothetical protein B456_005G179600                    310   1e-99    Gossypium raimondii
gb|EMT29455.1|  Alanine aminotransferase 2                              310   2e-99    
ref|NP_001237581.1|  alanine aminotransferase 3                         309   2e-99    Glycine max [soybeans]
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    308   3e-99    Cucumis melo [Oriental melon]
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       308   3e-99    
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    308   4e-99    
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    306   5e-98    Brassica rapa
ref|NP_001183048.1|  uncharacterized protein LOC100501386               305   1e-97    Zea mays [maize]
gb|EMS58349.1|  Alanine aminotransferase 2                              304   2e-97    Triticum urartu
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              303   4e-97    
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    303   4e-97    
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             302   1e-96    Selaginella moellendorffii
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    301   2e-96    Cucumis sativus [cucumbers]
gb|ABK25444.1|  unknown                                                 301   2e-96    Picea sitchensis
ref|XP_001782822.1|  predicted protein                                  296   2e-94    
ref|XP_001777071.1|  predicted protein                                  293   2e-93    
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   289   7e-92    Citrus sinensis [apfelsine]
ref|XP_001763950.1|  predicted protein                                  290   7e-92    
emb|CDY12474.1|  BnaC07g13140D                                          271   4e-84    Brassica napus [oilseed rape]
ref|XP_002947519.1|  alanine aminotransferase                           239   5e-72    Volvox carteri f. nagariensis
ref|XP_005651940.1|  alanine aminotransferase                           238   1e-71    Coccomyxa subellipsoidea C-169
ref|XP_008446998.1|  PREDICTED: glutamate--glyoxylate aminotransf...    229   2e-71    
gb|KIZ04988.1|  alanine transaminase                                    229   3e-71    Monoraphidium neglectum
ref|XP_001698518.1|  alanine aminotransferase                           236   6e-71    Chlamydomonas reinhardtii
gb|AAB01685.1|  alanine aminotransferase                                236   7e-71    Chlamydomonas reinhardtii
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    227   3e-69    
emb|CBJ25743.1|  nicotinanamine aminotransferase A                      228   6e-68    Ectocarpus siliculosus
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               218   4e-63    Nannochloropsis gaditana
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929              208   6e-60    Chlorella variabilis
gb|KIZ07569.1|  alanine transaminase                                    208   3e-59    Monoraphidium neglectum
ref|XP_004992298.1|  alanine aminotransferase                           201   7e-58    Salpingoeca rosetta
gb|KIY95165.1|  alanine transaminase                                    191   1e-56    Monoraphidium neglectum
ref|XP_001745052.1|  hypothetical protein                               194   3e-55    Monosiga brevicollis MX1
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...    192   2e-54    Auxenochlorella protothecoides
gb|KDD76740.1|  aminotransferase                                        188   8e-53    Helicosporidium sp. ATCC 50920
ref|WP_026853156.1|  aminotransferase class I/II                        185   6e-52    Geothrix fermentans
ref|XP_003291733.1|  alanine transaminase                               185   3e-51    Dictyostelium purpureum
ref|XP_007510961.1|  predicted protein                                  183   6e-51    Bathycoccus prasinos
ref|XP_002175263.1|  alanine aminotransferase                           183   7e-51    Schizosaccharomyces japonicus yFS275
ref|XP_005648726.1|  alanine aminotransferase 2                         183   1e-50    Coccomyxa subellipsoidea C-169
ref|WP_005033524.1|  aminotransferase class I/II                        181   3e-50    Holophaga foetida
ref|XP_637993.1|  alanine transaminase                                  182   4e-50    Dictyostelium discoideum AX4
emb|CDX91708.1|  BnaC08g06270D                                          176   4e-49    
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like         179   6e-49    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY25780.1|  BnaA07g10020D                                          174   2e-48    Brassica napus [oilseed rape]
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...    176   2e-48    Hordeum vulgare [barley]
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...    176   4e-48    Hordeum vulgare [barley]
ref|XP_008869166.1|  hypothetical protein H310_06043                    175   6e-48    Aphanomyces invadans
ref|XP_005825112.1|  hypothetical protein GUITHDRAFT_77426              175   6e-48    Guillardia theta CCMP2712
ref|XP_010261672.1|  PREDICTED: alanine aminotransferase 2-like         176   6e-48    Nelumbo nucifera [Indian lotus]
ref|XP_007409910.1|  hypothetical protein MELLADRAFT_43385              175   6e-48    Melampsora larici-populina 98AG31
ref|XP_011048627.1|  PREDICTED: alanine aminotransferase 2, mitoc...    174   8e-48    Populus euphratica
gb|EFA80185.1|  alanine transaminase                                    176   1e-47    Heterostelium album PN500
ref|XP_008460349.1|  PREDICTED: alanine aminotransferase 1, mitoc...    172   2e-47    Cucumis melo [Oriental melon]
ref|XP_004362319.1|  alanine transaminase                               174   4e-47    Cavenderia fasciculata
ref|XP_002176328.1|  predicted protein                                  172   5e-47    Phaeodactylum tricornutum CCAP 1055/1
dbj|GAM23260.1|  hypothetical protein SAMD00019534_064350               173   6e-47    Acytostelium subglobosum LB1
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...    173   6e-47    Elaeis guineensis
dbj|GAA97564.1|  hypothetical protein E5Q_04242                         174   7e-47    Mixia osmundae IAM 14324
ref|XP_009826737.1|  hypothetical protein H257_04062                    172   7e-47    Aphanomyces astaci
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like         173   8e-47    Sesamum indicum [beniseed]
ref|XP_008620886.1|  alanine transaminase                               171   1e-46    Saprolegnia diclina VS20
ref|XP_002946490.1|  hypothetical protein VOLCADRAFT_120326             174   1e-46    Volvox carteri f. nagariensis
gb|KIZ01751.1|  alanine transaminase                                    168   2e-46    Monoraphidium neglectum
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...    172   2e-46    Cucumis melo [Oriental melon]
emb|CEG81302.1|  Putative Alanine transaminase                          165   2e-46    Rhizopus microsporus
gb|ETM43767.1|  hypothetical protein L914_10885                         165   2e-46    Phytophthora parasitica
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like         171   3e-46    
gb|KDO53769.1|  hypothetical protein CISIN_1g009517mg                   168   3e-46    Citrus sinensis [apfelsine]
ref|XP_002304255.2|  hypothetical protein POPTR_0003s07020g             170   4e-46    
gb|KDO24164.1|  hypothetical protein SPRG_10592                         170   4e-46    Saprolegnia parasitica CBS 223.65
ref|XP_005775483.1|  alanine aminotransferase                           171   4e-46    Emiliania huxleyi CCMP1516
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like         170   5e-46    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382959.1|  PREDICTED: alanine aminotransferase 2              171   5e-46    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2              171   5e-46    Sesamum indicum [beniseed]
ref|XP_005833147.1|  hypothetical protein GUITHDRAFT_157749             169   6e-46    Guillardia theta CCMP2712
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...    170   8e-46    
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2              170   8e-46    Phoenix dactylifera
gb|KGN58474.1|  hypothetical protein Csa_3G646610                       170   8e-46    Cucumis sativus [cucumbers]
emb|CDO97792.1|  unnamed protein product                                169   9e-46    Coffea canephora [robusta coffee]
ref|XP_010917381.1|  PREDICTED: alanine aminotransferase 2-like i...    169   9e-46    Elaeis guineensis
ref|XP_010917380.1|  PREDICTED: alanine aminotransferase 2-like i...    169   9e-46    Elaeis guineensis
gb|KFH67262.1|  alanine transaminase                                    170   1e-45    Mortierella verticillata NRRL 6337
ref|XP_006680648.1|  hypothetical protein BATDEDRAFT_20287              169   1e-45    Batrachochytrium dendrobatidis JAM81
ref|XP_003573850.1|  PREDICTED: alanine aminotransferase 2              169   1e-45    Brachypodium distachyon [annual false brome]
ref|XP_005838227.1|  hypothetical protein GUITHDRAFT_103164             169   1e-45    Guillardia theta CCMP2712
tpg|DAA59363.1|  TPA: putative MATE efflux family protein isoform 1     167   1e-45    
ref|XP_010917379.1|  PREDICTED: alanine aminotransferase 2-like i...    169   1e-45    Elaeis guineensis
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like         169   1e-45    Phoenix dactylifera
gb|EPZ32571.1|  Aminotransferase, class I/classII domain-containi...    164   2e-45    Rozella allomycis CSF55
gb|KDO53768.1|  hypothetical protein CISIN_1g009517mg                   167   2e-45    Citrus sinensis [apfelsine]
ref|WP_012096788.1|  aminotransferase class I/II                        168   2e-45    Anaeromyxobacter sp. Fw109-5
ref|XP_010917378.1|  PREDICTED: alanine aminotransferase 2-like i...    169   2e-45    Elaeis guineensis
ref|XP_011127540.1|  hypothetical protein AOL_s00215g36                 168   2e-45    Arthrobotrys oligospora ATCC 24927
gb|ETM43759.1|  hypothetical protein L914_10880                         162   2e-45    Phytophthora parasitica
ref|XP_002906656.1|  alanine aminotransferase 2                         168   2e-45    Phytophthora infestans T30-4
ref|XP_010273809.1|  PREDICTED: alanine aminotransferase 2-like         169   2e-45    Nelumbo nucifera [Indian lotus]
gb|AGT60040.1|  aminotransferase                                        167   3e-45    uncultured bacterium
dbj|GAN09782.1|  alanine transaminase                                   168   3e-45    Mucor ambiguus
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2              169   3e-45    Elaeis guineensis
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...    169   3e-45    Cicer arietinum [garbanzo]
ref|XP_004241856.1|  PREDICTED: alanine aminotransferase 2-like         169   3e-45    Solanum lycopersicum
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...    168   3e-45    Cucumis melo [Oriental melon]
ref|XP_011109633.1|  hypothetical protein H072_3664                     168   3e-45    
gb|AIT69927.1|  alanine transaminase                                    168   3e-45    Saccharina japonica
gb|AIT69925.1|  alanine transaminase                                    168   4e-45    Saccharina sculpera
ref|NP_001237553.1|  alanine aminotransferase 1                         167   4e-45    
ref|XP_009783410.1|  PREDICTED: alanine aminotransferase 2, mitoc...    168   4e-45    Nicotiana sylvestris
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg             168   5e-45    
sp|P34106.1|ALA2_PANMI  RecName: Full=Alanine aminotransferase 2;...    167   5e-45    Panicum miliaceum [broom millet]
ref|XP_010318453.1|  PREDICTED: alanine aminotransferase 2, mitoc...    167   5e-45    Solanum lycopersicum
ref|XP_011036545.1|  PREDICTED: alanine aminotransferase 2-like         168   5e-45    Populus euphratica
ref|XP_002906651.1|  alanine aminotransferase 2                         167   6e-45    Phytophthora infestans T30-4
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...    167   6e-45    
ref|XP_008654837.1|  PREDICTED: uncharacterized protein LOC100193...    167   6e-45    
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...    167   6e-45    Cucumis sativus [cucumbers]
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...    167   6e-45    Solanum tuberosum [potatoes]
ref|XP_006369083.1|  alanine aminotransferas family protein             167   6e-45    Populus trichocarpa [western balsam poplar]
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                   167   7e-45    Citrus sinensis [apfelsine]
gb|EJK48082.1|  hypothetical protein THAOC_33157                        168   7e-45    Thalassiosira oceanica
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg             167   7e-45    Citrus clementina [clementine]
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...    167   7e-45    
gb|EMT23015.1|  Alanine aminotransferase 2                              167   7e-45    
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...    167   7e-45    Citrus sinensis [apfelsine]
gb|AIT69928.1|  alanine transaminase                                    167   7e-45    Scytosiphon dotyi
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg             167   7e-45    Prunus persica
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...    167   7e-45    Solanum lycopersicum
ref|XP_009627254.1|  PREDICTED: alanine aminotransferase 2-like         167   7e-45    Nicotiana tomentosiformis
gb|AIT69918.1|  alanine transaminase                                    167   7e-45    Desmarestia viridis
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...    167   8e-45    Cucumis melo [Oriental melon]
ref|XP_003528736.1|  PREDICTED: alanine aminotransferase 2, mitoc...    167   8e-45    Glycine max [soybeans]
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2              167   8e-45    Fragaria vesca subsp. vesca
emb|CDS05712.1|  hypothetical protein LRAMOSA08240                      167   8e-45    Lichtheimia ramosa
ref|XP_001769989.1|  predicted protein                                  167   8e-45    
gb|EPB88721.1|  alanine transaminase                                    167   9e-45    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_004983099.1|  PREDICTED: alanine aminotransferase 2-like         166   9e-45    Setaria italica
ref|XP_010029516.1|  PREDICTED: alanine aminotransferase 2-like         167   1e-44    Eucalyptus grandis [rose gum]
gb|EWC46913.1|  hypothetical protein DRE_03925                          166   1e-44    Drechslerella stenobrocha 248
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial               167   1e-44    Glycine soja [wild soybean]
gb|ETO72417.1|  hypothetical protein F444_11427                         162   1e-44    Phytophthora parasitica P1976
ref|XP_006357426.1|  PREDICTED: alanine aminotransferase 2, mitoc...    167   1e-44    Solanum tuberosum [potatoes]
gb|EPS60556.1|  hypothetical protein M569_14246                         166   1e-44    Genlisea aurea
ref|XP_010537653.1|  PREDICTED: alanine aminotransferase 2, mitoc...    167   2e-44    Tarenaya hassleriana [spider flower]
ref|XP_008380735.1|  PREDICTED: alanine aminotransferase 2              167   2e-44    Malus domestica [apple tree]
gb|KEQ94204.1|  hypothetical protein AUEXF2481DRAFT_41383               167   2e-44    Aureobasidium subglaciale EXF-2481
emb|CBI35796.3|  unnamed protein product                                166   2e-44    Vitis vinifera
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...    166   2e-44    Prunus mume [ume]
gb|EEE67593.1|  hypothetical protein OsJ_25140                          166   2e-44    Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                          166   2e-44    Oryza sativa Indica Group [Indian rice]
gb|EMS19811.1|  1-aminocyclopropane-1-carboxylate synthase              166   2e-44    Rhodotorula toruloides NP11
gb|KJB57088.1|  hypothetical protein B456_009G147700                    166   2e-44    Gossypium raimondii
gb|AIT69920.1|  alanine transaminase                                    166   2e-44    Scytosiphon lomentaria
ref|XP_002265294.2|  PREDICTED: alanine aminotransferase 2              166   2e-44    Vitis vinifera
ref|XP_010939849.1|  PREDICTED: alanine aminotransferase 2 isofor...    165   3e-44    Elaeis guineensis
gb|AAC62456.1|  alanine aminotransferase                                165   3e-44    Zea mays [maize]
gb|AFW68850.1|  alanine aminotransferase                                165   3e-44    
emb|CEI91975.1|  Putative Alanine transaminase                          165   3e-44    Rhizopus microsporus
gb|ACJ85860.1|  unknown                                                 166   3e-44    Medicago truncatula
gb|AFK39904.1|  unknown                                                 166   3e-44    Medicago truncatula
gb|AAR05449.1|  alanine aminotransferase                                165   3e-44    Capsicum annuum
ref|XP_003627448.1|  Alanine aminotransferase                           166   3e-44    Medicago truncatula
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...    166   3e-44    Solanum tuberosum [potatoes]
gb|KJB57091.1|  hypothetical protein B456_009G147700                    166   4e-44    Gossypium raimondii
ref|XP_010096539.1|  Alanine aminotransferase 2                         166   4e-44    Morus notabilis
ref|NP_001149227.1|  LOC100282849                                       165   4e-44    
gb|KJB57090.1|  hypothetical protein B456_009G147700                    166   4e-44    Gossypium raimondii
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like         166   5e-44    
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...    164   5e-44    Oryza brachyantha
gb|AIT69923.1|  alanine transaminase                                    164   6e-44    Dictyopteris undulata
ref|XP_009798100.1|  PREDICTED: alanine aminotransferase 2-like         165   6e-44    Nicotiana sylvestris
gb|EYU21272.1|  hypothetical protein MIMGU_mgv1a003837mg                165   6e-44    Erythranthe guttata [common monkey flower]
gb|AIT69937.1|  alanine transaminase                                    165   6e-44    Gracilariopsis lemaneiformis
ref|XP_005840936.1|  hypothetical protein GUITHDRAFT_159157             164   6e-44    Guillardia theta CCMP2712
ref|XP_006661735.1|  PREDICTED: alanine aminotransferase 2-like         164   7e-44    Oryza brachyantha
gb|KEQ61418.1|  PLP-dependent transferase                               164   7e-44    Aureobasidium melanogenum CBS 110374
ref|XP_659527.1|  hypothetical protein AN1923.2                         164   7e-44    Aspergillus nidulans FGSC A4
emb|CDY48485.1|  BnaC05g13450D                                          165   7e-44    Brassica napus [oilseed rape]
gb|AIT69929.1|  alanine transaminase                                    164   7e-44    Petalonia fascia
gb|EGU11111.1|  putative Alanine aminotransferase                       164   8e-44    Rhodotorula toruloides ATCC 204091
gb|ETI43749.1|  hypothetical protein F443_11362                         164   8e-44    Phytophthora parasitica P1569
emb|CEG77871.1|  Putative Alanine transaminase                          158   9e-44    Rhizopus microsporus
ref|XP_009149177.1|  PREDICTED: alanine aminotransferase 1, mitoc...    164   9e-44    Brassica rapa
gb|ETP13560.1|  hypothetical protein F441_11279                         164   9e-44    Phytophthora parasitica CJ01A1
ref|XP_004166923.1|  PREDICTED: alanine aminotransferase 2, mitoc...    164   1e-43    
gb|KHG05613.1|  Alanine aminotransferase 2, mitochondrial -like p...    164   1e-43    Gossypium arboreum [tree cotton]
gb|KFH70378.1|  alanine transaminase                                    164   1e-43    Mortierella verticillata NRRL 6337
tpe|CBF85834.1|  TPA: alanine transaminase (Eurofung)                   164   1e-43    Aspergillus nidulans FGSC A4
gb|KDP40629.1|  hypothetical protein JCGZ_24628                         164   1e-43    Jatropha curcas
gb|ETP41623.1|  hypothetical protein F442_11247                         164   1e-43    
ref|XP_008907369.1|  hypothetical protein PPTG_13440                    164   1e-43    
gb|EIE79350.1|  hypothetical protein RO3G_04055                         163   1e-43    
gb|KEQ80043.1|  PLP-dependent transferase                               164   1e-43    
gb|KDE04574.1|  hypothetical protein MVLG_05042                         164   1e-43    
gb|EIE90509.1|  hypothetical protein RO3G_15220                         163   1e-43    
ref|NP_001064504.1|  Os10g0390500                                       163   1e-43    
ref|XP_006416720.1|  hypothetical protein EUTSA_v10007290mg             164   1e-43    
emb|CEG73189.1|  Putative Alanine transaminase                          163   1e-43    
ref|XP_003646187.1|  hypothetical protein Ecym_4307                     164   2e-43    
gb|EJK50290.1|  hypothetical protein THAOC_30762                        164   2e-43    
ref|XP_009515719.1|  hypothetical protein PHYSODRAFT_477603             163   2e-43    
ref|NP_986750.1|  AGR085Wp                                              163   2e-43    
ref|XP_455940.1|  hypothetical protein                                  163   2e-43    
gb|AEY98906.1|  FAGR085Wp                                               163   2e-43    
gb|KEQ74308.1|  PLP-dependent transferase                               163   2e-43    
ref|XP_007921271.1|  hypothetical protein MYCFIDRAFT_125681             163   2e-43    
ref|XP_007135364.1|  hypothetical protein PHAVU_010G123200g             163   3e-43    
emb|CAY81325.1|  Alt1p                                                  164   3e-43    
ref|XP_006649511.1|  PREDICTED: alanine aminotransferase 2-like         162   3e-43    
ref|XP_007024768.1|  Alanine aminotransferase 2                         163   3e-43    
gb|KHG30536.1|  Alanine aminotransferase 2, mitochondrial -like p...    162   3e-43    
emb|CDO96247.1|  unnamed protein product                                163   3e-43    
gb|AIT69914.1|  alanine transaminase                                    162   3e-43    
emb|CDY26256.1|  BnaA06g11610D                                          163   3e-43    
gb|AIT69922.1|  alanine transaminase                                    162   3e-43    
emb|CEG76882.1|  Putative Alanine transaminase                          162   4e-43    
emb|CDX83914.1|  BnaC08g17310D                                          162   4e-43    
ref|XP_009110415.1|  PREDICTED: alanine aminotransferase 1, mitoc...    162   5e-43    
emb|CEI89078.1|  Putative Alanine transaminase                          162   5e-43    
gb|KIH88204.1|  alanine transaminase                                    162   5e-43    
gb|KIJ33545.1|  hypothetical protein M422DRAFT_35465                    162   5e-43    
gb|AIT69919.1|  alanine transaminase                                    162   5e-43    
ref|XP_009606549.1|  PREDICTED: alanine aminotransferase 2              162   6e-43    
emb|CEG73119.1|  Putative Alanine transaminase                          162   6e-43    
gb|ERT01918.1|  hypothetical protein HMPREF1624_00213                   162   6e-43    
emb|CEI89079.1|  Putative Alanine transaminase                          162   6e-43    
ref|XP_008903570.1|  hypothetical protein PPTG_10079                    162   6e-43    
gb|AIT69916.1|  alanine transaminase                                    162   6e-43    
emb|CEG73120.1|  Putative Alanine transaminase                          162   6e-43    
gb|EMS46317.1|  Alanine aminotransferase 2                              162   6e-43    
gb|EGA81832.1|  Alt1p                                                   162   7e-43    
gb|AAF82782.1|AF275372_1  alanine aminotransferase                      162   7e-43    
gb|EQB43892.1|  aminotransferase class I and II                         161   7e-43    
gb|AAK64147.2|  putative alanine aminotransferase                       162   7e-43    
ref|NP_173173.3|  alanine aminotransferase                              162   7e-43    
gb|EIW08706.1|  Alt1p                                                   162   7e-43    
emb|CDX96776.1|  BnaA08g23190D                                          162   8e-43    
gb|EPX73451.1|  alanine aminotransferase                                162   8e-43    
gb|EMF16555.1|  PLP-dependent transferase                               161   8e-43    
gb|AIT69926.1|  alanine transaminase                                    161   8e-43    
ref|NP_013190.1|  alanine transaminase ALT1                             162   8e-43    
ref|XP_002557770.1|  Pc12g09430                                         162   8e-43    
gb|ETI43741.1|  hypothetical protein F443_11357                         161   9e-43    
ref|XP_009495905.1|  alanine transaminase                               162   9e-43    
gb|EIE85592.1|  hypothetical protein RO3G_10302                         161   9e-43    
emb|CEI94294.1|  Putative Alanine transaminase                          161   1e-42    
gb|EGA61365.1|  Alt1p                                                   162   1e-42    
gb|ETL90462.1|  hypothetical protein L917_10858                         154   1e-42    
ref|XP_004342401.1|  alanine aminotransferase, mitochondrial, put...    161   1e-42    
gb|ETP13552.1|  hypothetical protein F441_11274                         161   1e-42    
ref|XP_010476874.1|  PREDICTED: alanine aminotransferase 1, mitoc...    162   1e-42    
gb|ESA18192.1|  hypothetical protein GLOINDRAFT_334935                  161   1e-42    
ref|XP_007876868.1|  hypothetical protein PFL1_01174                    162   1e-42    
gb|EGA77892.1|  Alt1p                                                   162   1e-42    
gb|AIT69945.1|  alanine transaminase                                    161   1e-42    
gb|EGA85809.1|  Alt1p                                                   161   1e-42    
gb|EYU45916.1|  hypothetical protein MIMGU_mgv1a005454mg                160   1e-42    
ref|XP_002890217.1|  alanine aminotransferase                           161   1e-42    
ref|XP_006307188.1|  hypothetical protein CARUB_v10008780mg             161   1e-42    
emb|CBJ31990.1|  Alanine transaminase                                   161   1e-42    
emb|CBK25308.2|  unnamed protein product                                161   1e-42    
gb|KJB57089.1|  hypothetical protein B456_009G147700                    161   1e-42    
gb|ADB91976.1|  alanine aminotransferase                                160   2e-42    
dbj|GAD97541.1|  alanine aminotransferase                               160   2e-42    
emb|CDX81815.1|  BnaC08g37860D                                          161   2e-42    
gb|EXX69945.1|  alanine transaminase ALT1                               161   2e-42    
ref|XP_009117710.1|  PREDICTED: alanine aminotransferase 1, mitoc...    161   2e-42    
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2              161   2e-42    
emb|CDY21752.1|  BnaA09g45030D                                          161   2e-42    
gb|AIT69924.1|  alanine transaminase                                    160   2e-42    
gb|EST07984.1|  alanine aminotransferase                                160   2e-42    
ref|XP_004959833.1|  PREDICTED: alanine aminotransferase 2, mitoc...    160   2e-42    
ref|XP_001622550.1|  hypothetical protein NEMVEDRAFT_v1g236165          160   2e-42    
ref|XP_011104474.1|  alt1p                                              161   2e-42    
gb|AIT69921.1|  alanine transaminase                                    160   2e-42    
ref|XP_001744315.1|  hypothetical protein                               160   3e-42    
gb|EZF11507.1|  hypothetical protein H100_07427                         159   3e-42    
ref|XP_003852961.1|  hypothetical protein MYCGRDRAFT_92510              160   3e-42    
ref|XP_003682412.1|  hypothetical protein TDEL_0F03900                  160   3e-42    
ref|XP_007275927.1|  alanine aminotransferase                           160   3e-42    
ref|XP_003177413.1|  alanine aminotransferase 2                         159   3e-42    
gb|EME49123.1|  hypothetical protein DOTSEDRAFT_118712                  160   3e-42    
ref|XP_001802664.1|  hypothetical protein SNOG_12441                    159   3e-42    
emb|CEG68596.1|  Putative Alanine transaminase                          160   3e-42    
gb|AET06148.1|  PLP-dependent aminotransferase                          159   3e-42    
ref|XP_009550730.1|  hypothetical protein HETIRDRAFT_388676             159   3e-42    
gb|KFK43924.1|  hypothetical protein AALP_AA1G191800                    160   3e-42    
emb|CEI95237.1|  Putative Alanine transaminase                          160   4e-42    
gb|AIT69930.1|  alanine transaminase                                    160   4e-42    
gb|AIT69931.1|  alanine transaminase                                    160   4e-42    
dbj|GAC74212.1|  alanine aminotransferase                               160   4e-42    
gb|EZF29412.1|  hypothetical protein H101_06912                         159   4e-42    
ref|XP_007418305.1|  hypothetical protein MELLADRAFT_95696              159   4e-42    
gb|KGO69166.1|  Pyridoxal phosphate-dependent transferase, major ...    160   4e-42    
gb|EGD96819.1|  alanine aminotransferase                                159   5e-42    
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2              160   5e-42    
gb|KII91504.1|  hypothetical protein PLICRDRAFT_51647                   159   5e-42    
gb|EGE04493.1|  alanine aminotransferase                                159   5e-42    
gb|EZF70245.1|  hypothetical protein H105_07420                         158   5e-42    
ref|XP_010459304.1|  PREDICTED: alanine aminotransferase 1, mitoc...    160   5e-42    
ref|XP_010498073.1|  PREDICTED: alanine aminotransferase 1, mitoc...    160   5e-42    
gb|AFH41841.1|  1-aminocyclopropane-1-carboxylate synthase 2            159   5e-42    
ref|XP_006455367.1|  hypothetical protein AGABI2DRAFT_138566            159   6e-42    
emb|CCF52154.1|  probable alt1-alanine aminotransferase                 160   6e-42    
gb|EGA57796.1|  Alt1p                                                   160   6e-42    
gb|AAK52114.1|AC079936_10  Putative alanine aminotransferase            159   6e-42    
ref|XP_003022157.1|  hypothetical protein TRV_03717                     159   6e-42    
emb|CEP09944.1|  hypothetical protein                                   159   6e-42    
ref|XP_007595708.1|  aminotransferase class I and II                    159   7e-42    
gb|KFV83100.1|  Alanine aminotransferase 2                              159   7e-42    
ref|XP_003326532.2|  alanine transaminase                               159   7e-42    
emb|CCU82630.1|  alanine aminotransferase                               159   8e-42    
dbj|BAC79866.1|  putative alanine aminotransferase                      159   8e-42    
gb|AIT69940.1|  alanine transaminase                                    159   8e-42    
dbj|GAN07970.1|  alanine transaminase                                   159   8e-42    
ref|XP_011320325.1|  hypothetical protein FGSG_08443                    158   8e-42    
ref|XP_003238011.1|  alanine aminotransferase                           158   8e-42    
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340          159   9e-42    
ref|XP_009216889.1|  hypothetical protein GGTG_00873                    158   9e-42    
emb|CBQ68350.1|  probable alt1-alanine aminotransferase                 159   1e-41    
ref|XP_007673116.1|  hypothetical protein BAUCODRAFT_63743              159   1e-41    
gb|AGO13948.1|  AaceriAGR085Wp                                          159   1e-41    
emb|CDI54471.1|  probable alt1-alanine aminotransferase (C-termin...    159   1e-41    
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2              159   1e-41    
ref|XP_009650728.1|  alanine aminotransferase                           158   1e-41    
gb|EMT05433.1|  Alanine aminotransferase 2                              158   1e-41    
dbj|BAP71656.1|  probable alanine aminotransferase                      159   1e-41    
ref|XP_004664888.1|  PREDICTED: alanine aminotransferase 2              158   1e-41    
ref|XP_005852218.1|  hypothetical protein CHLNCDRAFT_29318              158   1e-41    
ref|XP_009257052.1|  hypothetical protein FPSE_05659                    158   1e-41    
gb|KJA14567.1|  hypothetical protein HYPSUDRAFT_208608                  158   1e-41    
dbj|GAK66048.1|  PLP-dependent transferase                              159   1e-41    
gb|KFY66487.1|  hypothetical protein V496_02058                         159   1e-41    
gb|KDR12685.1|  Alanine aminotransferase 2                              159   1e-41    
ref|XP_002392061.1|  hypothetical protein MPER_08419                    150   1e-41    
dbj|BAO40163.1|  probable alanine aminotransferase                      159   1e-41    
gb|EPQ67854.1|  alanine transaminase                                    159   1e-41    
gb|AGT02519.1|  alanine transaminase                                    158   2e-41    
ref|XP_003010818.1|  hypothetical protein ARB_02969                     159   2e-41    
ref|XP_002430266.1|  Alanine aminotransferase, putative                 157   2e-41    
ref|XP_007869834.1|  PLP-dependent transferase                          157   2e-41    
gb|EPB83565.1|  alanine transaminase                                    157   2e-41    
gb|AAF79891.1|AC026479_3  Strong similarity to alanine aminotrans...    157   2e-41    
ref|XP_003001709.1|  alanine aminotransferase                           156   2e-41    
emb|CCM05382.1|  predicted protein                                      157   2e-41    
ref|XP_009515714.1|  hypothetical protein PHYSODRAFT_476244             157   2e-41    
emb|CDS14202.1|  hypothetical protein LRAMOSA06372                      158   2e-41    
gb|AIT69917.1|  alanine transaminase                                    157   2e-41    
gb|EHA19467.1|  hypothetical protein ASPNIDRAFT_208695                  157   2e-41    
dbj|GAA83975.1|  alanine aminotransferase                               157   2e-41    
ref|XP_003717056.1|  hypothetical protein MGG_06503                     157   3e-41    
emb|CEG68597.1|  Putative Alanine transaminase                          157   3e-41    
ref|XP_007316821.1|  hypothetical protein SERLADRAFT_463910             157   3e-41    
emb|CDH53092.1|  alanine transaminase                                   157   3e-41    
emb|CEI95238.1|  Putative Alanine transaminase                          157   3e-41    
ref|XP_001267930.1|  alanine aminotransferase, putative                 157   3e-41    
emb|CAK40604.1|  unnamed protein product                                158   3e-41    
ref|XP_002970914.1|  hypothetical protein SELMODRAFT_94316              157   3e-41    
ref|XP_001394263.2|  alanine aminotransferase                           157   3e-41    
gb|EYE95145.1|  PLP-dependent transferase                               157   4e-41    
dbj|BAK07780.1|  predicted protein                                      157   4e-41    
gb|KGO40423.1|  Pyridoxal phosphate-dependent transferase, major ...    157   4e-41    
emb|CDM35136.1|  Probable alanine aminotransferase, mitochondrial       157   4e-41    
gb|KFZ15791.1|  hypothetical protein V502_05411                         157   4e-41    
ref|XP_002969652.1|  hypothetical protein SELMODRAFT_91640              157   4e-41    
ref|NP_595176.1|  alanine aminotransferase (predicted)                  157   5e-41    
ref|XP_004690373.1|  PREDICTED: alanine aminotransferase 2              157   5e-41    
emb|CCA27196.1|  unnamed protein product                                157   5e-41    
gb|KIM60554.1|  hypothetical protein SCLCIDRAFT_124096                  156   5e-41    
gb|EKV16330.1|  hypothetical protein PDIP_36630                         157   5e-41    
gb|EER41400.1|  alanine transaminase                                    157   5e-41    
ref|XP_001538074.1|  hypothetical protein HCAG_05679                    156   5e-41    
gb|KHJ33214.1|  putative alanine aminotransferase                       157   5e-41    
gb|KIK54467.1|  hypothetical protein GYMLUDRAFT_249408                  156   5e-41    
gb|KFK41654.1|  hypothetical protein AALP_AA2G155600                    157   6e-41    
gb|KIM92418.1|  hypothetical protein PILCRDRAFT_83571                   156   6e-41    
gb|KFY82291.1|  hypothetical protein V500_10655                         156   6e-41    
ref|XP_007583269.1|  putative alanine aminotransferase protein          156   6e-41    
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...    157   6e-41    
gb|EEH09537.1|  alanine transaminase                                    156   6e-41    
ref|XP_002499950.1|  alanine aminotransferase                           156   6e-41    
gb|EXM09405.1|  alanine transaminase                                    156   6e-41    
gb|EXA40709.1|  alanine transaminase                                    156   6e-41    
emb|CBK19835.2|  Alanine aminotransferase 2                             156   7e-41    
gb|EGU80733.1|  hypothetical protein FOXB_08773                         156   7e-41    
ref|XP_007339865.1|  transaminase                                       156   7e-41    
gb|AIT69936.1|  alanine transaminase                                    156   7e-41    
gb|KID78103.1|  Pyridoxal phosphate-dependent transferase, major ...    156   7e-41    
ref|XP_006966918.1|  alanine transaminase-like protein                  156   7e-41    
ref|XP_003055208.1|  predicted protein                                  156   7e-41    
gb|ENH81466.1|  alanine aminotransferase                                156   7e-41    
gb|EGC49263.1|  alanine transaminase                                    157   7e-41    
gb|KFH46391.1|  alanine aminotransferase-like protein                   156   7e-41    
dbj|GAC95800.1|  aspartate aminotransferase                             157   7e-41    
gb|AAV64237.1|  putative alanine aminotransferase                       156   7e-41    
gb|AAV64199.1|  putative alanine aminotransferase                       156   7e-41    
ref|XP_002850365.1|  alanine transaminase                               157   8e-41    
gb|EMD37126.1|  hypothetical protein CERSUDRAFT_115046                  155   8e-41    
ref|XP_008499534.1|  PREDICTED: alanine aminotransferase 2              156   8e-41    
gb|AIT69935.1|  alanine transaminase                                    156   9e-41    
ref|XP_010415979.1|  PREDICTED: alanine aminotransferase 2, mitoc...    156   9e-41    
gb|EFQ30288.1|  aminotransferase class I and II                         155   9e-41    
ref|XP_003299332.1|  hypothetical protein PTT_10298                     152   1e-40    
ref|XP_003026698.1|  hypothetical protein SCHCODRAFT_61980              155   1e-40    
ref|NP_001077811.1|  alanine aminotransferase 2                         155   1e-40    
gb|EXK34393.1|  alanine transaminase                                    156   1e-40    
gb|AIT69942.1|  alanine transaminase                                    155   1e-40    
gb|KFP06658.1|  Alanine aminotransferase 2                              156   1e-40    
emb|CCF40508.1|  aminotransferase class I and II                        155   1e-40    
ref|XP_006300438.1|  hypothetical protein CARUB_v10020102mg             156   1e-40    



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   336 bits (861),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 163/169 (96%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAKQFL MTSGGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKQFLGMTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILNSIIRGP+DGILVPVPQYPLYSA+I L
Sbjct  126  YPSDPELIFLTDGASKGVMQILNSIIRGPSDGILVPVPQYPLYSASIQL  174



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/169 (96%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAKQFL MTSGGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKQFLGMTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILNSIIRGP+DGILVPVPQYPLYSA+I L
Sbjct  126  YPSDPELIFLTDGASKGVMQILNSIIRGPSDGILVPVPQYPLYSASIQL  174



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   331 bits (848),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 160/169 (95%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYELLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGLVFPADAIARAK +L+MTSGGLGAYSDSRGIPGVRKE+AEFIGRRDG
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLAMTSGGLGAYSDSRGIPGVRKEIAEFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN+IIRG +DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNAIIRGQSDGILVPVPQYPLYSATISL  174



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/170 (95%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYENLN+NVK+CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNKNVKECQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGLVFPADAIARAK  LSMTSGGLGAYSDSRGIPGVRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLVFPADAIARAKHLLSMTSGGLGAYSDSRGIPGVRKEVAEFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELIFLTDGASKGVMQILN+IIRG  DG+LVPVPQYPLYSATISL
Sbjct  125  GYPSDPELIFLTDGASKGVMQILNAIIRGEGDGVLVPVPQYPLYSATISL  174



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ SGGLGAYSDSRGIPGVRKE+A+FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLNSGGLGAYSDSRGIPGVRKEIADFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELIFLTDGASKG+MQIL++IIRGPNDG+LVPVPQYPLYSATISL
Sbjct  125  GYPSDPELIFLTDGASKGIMQILHTIIRGPNDGVLVPVPQYPLYSATISL  174



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ SGGLGAYSDSRGIPGVRKE+A+FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLNSGGLGAYSDSRGIPGVRKEIADFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELIFLTDGASKG+MQIL++IIRGPNDG+LVPVPQYPLYSATISL
Sbjct  125  GYPSDPELIFLTDGASKGIMQILHTIIRGPNDGVLVPVPQYPLYSATISL  174



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   328 bits (842),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDY+NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVG +FPADAIARAK +L+MTSGGLGAYSDSRG PGVRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGFLFPADAIARAKHYLAMTSGGLGAYSDSRGTPGVRKEVAEFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELIFLTDGASKGVMQILN++IRGP+DGILVPVPQYPLYSA+I L
Sbjct  125  GYPSDPELIFLTDGASKGVMQILNTVIRGPSDGILVPVPQYPLYSASIQL  174



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   328 bits (841),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/170 (93%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  3    PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  62

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK ++S+TSGGLGAYSDSRGIPGVRKEVAEFI RRD
Sbjct  63   LCQAPFLLDDPNVGLLFPADAIARAKHYISLTSGGLGAYSDSRGIPGVRKEVAEFIQRRD  122

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQILN IIRG  DGILVPVPQYPLYSATI+L
Sbjct  123  GYPSDPELIYLTDGASKGVMQILNVIIRGQKDGILVPVPQYPLYSATIAL  172



>ref|XP_006416098.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34451.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=357

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  122

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  123  YPSDPELIFLTDGASKGVMQILNCVIRGEGDGILVPVPQYPLYSATISL  171



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFL+DDPNVG +F ADAIARAK +LSMTSGGLGAYSDSRG+PG+RKEVAEFI RRDG
Sbjct  66   CQAPFLMDDPNVGTLFHADAIARAKHYLSMTSGGLGAYSDSRGLPGIRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILNSIIRG +DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNSIIRGAHDGILVPVPQYPLYSATISL  174



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDY+NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVG +FPADAIARAK +L+MTSGGLGAYSDSRG PGVRKEVAEFI +RD
Sbjct  65   LCQAPFLLDDPNVGFLFPADAIARAKHYLAMTSGGLGAYSDSRGTPGVRKEVAEFIEKRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELIFLTDGASKGVMQILN++IRGP+DGILVPVPQYPLYSA+I L
Sbjct  125  GYPSDPELIFLTDGASKGVMQILNTVIRGPSDGILVPVPQYPLYSASIQL  174



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            +DYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  5    MDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  64

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPF+LDDPNVGL+FPADAIA+AK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  65   CQAPFMLDDPNVGLLFPADAIAKAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  124

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN+IIRG +DGILVPVPQYPLYSATI+L
Sbjct  125  YPSDPELIFLTDGASKGVMQILNTIIRGSSDGILVPVPQYPLYSATIAL  173



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVG +FPADAIA+AK +LS+ SGGLGAYSDSRGIPGVRKE+A+FI RRD
Sbjct  65   LCQAPFLLDDPNVGQLFPADAIAKAKHYLSLNSGGLGAYSDSRGIPGVRKEIADFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELIFLTDGASKG+MQIL++IIRGPNDG+LVPVPQYPLYSATISL
Sbjct  125  GYPSDPELIFLTDGASKGIMQILHTIIRGPNDGVLVPVPQYPLYSATISL  174



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   326 bits (835),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN IIRG +DG+LVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCIIRGQSDGVLVPVPQYPLYSATISL  174



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVAEFIGRRDG
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNTIIRGERDGILVPVPQYPLYSAAISL  174



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVAEFIGRRDG
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNTIIRGERDGILVPVPQYPLYSAAISL  174



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVAEFIGRRDG
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNTIIRGERDGILVPVPQYPLYSAAISL  174



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            L+YE+LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYESLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  63   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  122

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  123  YPSDPELIFLTDGASKGVMQILNCVIRGERDGILVPVPQYPLYSATISL  171



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGNGDGILVPVPQYPLYSATISL  174



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGDGDGILVPVPQYPLYSATISL  174



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGLVFPADAIARAK +LS+T+GGLGAYSDSRG+PG+RKEVAEFIGRRDG
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTTGGLGAYSDSRGLPGIRKEVAEFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNTIIRGERDGILVPVPQYPLYSAAISL  174



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  122

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  123  YPSDPELIFLTDGASKGVMQILNCVIRGEGDGILVPVPQYPLYSATISL  171



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLL+DPNVG+VFPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLEDPNVGMVFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGDGDGILVPVPQYPLYSATISL  174



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGNGDGILVPVPQYPLYSATISL  174



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGNGDGILVPVPQYPLYSATISL  174



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGQKDGILVPVPQYPLYSATISL  174



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGQKDGILVPVPQYPLYSATISL  174



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGDGDGILVPVPQYPLYSATISL  174



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGQKDGILVPVPQYPLYSATISL  174



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGQKDGILVPVPQYPLYSATISL  174



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   323 bits (827),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGQKDGILVPVPQYPLYSATISL  174



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPF LDDPNVG +FPADAIA+AK +LS+ SGGLGAYSDSRGIPGVRKE+A+FI RRD
Sbjct  65   LCQAPFFLDDPNVGQLFPADAIAKAKHYLSLNSGGLGAYSDSRGIPGVRKEIADFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPE IFLTDGASKG+MQIL++IIRGPNDG+LVPVPQYPLYSATISL
Sbjct  125  GYPSDPEHIFLTDGASKGIMQILHTIIRGPNDGVLVPVPQYPLYSATISL  174



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN IIRG  DG+LVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCIIRGQGDGVLVPVPQYPLYSATISL  174



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPN+G++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNIGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IR   DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRSQKDGILVPVPQYPLYSATISL  174



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPS+PELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSNPELIFLTDGASKGVMQILNCVIRGNGDGILVPVPQYPLYSATISL  174



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLL+DPNVG++FPADAIARA+ +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLEDPNVGMIFPADAIARARHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGDGDGILVPVPQYPLYSATISL  174



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA+FI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAQFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGQKDGILVPVPQYPLYSATISL  174



>ref|XP_006438273.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51513.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=398

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG+VFPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGIVFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQ LN +IRG  DG+LVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQTLNCVIRGEGDGVLVPVPQYPLYSATISL  174



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAI RAK +LS+TSGGLGAYSDSRG+PG+RKE+AEFIGRRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIDRAKHYLSLTSGGLGAYSDSRGLPGIRKEIAEFIGRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQILN+IIR  NDGILVPVPQYPLYSATISL
Sbjct  125  GYPSDPELIYLTDGASKGVMQILNTIIRNENDGILVPVPQYPLYSATISL  174



>gb|KJB31174.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=395

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNP ALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN IIRG  DG+LVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCIIRGQGDGVLVPVPQYPLYSATISL  174



>ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis]
 gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis]
Length=452

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILNSIIRG  DG+LVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNSIIRGEGDGVLVPVPQYPLYSAAISL  174



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   321 bits (823),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAK +LS+T+GGLGAYSDSRG+PG+RKEVAEFIGRRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTTGGLGAYSDSRGLPGIRKEVAEFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN+IIRG  DG+LVPVPQYPLYSA I+L
Sbjct  126  YPSDPELIFLTDGASKGVMQILNTIIRGEGDGVLVPVPQYPLYSAAIAL  174



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   321 bits (823),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN IIR   DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCIIRNQKDGILVPVPQYPLYSATISL  174



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   321 bits (822),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN IIR   DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCIIRNQKDGILVPVPQYPLYSATISL  174



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   321 bits (822),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN IIR   DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCIIRDQKDGILVPVPQYPLYSATISL  174



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            L+Y+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  122

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  123  YPSDPELIFLTDGASKGVMQILNCVIRGEGDGILVPVPQYPLYSATISL  171



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLL+DPNVG++FPADAIARA+ +LS+TSGGLGAYSDSRG+PGVRKEVA+FI RRDG
Sbjct  66   CQAPFLLEDPNVGMIFPADAIARARHYLSLTSGGLGAYSDSRGLPGVRKEVADFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGDGDGILVPVPQYPLYSATISL  174



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   320 bits (821),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            L+Y+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  122

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  123  YPSDPELIFLTDGASKGVMQILNCVIRGEGDGILVPVPQYPLYSATISL  171



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKTQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVAEFIGRRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGVPGIRKEVAEFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQ+LN+IIRG  DGILVPVPQYPLYSA I+L
Sbjct  126  YPSDPELIFLTDGASKGVMQMLNTIIRGEGDGILVPVPQYPLYSAAITL  174



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   321 bits (823),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKQYLSLTSGGLGAYSDSRGVPGVRKEVAEFIQRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPE I+LTDGASK VMQILN+IIRG  DGILVPVPQYPLYSATI+L
Sbjct  125  GYPSDPEFIYLTDGASKAVMQILNTIIRGQGDGILVPVPQYPLYSATIAL  174



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   320 bits (821),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE++NENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPE+I+LTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSATISL
Sbjct  125  GYPSDPEIIYLTDGASKGVMQILNTIIRGEGDGILVPVPQYPLYSATISL  174



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   320 bits (821),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKQYLSLTSGGLGAYSDSRGVPGVRKEVAEFIQRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPE I+LTDGASK VMQILN+IIRG  DGILVPVPQYPLYSATI+L
Sbjct  125  GYPSDPEFIYLTDGASKAVMQILNTIIRGQGDGILVPVPQYPLYSATIAL  174



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   320 bits (820),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  63   CQAPFLLDNPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  122

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  123  YPSDPELIFLTDGASKGVMQILNCVIRGAGDGILVPVPQYPLYSATISL  171



>ref|XP_006378236.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|ERP56033.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=335

 Score =   315 bits (808),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIA+AK +L+MT+GGLGAYSDSRG+PGVRKEVA+FI RRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIAKAKHYLAMTTGGLGAYSDSRGMPGVRKEVADFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQIL++IIRG +DG+LVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILSTIIRGESDGVLVPVPQYPLYSAAISL  174



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE+LNENVKK  YAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRAAELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAI+RA+ +LSMTSGGLGAYSDSRG+PG+RKEVA+FIG+RD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAISRARHYLSMTSGGLGAYSDSRGLPGIRKEVADFIGKRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELIFLTDGASKGVMQILN+IIR  NDGILVPVPQYPLYSATISL
Sbjct  125  GYPSDPELIFLTDGASKGVMQILNTIIRDENDGILVPVPQYPLYSATISL  174



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LD+E+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDHESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN IIRG  DG+LVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCIIRGEGDGVLVPVPQYPLYSATISL  174



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLD+PNVG++FPADAI+RAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDNPNVGMIFPADAISRAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN IIR   DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCIIRDQKDGILVPVPQYPLYSATISL  174



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVK CQYAVRGELYLRASELQKE KKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKECKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA+FI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVADFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCVIRGQKDGILVPVPQYPLYSATISL  174



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNP ALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN IIRG  DG+LVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNCIIRGQGDGVLVPVPQYPLYSATISL  174



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG+VFPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGIVFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQ LN +IRG  DG+LVPVPQYPLYSATISL
Sbjct  126  YPSDPELIFLTDGASKGVMQTLNCVIRGEGDGVLVPVPQYPLYSATISL  174



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LSMTSGGLGAYSDSRG+PG+RKEVA+FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSMTSGGLGAYSDSRGLPGIRKEVADFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELIFLTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSATISL
Sbjct  125  GYPSDPELIFLTDGASKGVMQMLNTIIRNEKDGILVPVPQYPLYSATISL  174



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   318 bits (814),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI +RDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSITSGGLGAYSDSRGIPGVRKEVAEFIEKRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIYLTDGASKGVMQILNAIIRGEGDGILVPVPQYPLYSAAISL  174



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   318 bits (814),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI +RDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSITSGGLGAYSDSRGIPGVRKEVAEFIEKRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIYLTDGASKGVMQILNAIIRGEGDGILVPVPQYPLYSAAISL  174



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   318 bits (814),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKK+IFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKVIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+T+GGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAISRAKHYLSITAGGLGAYSDSRGIPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQILN+IIRG  DG+LVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIYLTDGASKGVMQILNTIIRGEGDGVLVPVPQYPLYSAAISL  174



>ref|XP_004955316.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X1 [Setaria italica]
Length=539

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ +GGLGAYSDSRGIPG+RKEVA+FI RRD
Sbjct  65   LCQAPFLLDDPNVGLMFPADAIARAKHYLSLATGGLGAYSDSRGIPGIRKEVADFIQRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSATISL
Sbjct  125  GYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSATISL  174



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNEKVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI +RDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSITSGGLGAYSDSRGIPGVRKEVAEFIEKRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSATISL
Sbjct  126  YPSDPELIYLTDGASKGVMQILNAIIRGEGDGILVPVPQYPLYSATISL  174



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ +GGLGAYSDSRGIPG+RKEVA+FI RRD
Sbjct  65   LCQAPFLLDDPNVGLMFPADAIARAKHYLSLATGGLGAYSDSRGIPGIRKEVADFIQRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSATISL
Sbjct  125  GYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSATISL  174



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE+LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLMFPADAIARAKYYLSLTSGGLGAYSDSRGMPGIRKEVAEFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPE IFLTDGASKGVMQ+LN+IIRG  DGILVPVPQYPLYSA ISL
Sbjct  125  GYPSDPEHIFLTDGASKGVMQLLNTIIRGEGDGILVPVPQYPLYSAAISL  174



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKSVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARA  +L+MTSGGLGAYSDSRG+PG+RKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARATHYLAMTSGGLGAYSDSRGLPGIRKEVAEFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQILN+IIR   DGILVPVPQYPLYSATI+L
Sbjct  125  GYPSDPELIYLTDGASKGVMQILNAIIRNNKDGILVPVPQYPLYSATIAL  174



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  15   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  74

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LSM  GGLGAYSDSRGIPGVRKEVAEFI RRD
Sbjct  75   LCQAPFLLDDPNVGLIFPADAIARAKHYLSMAPGGLGAYSDSRGIPGVRKEVAEFIQRRD  134

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSA ISL
Sbjct  135  GYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSAAISL  184



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   316 bits (810),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIA+AK +L+MT+GGLGAYSDSRG+PGVRKEVA+FI RRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIAKAKHYLAMTTGGLGAYSDSRGMPGVRKEVADFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQIL++IIRG +DG+LVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILSTIIRGESDGVLVPVPQYPLYSAAISL  174



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   316 bits (810),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+T+GGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAISRAKHYLSITTGGLGAYSDSRGIPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQILN+IIRG  DG+LVPVPQYPLYSA I+L
Sbjct  126  YPSDPELIYLTDGASKGVMQILNTIIRGEGDGVLVPVPQYPLYSAAITL  174



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFILRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYP+DPELI+LTDGASKGVMQILN+IIRG +DGILVPVPQYPLYSATI+L
Sbjct  125  GYPTDPELIYLTDGASKGVMQILNTIIRGQDDGILVPVPQYPLYSATIAL  174



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFILRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYP+DPELI+LTDGASKGVMQILN+IIRG +DGILVPVPQYPLYSATI+L
Sbjct  125  GYPTDPELIYLTDGASKGVMQILNTIIRGQDDGILVPVPQYPLYSATIAL  174



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  12   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  71

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +L+M  GGLGAYSDSRGIPG+RKEVAEFI RRD
Sbjct  72   LCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIRKEVAEFIERRD  131

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSA ISL
Sbjct  132  GYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSAAISL  181



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFILRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYP+DPELI+LTDGASKGVMQILN+IIRG +DGILVPVPQYPLYSATI+L
Sbjct  125  GYPTDPELIYLTDGASKGVMQILNTIIRGQDDGILVPVPQYPLYSATIAL  174



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDP+VG++FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPHVGILFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQILN++IR   DGILVPVPQYPLYSA ISL
Sbjct  125  GYPSDPELIYLTDGASKGVMQILNTVIRNEKDGILVPVPQYPLYSAAISL  174



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  66

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAK +LSM  GGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  67   CQAPFLLDDPNVGLIFPADAIARAKHYLSMAPGGLGAYSDSRGIPGVRKEVAEFIQRRDG  126

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSA ISL
Sbjct  127  YPSDPELIYLTDGASKGVMQMLNAIIRNERDGILVPVPQYPLYSAAISL  175



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LD+E LNENVK  QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  5    LDHETLNENVKNVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  64

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVAEFI RRDG
Sbjct  65   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRDG  124

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQ+LN++IRG  DGILVPVPQYPLYSA I+L
Sbjct  125  YPSDPELIFLTDGASKGVMQMLNTMIRGEKDGILVPVPQYPLYSAAIAL  173



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS TSGGLGAYSDSRG P VRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKQYLSFTSGGLGAYSDSRGTPAVRKEVAEFIQRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPE I+LTDGASK VMQILN+IIRG  DGI+VPVPQYPLYSATI+L
Sbjct  125  GYPSDPEFIYLTDGASKAVMQILNTIIRGEVDGIMVPVPQYPLYSATIAL  174



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAYSDSRGIP +RKEVAEFI +RDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSVTSGGLGAYSDSRGIPAIRKEVAEFIEKRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQILN+IIRG  DG+LVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIYLTDGASKGVMQILNAIIRGAGDGVLVPVPQYPLYSAAISL  174



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLD+  +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+A
Sbjct  5    PLDHALINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFILRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQILN+IIR  +DGILVPVPQYPLYSATI+L
Sbjct  125  GYPSDPELIYLTDGASKGVMQILNTIIRNQDDGILVPVPQYPLYSATIAL  174



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS TSGGLGAYSDSRG P VRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKQYLSFTSGGLGAYSDSRGTPAVRKEVAEFIQRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPE I+LTDGASK VMQILN+IIRG  DGI+VPVPQYPLYSATI+L
Sbjct  125  GYPSDPEFIYLTDGASKAVMQILNTIIRGEVDGIMVPVPQYPLYSATIAL  174



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE+LNENVKK  YAVRGELY RASELQKEGKKIIFT+VGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYFRASELQKEGKKIIFTDVGNPHALGQKPLSFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARA+ +LSMTSGGLGAYSDSRGIPGVRKEVA+FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARARHYLSMTSGGLGAYSDSRGIPGVRKEVADFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELIFLTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSA ISL
Sbjct  125  GYPSDPELIFLTDGASKGVMQMLNTIIRDEKDGILVPVPQYPLYSAAISL  174



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  11   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  70

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +L+M  GGLGAYSDSRGIPG+RKEVAEFI RRD
Sbjct  71   LCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIRKEVAEFIERRD  130

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATIS  672
            GYPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSA IS
Sbjct  131  GYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSAAIS  179



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   313 bits (803),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL FPADAI++AK +L+MT GGLGAY+DSRG+PGVRKEVA+FI RRDG
Sbjct  66   CQAPFLLDDPNVGLFFPADAISKAKHYLAMTIGGLGAYTDSRGMPGVRKEVADFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN+IIRG +DGILVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNTIIRGESDGILVPVPQYPLYSAAISL  174



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG +FPADAIA+AK +L+MT+GGLGAYSDSRG+PGVRKEVA+FI RRDG
Sbjct  66   CQAPFLLDDPNVGFLFPADAIAKAKHYLAMTTGGLGAYSDSRGMPGVRKEVADFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN+II G +DG+LVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIFLTDGASKGVMQILNTIICGESDGVLVPVPQYPLYSAAISL  174



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE LNENVK+ QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKRVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDP+VGL+FPADAIARAK +L+M  GGLGAYSDSRGIPG+RKEVA+FI +RD
Sbjct  65   LCQAPFLLDDPHVGLMFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIRKEVADFIHKRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQILN+IIR   DGILVPVPQYPLYSATISL
Sbjct  125  GYPSDPELIYLTDGASKGVMQILNTIIRNEMDGILVPVPQYPLYSATISL  174



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAYSDSRGIP +RKEVA+FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKHYLSLIPGGLGAYSDSRGIPAIRKEVADFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSA I+L
Sbjct  126  YPSDPELIYLTDGASKGVMQILNTIIRGAGDGILVPVPQYPLYSAAIAL  174



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAYSDSRGIP +RKEVA+FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKHYLSLIPGGLGAYSDSRGIPAIRKEVADFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSA I+L
Sbjct  126  YPSDPELIYLTDGASKGVMQILNTIIRGAGDGILVPVPQYPLYSAAIAL  174



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAYSDSRGIP +RKEVA+FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKHYLSLIPGGLGAYSDSRGIPAIRKEVADFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSA I+L
Sbjct  126  YPSDPELIYLTDGASKGVMQILNTIIRGAGDGILVPVPQYPLYSAAIAL  174



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 161/183 (88%), Gaps = 14/183 (8%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------------IIFTNVGNPHAL  306
            LDYE +NENVKK QYAVRGELYLRASELQKEGKK              IIFTNVGNP AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKYMKSTVCWGSMHFHIIFTNVGNPQAL  65

Query  307  GQKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPG  486
            GQKPLTFPRQV+ALCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRGIPG
Sbjct  66   GQKPLTFPRQVVALCQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPG  125

Query  487  VRKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSAT  666
            VRKEVAEFI RRDGYPSDPELIFLTDGASKGVMQILN IIRG  DG+LVPVPQYPLYSAT
Sbjct  126  VRKEVAEFIERRDGYPSDPELIFLTDGASKGVMQILNCIIRGQGDGVLVPVPQYPLYSAT  185

Query  667  ISL  675
            ISL
Sbjct  186  ISL  188



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL+FPADAIARAK +LS+  GGLGAYSDSRGIPGVR+EVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLAPGGLGAYSDSRGIPGVRQEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIYLTDGASKGVMQMLNAIIRNERDGILVPVPQYPLYSAAISL  174



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 164/170 (96%), Gaps = 1/170 (1%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFILRRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYP+DPELI+LTDGASKGVMQILN+IIRG +DGIL PVPQYPLYSATI+L
Sbjct  125  GYPTDPELIYLTDGASKGVMQILNTIIRGQDDGIL-PVPQYPLYSATIAL  173



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE++NEN+KK +YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYESINENMKKVEYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVG +FP DAI RAK +LSM  GGLGAYSDSRG PGVRKEVAEFI RRD
Sbjct  65   LCQAPFLLDDPNVGQLFPPDAIVRAKHYLSMIGGGLGAYSDSRGNPGVRKEVAEFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSATI+L
Sbjct  125  GYPSDPELIYLTDGASKGVMQILNTIIRGEGDGILVPVPQYPLYSATIAL  174



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLL+DPNVGL+FPADAI RAK +LS+  GGLGAYSDSRGIP +RKEVA+FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIERAKSYLSLIPGGLGAYSDSRGIPAIRKEVADFIGRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             PSDPELI+LTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSATI+L
Sbjct  126  SPSDPELIYLTDGASKGVMQILNTIIRGEGDGILVPVPQYPLYSATIAL  174



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 158/169 (93%), Gaps = 3/169 (2%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVGL       A+AK +L+MTSGGLGAYSDSRG+PG+RKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGL---XXXXAKAKHYLAMTSGGLGAYSDSRGLPGIRKEVAEFIERRDG  122

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELIFLTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSATI+L
Sbjct  123  YPSDPELIFLTDGASKGVMQILNTIIRGAGDGILVPVPQYPLYSATITL  171



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   306 bits (785),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 161/197 (82%), Gaps = 28/197 (14%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLG------------------------  456
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLG                        
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGMSLLSIYLLTIAKACKSKKHFCFN  125

Query  457  ----AYSDSRGIPGVRKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDG  624
                AYSDSRG+PGVRKEVAEFI RRDGYPSDPELIFLTDGASKGVMQILN IIR   DG
Sbjct  126  LLLGAYSDSRGLPGVRKEVAEFIQRRDGYPSDPELIFLTDGASKGVMQILNCIIRNQKDG  185

Query  625  ILVPVPQYPLYSATISL  675
            ILVPVPQYPLYSATISL
Sbjct  186  ILVPVPQYPLYSATISL  202



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            P+DYE LNE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FP DAI RAK++L+M  GGLGAYSD+RGIPG+RKEVA+FI +RD
Sbjct  66   LCQAPFLLDDPNVGLMFPPDAIVRAKRYLAMAPGGLGAYSDARGIPGIRKEVADFIHKRD  125

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSA ISL
Sbjct  126  GYPSDPELIYLTDGASKGVMQMLNAIIRNERDGILVPVPQYPLYSAIISL  175



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPN  L  PADAIARAK +LS+  GGLGAYSDSRGIPGVR+EVAEFI RRDG
Sbjct  66   CQAPFLLDDPNAALSSPADAIARAKHYLSLAPGGLGAYSDSRGIPGVRQEVAEFIQRRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSA ISL
Sbjct  126  YPSDPELIYLTDGASKGVMQMLNAIIRNERDGILVPVPQYPLYSAAISL  174



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            P+DYE LNE VKK QYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FP DAI RAK++L+M  GGLGAYSD+RGIPG+RKEVA+FI +RD
Sbjct  66   LCQAPFLLDDPNVGLMFPPDAIVRAKRYLAMAPGGLGAYSDARGIPGIRKEVADFIHKRD  125

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSA ISL
Sbjct  126  GYPSDPELIYLTDGASKGVMQMLNAIIRNERDGILVPVPQYPLYSAIISL  175



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            P+DYE LNE VKK QYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAPFLLDDPNVGL+FP DAI RAK++L+M  GGLGAYSD+RGIPG+RKEVA+FI +RD
Sbjct  66   LCQAPFLLDDPNVGLMFPPDAIVRAKRYLAMAPGGLGAYSDARGIPGIRKEVADFIHKRD  125

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDPELI+LTDGASKGVMQ+LN+IIR   DGILVPVPQYPLYSA ISL
Sbjct  126  GYPSDPELIYLTDGASKGVMQMLNAIIRNERDGILVPVPQYPLYSAIISL  175



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LD +N+NENVKKC YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDPDNINENVKKCVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFL+DDPNVGL+FP DA+ARAK +LSMTSGG+GAYSDSRG+PGVR+EVAEFI +RDG
Sbjct  66   CQAPFLMDDPNVGLLFPPDAVARAKHYLSMTSGGVGAYSDSRGLPGVRQEVAEFIQKRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPE IFLTDGASKGVM +LN++IR   DG+LVP+PQYPLYSA+I+L
Sbjct  126  YPSDPEHIFLTDGASKGVMMMLNALIRNEKDGVLVPIPQYPLYSASIAL  174



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE++NEN+KK +YAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQ PLTFPRQVIAL
Sbjct  6    LDYESINENMKKVEYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQMPLTFPRQVIAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG +FP DAI RAK +LSM  GGLGAYSDSRG PGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGQLFPPDAIVRAKHYLSMIGGGLGAYSDSRGNPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPELI+LTDGASKGVMQILN+IIRG  DGILVPVPQYPLYSA I+L
Sbjct  126  YPSDPELIYLTDGASKGVMQILNTIIRGEGDGILVPVPQYPLYSAAIAL  174



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PLDYE +NENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNP ALGQ+PLTFPRQV+A
Sbjct  5    PLDYECINENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQRPLTFPRQVMA  64

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRD  525
            LCQAP L+DDPNV ++FPAD IARAK +L+MT+GGLGAYSDSRG+PG+RKEVAEFI RRD
Sbjct  65   LCQAPMLMDDPNVSILFPADVIARAKHYLAMTTGGLGAYSDSRGLPGIRKEVAEFIERRD  124

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            GYPSDP+LIFLTDGASKGVMQILN+IIR   DGILVPVPQYPLYSA ISL
Sbjct  125  GYPSDPDLIFLTDGASKGVMQILNTIIRDEKDGILVPVPQYPLYSAAISL  174



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            +D ENLNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPENLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFL+DDP+VGL+FPADAIA+AK +LSMTSGG+GAYSDSRG+PGVR+EVA FI +RDG
Sbjct  67   CQAPFLMDDPHVGLLFPADAIAKAKHYLSMTSGGVGAYSDSRGLPGVRQEVANFILQRDG  126

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPE IFLTDGASKGV Q+LN++IR   DG+LVP+PQYPLYSATI L
Sbjct  127  YPSDPENIFLTDGASKGVAQVLNALIRDEKDGVLVPIPQYPLYSATIQL  175



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            +D +NLNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPDNLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFL+DDP+VGL+FPADAIA+AK +L+MTSGG+GAYSDSRG+PGVR+EVA FI +RDG
Sbjct  67   CQAPFLMDDPHVGLLFPADAIAKAKHYLAMTSGGVGAYSDSRGLPGVRQEVANFILQRDG  126

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSDPE IFLTDGASKGV Q+LN++IR   DG+LVP+PQYPLYSATI L
Sbjct  127  YPSDPENIFLTDGASKGVAQVLNALIRDEKDGVLVPIPQYPLYSATIQL  175



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   289 bits (740),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLLDDPNVG+VFPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVAEFI RRDG
Sbjct  66   CQAPFLLDDPNVGIVFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILV  633
            YPSDPELIFLTDGASKGVMQ LN +IRG  DG+++
Sbjct  126  YPSDPELIFLTDGASKGVMQTLNCVIRGEGDGVVL  160



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   290 bits (741),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            +D ENLN NVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPENLNLNVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFL+DDP+VGL+FP DAIARAK +L+MTSGG+GAYSDSRG+PGVR+EVAEFI  RDG
Sbjct  67   CQAPFLMDDPHVGLLFPEDAIARAKHYLAMTSGGVGAYSDSRGLPGVRQEVAEFILERDG  126

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            YPSD E IFLTDGASKGV Q+LN++IR   DG+LVP+PQYPLYSATI L
Sbjct  127  YPSDVENIFLTDGASKGVAQVLNALIRNEKDGVLVPIPQYPLYSATIQL  175



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 148/174 (85%), Gaps = 16/174 (9%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  68   LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  127

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRR--  522
            CQAPFLLDDPNVG++F ADAI RAK +LS+TSGGLGAY           +VAEFI RR  
Sbjct  128  CQAPFLLDDPNVGMLFSADAIERAKHYLSLTSGGLGAY-----------KVAEFIQRRLS  176

Query  523  ---DGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
                 Y +DPELIFLTDGASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  177  ASYLSYHNDPELIFLTDGASKGVMQILNCVIRGAGDGILVPVPQYPLYSATISL  230



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTFPRQV+ALC APF
Sbjct  60   LNENVMKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFPRQVLALCAAPF  119

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            LLD P V  +FPADAIARAK+ LS   GG+GAY+DSRG P VR+EVA FI +RDG  S+P
Sbjct  120  LLDHPRVEELFPADAIARAKKILSAFKGGVGAYTDSRGNPLVREEVARFIEKRDGVASNP  179

Query  544  ELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            + IFLTDGAS  V   LN++IR   D +LVP+PQYPLYSA+I L
Sbjct  180  DHIFLTDGASVAVRLCLNAMIRHERDAVLVPIPQYPLYSASIRL  223



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            LNEN+ + +YAVRGELYLR  EL+K+GK+IIFTNVGNPH LGQKPLTF RQV++L  +P 
Sbjct  62   LNENLVRAEYAVRGELYLRGEELRKQGKEIIFTNVGNPHVLGQKPLTFNRQVLSLIASPA  121

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            LL+ P VG +FP+DAIARAKQ L+   GG+GAYSDSRG  GVRKE+AEFI +RDGYPS+P
Sbjct  122  LLEHPEVGRLFPSDAIARAKQVLTYFPGGMGAYSDSRGAEGVRKEIAEFISKRDGYPSNP  181

Query  544  ELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
              IFLTDGAS  V  ILN+IIR   DGILVPVPQYPLYSA+I L
Sbjct  182  NNIFLTDGASPAVRYILNAIIRSDKDGILVPVPQYPLYSASIQL  225



>ref|XP_008446998.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
melo]
Length=234

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE++NE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINETVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAYSDSRGIP +RKEVA+FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKSYLSLIPGGLGAYSDSRGIPAIRKEVADFIGRRDG  125

Query  529  YPS  537
            YPS
Sbjct  126  YPS  128



>gb|KIZ04988.1| alanine transaminase [Monoraphidium neglectum]
Length=242

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            LNEN++K QYAVRGELYL+A EL+  GK IIFTNVGNPH LG KP+TF RQVIALC APF
Sbjct  58   LNENMRKTQYAVRGELYLKAEELKNAGKPIIFTNVGNPHNLGAKPITFTRQVIALCAAPF  117

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            LL  P V  +FPADAI RAK+ L   SGG+GAY DSRG   VR+EVA+FI  RDG+ +DP
Sbjct  118  LLQHPKVAELFPADAIERAKKLLGAFSGGIGAYQDSRGNFLVRQEVADFIKARDGHAADP  177

Query  544  ELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
              IFLTDGAS  V   LN+ IRGP DGILVP+PQYPLYSA+I L
Sbjct  178  NSIFLTDGASVAVRMCLNAAIRGPQDGILVPIPQYPLYSASIQL  221



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTF RQV+ALC APF
Sbjct  59   LNENVVKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFTRQVLALCAAPF  118

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            LLD P V  +FPADAIARAK+ L+   GG+GAY+DSRG P VR+EVA FI +RDG PS+P
Sbjct  119  LLDHPKVEDMFPADAIARAKKILASFKGGVGAYTDSRGNPLVREEVARFIEKRDGVPSNP  178

Query  544  ELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            + IFLTDGAS  V   LN++IR   D +LVP+PQYPLYSA+I L
Sbjct  179  DHIFLTDGASVAVRLCLNAMIRHDRDSVLVPIPQYPLYSASIRL  222



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTF RQV+ALC APF
Sbjct  59   LNENVVKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFTRQVLALCAAPF  118

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            LLD P V  +FPADAIARAK+ L+   GG+GAY+DSRG P VR+EVA FI +RDG PS+P
Sbjct  119  LLDHPKVEDMFPADAIARAKKILASFKGGVGAYTDSRGNPLVREEVARFIEKRDGVPSNP  178

Query  544  ELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            + IFLTDGAS  V   LN++IR   D +LVP+PQYPLYSA+I L
Sbjct  179  DHIFLTDGASVAVRLCLNAMIRHDRDSVLVPIPQYPLYSASIRL  222



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGL AYSDSRGIP +RKEVA+FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKSYLSLIPGGLVAYSDSRGIPAIRKEVADFIGRRDG  125

Query  529  YP  534
            YP
Sbjct  126  YP  127



>emb|CBJ25743.1| nicotinanamine aminotransferase A [Ectocarpus siliculosus]
Length=490

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            L Y+ + E VK CQYAVRGE+YL A+E  K GK++IFTNVGNPH LGQKPLTF RQV+AL
Sbjct  9    LTYDTIAECVKDCQYAVRGEIYLAATERIKAGKEVIFTNVGNPHGLGQKPLTFLRQVMAL  68

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
              APFLL+DP V  +FP DAIARA+++L    GG GAYSDS+G P VR+EV +FI RRDG
Sbjct  69   VMAPFLLEDPRVSDMFPGDAIARAREYLVHVKGGFGAYSDSKGNPYVRQEVCDFIERRDG  128

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            + + P+ IFLT+GAS+ V  +L + IRGP+DG++VPVPQYPLYSA+++L
Sbjct  129  HRTSPDNIFLTNGASEAVRLVLRTAIRGPSDGVMVPVPQYPLYSASVAL  177



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            L+Y++L ++VK C+YAVRGELY  A+E    GK++IFTNVGNPH LGQKP+TF RQV AL
Sbjct  52   LNYDSLPDHVKHCEYAVRGELYRAATERVAAGKEVIFTNVGNPHGLGQKPITFIRQVFAL  111

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
              APFLL+ P+V  +FP D IARAK ++    GG+GAYSDS+G+P VR+E A+F+ RRDG
Sbjct  112  VSAPFLLEHPDVHRIFPRDVIARAKAYMKAAPGGIGAYSDSKGLPIVRQEFADFLQRRDG  171

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            + SD + IFLT+GAS+ V   L +++RGP DGILVP+PQYPLYSA I L
Sbjct  172  FGSDIDKIFLTNGASEAVRLGLTAMLRGPQDGILVPIPQYPLYSAAIEL  220



>ref|XP_005847240.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
 gb|EFN55138.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
Length=529

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            LNE++ K +YAVRGELY +A ELQK+G+++IFTNVGNP  LGQ+P+TF R V +L  APF
Sbjct  67   LNEDLLKAEYAVRGELYNKAMELQKQGRELIFTNVGNPQQLGQQPITFNRMVTSLVAAPF  126

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            L+  P+   +FPAD + RAK+   M  G LGAY+DSRG  GVR+EVA+FI +RDGYPS+P
Sbjct  127  LMGHPSAPSMFPADVLERAKKINGMFGGALGAYTDSRGNAGVRQEVADFIKQRDGYPSNP  186

Query  544  ELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            + IFLTDGAS  V  +LN++IR  +D ILVP+PQYPLYSA+I L
Sbjct  187  DNIFLTDGASVAVRLLLNALIRDSSDAILVPIPQYPLYSASIQL  230



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 130/178 (73%), Gaps = 14/178 (8%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQ---------  336
            +N N+ K QYAVRGELYL+A E+++ G+ +IFTN+GNPH LG KP TF RQ         
Sbjct  116  VNPNIIKTQYAVRGELYLKAEEMRRAGRDVIFTNIGNPHNLGAKPKTFTRQAGRGPPRPG  175

Query  337  -----VIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  501
                 VIALC AP LLD P    +FP D +ARA++ LS  +GG+G+Y+DSRG   VR++V
Sbjct  176  PLGRVVIALCAAPDLLDSPQAAGLFPHDTVARARKLLSSFTGGVGSYTDSRGNSMVRQDV  235

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            A+FIGRRDG+P++PE IFLTDGAS GV   L+++IR  +D ILVP+PQYPLYSA I+L
Sbjct  236  ADFIGRRDGFPANPEHIFLTDGASPGVRMSLSALIRNSDDAILVPIPQYPLYSAAITL  293



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            +N+ V    YAVRG +Y+ A + +  GK++IFTN+GNP +LGQKP+TFPRQVI+L   P 
Sbjct  16   INQFVIASHYAVRGTIYIEAQKRKASGKEVIFTNIGNPQSLGQKPITFPRQVISLVTCPQ  75

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            LL+ P+VG +FP DAIARAK++L    GG GAY DSRG   VR+EVA+FI RRDG+P++P
Sbjct  76   LLEHPDVGKLFPEDAIARAKKYLDNLPGGSGAYQDSRGNMYVRQEVADFIARRDGHPANP  135

Query  544  ELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            E IFL+DGAS  + + LN +IR   DGIL+P PQYPLYSA+++L
Sbjct  136  EHIFLSDGASPAIQRCLNMLIRDQKDGILLPTPQYPLYSASVAL  179



>gb|KIY95165.1| alanine transaminase [Monoraphidium neglectum]
Length=227

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            +N N+ K QYAVRGELYLRA ++++EG+ IIFTN+GNPH LG +P TF RQ++ALC AP+
Sbjct  77   INPNILKTQYAVRGELYLRADKMRREGRDIIFTNIGNPHNLGAQPKTFTRQLVALCAAPW  136

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            LLDDP    +FP+D + RA++ L   +GG+GAY+DSRG   VR+EVA+FI RRDG+PS+P
Sbjct  137  LLDDPRAAELFPSDVMQRARKLLGTFTGGIGAYTDSRGNAAVRREVADFIQRRDGHPSNP  196

Query  544  ELIFLTDGASKGVMQILNSIIR  609
            E I+LTDGAS GV  ++N+IIR
Sbjct  197  EHIYLTDGASPGVRIMINAIIR  218



>ref|XP_001745052.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90285.1| predicted protein [Monosiga brevicollis MX1]
Length=480

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            +N NV    YAVRG++Y  A + + EGKK+I TNVGNPH+LGQ  +TFPRQV+AL   P 
Sbjct  13   INANVLAATYAVRGKIYEMAMQRKAEGKKVILTNVGNPHSLGQPAITFPRQVLALMNYPA  72

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            LLD PNVG +FPAD IARA+ +L    GG GAY DSRG P +RKEVA+FI  RDG+P+ P
Sbjct  73   LLDAPNVGDLFPADVIARARTYLEAFPGGTGAYQDSRGNPAIRKEVADFISARDGHPASP  132

Query  544  ELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSAT  666
            + IFL+DGAS  +   L  +IR   D +L+P+PQYPLYSA 
Sbjct  133  DDIFLSDGASPAIQNCLKMLIRDKQDAVLLPIPQYPLYSAA  173



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            LN+N+ K QYAVRGELY RA EL K G ++I+TN+GNP  LGQ+PL F RQV+AL  APF
Sbjct  24   LNDNILKTQYAVRGELYTRAQELAKSGGEVIYTNIGNPQQLGQEPLVFNRQVLALLLAPF  83

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            LLD P+   +FP +AI RA++ L+   G +GAYSD+RG P +R++VA FI  RDG P+DP
Sbjct  84   LLDHPSASALFPREAIDRARELLAAFGGRMGAYSDARGAPAIRQQVAAFIEARDGQPADP  143

Query  544  ELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            E I+LTDGAS GV   LN++IR  NDGIL P+PQYPLYSA I L
Sbjct  144  EDIYLTDGASVGVKYALNALIRDGNDGILCPIPQYPLYSAAIQL  187



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            +N  + K +YAVRGELY RA EL  +G++II+TNVGNPH LG KPLTF R+VI+L  +P+
Sbjct  24   MNPAILKAEYAVRGELYNRAMELAAQGREIIYTNVGNPHQLGGKPLTFNREVISLMLSPW  83

Query  364  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDP  543
            LLD P    +F  + I RA++      G  GAY+DSRG+ G+RKEVA FI  RDG+  DP
Sbjct  84   LLDLPQTQEMFRPEVIERAREMSGFFGGAAGAYTDSRGVAGIRKEVAAFISERDGHACDP  143

Query  544  ELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            E IFLTDGAS  V   L+++IR   D IL P+PQYPLYSA I L
Sbjct  144  ESIFLTDGASVAVRYALHALIRTRQDAILCPIPQYPLYSAAIEL  187



>ref|WP_026853156.1| aminotransferase class I/II [Geothrix fermentans]
Length=451

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 123/166 (74%), Gaps = 4/166 (2%)
 Frame = +1

Query  181  NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAP  360
            +L + V + +YAVRG +  RA+EL+K+G++II+ N+GNP +LGQKPLT+ RQ++ALC+ P
Sbjct  7    DLGKAVLETEYAVRGPIVARAAELEKQGREIIYCNIGNPQSLGQKPLTWNRQILALCEYP  66

Query  361  FLLD-DPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPS  537
             L+D  P     FPAD +  A+  L+ T  GLGAYS+SRG+  +R+ VAEFI  RD    
Sbjct  67   DLMDLAPGA---FPADVVETARAILAGTRHGLGAYSESRGVRFIREGVAEFILERDHMRV  123

Query  538  DPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            DP+ IFLTDGASKGV  IL  +I GP DG++VP+PQYPLYSATI+L
Sbjct  124  DPDAIFLTDGASKGVQTILRLLISGPGDGVMVPIPQYPLYSATITL  169



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 125/182 (69%), Gaps = 13/182 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASEL-------QKEGKK------IIFTNVGNPHALG  309
            +  +N+ +NV+  QYAVRGEL +RA  +       +KEG K      I++ N+GNP  L 
Sbjct  50   MTIDNICQNVRNAQYAVRGELVIRAESISHQLEKQKKEGSKVLPFDEIVYCNIGNPQQLK  109

Query  310  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  489
            QKPLTF RQV++L + P LLD+P +  ++PAD IARA++ L   +   GAYS S+GI  V
Sbjct  110  QKPLTFFRQVVSLTECPELLDNPYIEKIYPADVIARAREILGSINNTTGAYSSSQGISLV  169

Query  490  RKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATI  669
             K VA FI +RDG+P+DP  IFLTDGAS GV +IL  +I+  +DGI++P+PQYPLYSATI
Sbjct  170  LKSVASFIEKRDGHPADPSEIFLTDGASTGVQRILKLLIKDRSDGIMIPIPQYPLYSATI  229

Query  670  SL  675
             L
Sbjct  230  EL  231



>ref|XP_007510961.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66521.1| predicted protein [Bathycoccus prasinos]
Length=480

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 125/179 (70%), Gaps = 9/179 (5%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P++   +N+NV   +YAVRG + +RA EL  + KK         I+  N+GNP +LGQKP
Sbjct  4    PVNANTINQNVLTAEYAVRGPIVVRAGELALQLKKDPSSLPFEDIVLCNIGNPQSLGQKP  63

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  498
            +TF RQ++A+C  P LLD P    +FP D IAR+K+ L+ T+GG GAY++S+G+  VR++
Sbjct  64   ITFYRQIMAICDYPDLLDSPECSKIFPEDVIARSKEVLANTAGGTGAYTESKGLKYVREQ  123

Query  499  VAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            +A F+ +RDG+ +DPE+I+  DGAS GV  +L  +IRG  D +LVP+PQYPLYSA ++L
Sbjct  124  IATFLEKRDGHKADPEMIYTLDGASSGVNYMLTLLIRGKQDAMLVPIPQYPLYSAGLAL  182



>ref|XP_002175263.1| alanine aminotransferase [Schizosaccharomyces japonicus yFS275]
 gb|EEB08970.1| alanine aminotransferase [Schizosaccharomyces japonicus yFS275]
Length=486

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 127/178 (71%), Gaps = 11/178 (6%)
 Frame = +1

Query  172  DYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPLT  324
            D E LN+NV   QYAVRG L +RA EL+ + K+         II  N+GNPH +GQ PLT
Sbjct  12   DPEQLNQNVFAAQYAVRGPLAVRAEELRAQLKEKPDSLPFTEIINANIGNPHQMGQIPLT  71

Query  325  FPRQVIALCQAPFLLDDPNVGL-VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  501
            F RQV+ALCQ P L+++  +   +FP+DAIARAK+ L  T GG+GAYS S+G+P VR++V
Sbjct  72   FIRQVLALCQYPALIENAEITQKLFPSDAIARAKELLEET-GGIGAYSSSQGVPLVRRDV  130

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            A FI  RDG+PSDP  IFLT GA++ V  ++N +I  P  GIL+P+PQYPLY+A+++L
Sbjct  131  ARFIEERDGFPSDPNHIFLTTGATQAVRMMINLLIARPYHGILLPIPQYPLYTASMAL  188



>ref|XP_005648726.1| alanine aminotransferase 2 [Coccomyxa subellipsoidea C-169]
 gb|EIE24182.1| alanine aminotransferase 2 [Coccomyxa subellipsoidea C-169]
Length=505

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 122/178 (69%), Gaps = 8/178 (4%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPL  321
            PL  EN+N  V K QYAVRGE+ +RA EL+ +          KI++ N+GNP  LGQ P+
Sbjct  19   PLALENINPKVVKAQYAVRGEIVIRAKELEDKLHAGEKLPFDKILYCNIGNPQQLGQHPV  78

Query  322  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  501
            TF RQV+A+C  P LL+      +FP D +ARAK++L+   GG GAYSDSRG   +R+++
Sbjct  79   TFYRQVLAICDYPELLESAEAKSIFPPDVLARAKKYLAAIPGGTGAYSDSRGAMVLRQDI  138

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            A+ I  RDGYP DP+ +FLTDGAS+GV  ++  ++R   D +L P+PQYPLYSAT+++
Sbjct  139  AKGIEERDGYPCDPDNLFLTDGASQGVHAMMRLLLRDEKDAVLTPIPQYPLYSATLTM  196



>ref|WP_005033524.1| aminotransferase class I/II [Holophaga foetida]
Length=451

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            +  ++L + V + QYAVRG +  +A ++++EG++II+ N+GNP AL QKPLT+ RQ +AL
Sbjct  3    MQLKDLGKAVLETQYAVRGPIVAKAQDMEREGREIIYCNIGNPQALEQKPLTYLRQTLAL  62

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            CQ P L+       +FPAD +  +++ L     G+GAYSDS+G+  +R+ VAEFI  RDG
Sbjct  63   CQYPELIQ--QAAHLFPADVLENSQRLLVGIEHGMGAYSDSKGVHFIREAVAEFIHERDG  120

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             P+ PE IFL+DGAS+ V  +L  +I GP+DGI+ PVPQYPLYSATI+L
Sbjct  121  IPAHPESIFLSDGASRAVQTVLRMLISGPHDGIMTPVPQYPLYSATITL  169



>ref|XP_637993.1| alanine transaminase [Dictyostelium discoideum AX4]
 sp|Q54MJ7.1|ALAM_DICDI RecName: Full=Probable alanine aminotransferase, mitochondrial; 
Short=ALT; AltName: Full=Glutamate pyruvate transaminase; 
Short=GPT; AltName: Full=Glutamic--alanine transaminase; AltName: 
Full=Glutamic--pyruvic transaminase; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL64484.1| alanine transaminase [Dictyostelium discoideum AX4]
Length=534

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 13/182 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRAS----ELQK---EGKK------IIFTNVGNPHALG  309
            +  +N+ +NV+  QYAVRGEL +RA     +LQK   EG K      I++ N+GNP  L 
Sbjct  54   MTIDNICQNVRNAQYAVRGELVIRAEAISHQLQKQKTEGTKTLPFEEIVYCNIGNPQQLK  113

Query  310  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  489
            QKPLT+ RQV++L + P LLD+P V  ++PAD I+RAK+ L   +   GAYS+S+GI  V
Sbjct  114  QKPLTYFRQVVSLVECPDLLDNPYVEKIYPADVISRAKEILGSINNTTGAYSNSQGIGLV  173

Query  490  RKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATI  669
             + VA+FI RRDG+ SDP  IFLTDGAS GV +IL  +I+  +DGIL+P+PQYPLYSATI
Sbjct  174  LRSVADFIERRDGHKSDPSEIFLTDGASVGVQRILKLLIKDRSDGILIPIPQYPLYSATI  233

Query  670  SL  675
             L
Sbjct  234  EL  235



>emb|CDX91708.1| BnaC08g06270D [Brassica napus]
Length=403

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +1

Query  388  LVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDPELIFLTDG  567
            ++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDGYPSDPELIFLTDG
Sbjct  1    MLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDGYPSDPELIFLTDG  60

Query  568  ASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            ASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  61   ASKGVMQILNCVIRGEGDGILVPVPQYPLYSATISL  96



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 122/180 (68%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+  + +N+ V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  45   PVALDTINQKVLKCEYAVRGEIVTHAQRLQQELQSKPGSHPFEEILYCNIGNPQSLGQQP  104

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD      +F ADAIARA Q L    GG  GAYS S+GI G+R 
Sbjct  105  ITFFREVLALCDHPPLLDKSETHALFSADAIARAWQILDAIPGGATGAYSHSQGIKGLRD  164

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A+ I  RDG+P++P+ IFLTDGAS GV  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  165  TIADGIAARDGFPANPDDIFLTDGASPGVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  224



>emb|CDY25780.1| BnaA07g10020D [Brassica napus]
Length=403

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +1

Query  388  LVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDPELIFLTDG  567
            ++FPADAIARA  +LS+TSGGLGAYSDSRG+PGVRKEVAEFI RRDGYPSDPELIFLTDG
Sbjct  1    MLFPADAIARATHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDGYPSDPELIFLTDG  60

Query  568  ASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            ASKGVMQILN +IRG  DGILVPVPQYPLYSATISL
Sbjct  61   ASKGVMQILNCVIRGAGDGILVPVPQYPLYSATISL  96



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 122/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            +NLN  V KC+YAVRGE+ + A  LQ++ K         +I++ N+GNP +LGQ+P+TF 
Sbjct  8    DNLNPKVLKCEYAVRGEIVIHAQRLQEQLKTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P LL    +  +F AD+I+RAKQ L+M  G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPDLLQREEIKTLFSADSISRAKQILAMIPGRATGAYSHSQGIKGLRDAIAS  127

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P++ + IFLTDGAS GV  ++  +IR   DGILVP+PQYPLYSA+I+L
Sbjct  128  GIASRDGFPANADDIFLTDGASPGVHLMMQLLIRNEKDGILVPIPQYPLYSASIAL  183



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 122/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            +NLN  V KC+YAVRGE+ + A  LQ++ K         +I++ N+GNP +LGQ+P+TF 
Sbjct  26   DNLNPKVLKCEYAVRGEIVIHAQRLQEQLKTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  85

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P LL    +  +F AD+I+RAKQ L+M  G   GAYS S+GI G+R  +A 
Sbjct  86   REVLALCDHPDLLQREEIKTLFSADSISRAKQILAMIPGRATGAYSHSQGIHGLRDAIAS  145

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P++ + IFLTDGAS GV  ++  +IR   DGILVP+PQYPLYSA+I+L
Sbjct  146  GIASRDGFPANADDIFLTDGASPGVHLMMQLLIRNEKDGILVPIPQYPLYSASIAL  201



>ref|XP_008869166.1| hypothetical protein H310_06043 [Aphanomyces invadans]
 gb|ETW02561.1| hypothetical protein H310_06043 [Aphanomyces invadans]
Length=486

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 118/177 (67%), Gaps = 8/177 (5%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L  + +N  V + +YAVRG L L++ ELQK           KII  N+GNP +LGQKP+ 
Sbjct  15   LTKKTINPRVVEAEYAVRGPLVLKSIELQKRLSAGEKLPFDKIISCNIGNPQSLGQKPIQ  74

Query  325  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVA  504
            F R+V+AL   P L+D P+   +F  DAIARAK++L    GG GAY  S+G   VR+EVA
Sbjct  75   FHREVLALVNMPGLVDHPSAPSIFKPDAIARAKRYLQRIPGGTGAYGHSKGADVVREEVA  134

Query  505  EFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            +F+  RDGY +DPE IFLTDGAS+ V  IL + IR  ND ILVP+PQYPLYSA I++
Sbjct  135  QFLYERDGYKADPESIFLTDGASQAVQSILLACIRDENDSILVPIPQYPLYSAAIAI  191



>ref|XP_005825112.1| hypothetical protein GUITHDRAFT_77426 [Guillardia theta CCMP2712]
 gb|EKX38132.1| hypothetical protein GUITHDRAFT_77426 [Guillardia theta CCMP2712]
Length=482

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 120/178 (67%), Gaps = 9/178 (5%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  321
            L  +N+N+N+ + QYAVRG + + A  +QKE          K++++ N+GNPH++GQKP+
Sbjct  11   LTKKNINQNLVEMQYAVRGLVPITAERIQKEILNGDTSKPFKEVLYCNIGNPHSVGQKPI  70

Query  322  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  501
            TF R+V+AL   P LL+   V  +F  D I RAK+ + +  GG GAYS S+GI G+RK V
Sbjct  71   TFYREVLALVDCPMLLEREGVEKLFKPDVIKRAKELIGLIKGGTGAYSHSQGIEGIRKHV  130

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            AEFI  RDG+P+    IFLT+GAS G+  IL +II  P D ILVP+PQYP+YSA I L
Sbjct  131  AEFIKGRDGHPAQVGDIFLTNGASSGIQMILTTIIAEPTDAILVPLPQYPIYSALIKL  188



>ref|XP_010261672.1| PREDICTED: alanine aminotransferase 2-like [Nelumbo nucifera]
Length=528

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 118/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E LN  V KCQYAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  50   PVTAETLNPKVLKCQYAVRGEIVTHAQRLQQELQSKPSSHPFNEILYCNIGNPQSLGQQP  109

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LL+      +F ADAI RA+Q L    G   GAYS S+GI G+R 
Sbjct  110  ITFFREVLALCDHPALLNKSETQGLFSADAIQRAQQILDQIPGRATGAYSHSQGIKGLRD  169

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P+DP  IFLTDGAS GV  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  170  AIAAGIAARDGFPADPNDIFLTDGASPGVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  229



>ref|XP_007409910.1| hypothetical protein MELLADRAFT_43385 [Melampsora larici-populina 
98AG31]
 gb|EGG06950.1| hypothetical protein MELLADRAFT_43385 [Melampsora larici-populina 
98AG31]
Length=484

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 119/182 (65%), Gaps = 13/182 (7%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE------------GKKIIFTNVGNPHALG  309
            PL  +N+N  V + QYAVRGE+ LRA EL+ E               +I  N+GNP  LG
Sbjct  6    PLSIDNINPAVVEAQYAVRGEIALRAEELRNELASDPQAKDRLGFNNVISCNIGNPQQLG  65

Query  310  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  489
            QKPL+F RQV  L + P L+ +P+   +FP+D I RA Q L    G +GAYS S+G+P +
Sbjct  66   QKPLSFTRQVACLTEYPDLIKNPDAKSLFPSDVIERA-QLLLGAIGSVGAYSHSKGVPLI  124

Query  490  RKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATI  669
            R+ VAEF+  RDG+P+DPE I+LT GAS GV  IL  +I  P DG+++P+PQYPLY+A +
Sbjct  125  RQHVAEFLQERDGFPADPESIYLTAGASAGVSNILQLLISSPQDGVMIPIPQYPLYTAAL  184

Query  670  SL  675
            +L
Sbjct  185  AL  186



>ref|XP_011048627.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Populus 
euphratica]
Length=481

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 118/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  + +N  V KCQYAVRGE+   A  +Q+E K         +I++ N+GNP +LGQ+P
Sbjct  3    PVSLDTINPKVLKCQYAVRGEIVTLAQAVQEELKSKPGSRPFDEILYCNIGNPQSLGQQP  62

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            LTF R+V+ALC  PF+LD      +F ADAI RA+Q L    G   GAYS S+GI G+R 
Sbjct  63   LTFFREVLALCDHPFILDKSETRGLFSADAIERARQILDQIPGSATGAYSHSQGIKGLRD  122

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P+DP  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  123  AIAAGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  182



>gb|EFA80185.1| alanine transaminase [Polysphondylium pallidum PN500]
Length=599

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 123/182 (68%), Gaps = 14/182 (8%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASEL-------QKEGKK------IIFTNVGNPHALG  309
            L  +N+   VK  QYAVRGEL +RA  +       +KEG K      I++ N+GNP  L 
Sbjct  120  LTLDNMCPTVKTAQYAVRGELVIRAENIAHLLEKQKKEGTKLLPFNEIVYCNIGNPQQLK  179

Query  310  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  489
            Q+P++F RQV+ALC+ P LL+  +V  VFPADAIARA++ ++ + G  GAYS S+G+  V
Sbjct  180  QQPISFFRQVLALCECPELLNSAHVDKVFPADAIARARELMA-SIGNTGAYSGSQGVASV  238

Query  490  RKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATI  669
             K VA FI  RDG+ +DP  IFLTDGAS  V ++L  +IR  +DGI++P+PQYPLYSATI
Sbjct  239  LKSVAAFIESRDGHAADPSNIFLTDGASVAVQRMLRLLIRDRSDGIMIPIPQYPLYSATI  298

Query  670  SL  675
             L
Sbjct  299  EL  300



>ref|XP_008460349.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X3 [Cucumis melo]
 ref|XP_008460350.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X4 [Cucumis melo]
 ref|XP_008460351.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X5 [Cucumis melo]
Length=436

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLAQKLQEELSAKPGLHPFDEILYCNIGNPQSLGQQP  111

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAYS S+GI G+R 
Sbjct  112  ITFFREVLALCDHPAILDRSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRD  171

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDGYP+DP  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  172  TIAAGIEERDGYPADPNDIFLTDGASPAVHMMMQLLIRSEGDGILCPIPQYPLYSASIAL  231



>ref|XP_004362319.1| alanine transaminase [Dictyostelium fasciculatum]
 gb|EGG24468.1| alanine transaminase [Dictyostelium fasciculatum]
Length=517

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 118/183 (64%), Gaps = 14/183 (8%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------------IIFTNVGNPHAL  306
            +  +N+   VK  QYAVRGEL + A  L K+ ++              I++ N+GNP  L
Sbjct  53   MTMDNICPTVKTAQYAVRGELVIIAESLAKKLQEQQKNNTEKSLPFDEIVYCNIGNPQQL  112

Query  307  GQKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPG  486
             QKP+T+ RQV++LC+ P +LD  ++  +FP+D I RA++ L   +   GAYS S+GI  
Sbjct  113  KQKPITYFRQVLSLCEYPGMLDSAHIDKIFPSDVITRARELLGSINFTTGAYSGSQGIAH  172

Query  487  VRKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSAT  666
            V K VA FI  RDG+PSDP  IFLTDGAS  V +IL  +IR  NDGIL+P+PQYPLYSAT
Sbjct  173  VTKNVASFIESRDGHPSDPSDIFLTDGASVAVQRILRLLIRDRNDGILIPIPQYPLYSAT  232

Query  667  ISL  675
            I L
Sbjct  233  IEL  235



>ref|XP_002176328.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42720.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=464

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 121/166 (73%), Gaps = 3/166 (2%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  363
            +++++++ QYAVRGE+ L+A +L  EG+KI +TNVGNPHA+GQ+P+TF RQV+ALC  P 
Sbjct  1    MSQSLRRMQYAVRGEVVLKADKLAAEGRKITYTNVGNPHAVGQQPITFYRQVLALCDLPA  60

Query  364  L--LDDPNVGLVFPADAIARAKQFLSMT-SGGLGAYSDSRGIPGVRKEVAEFIGRRDGYP  534
               +D PN   +FP D + RA++   +   GG G+Y++S+G+ G+RK VAE+I  RDG+ 
Sbjct  61   SCGVDHPNASQLFPLDVLERARELRGIVGKGGTGSYTNSQGLAGIRKHVAEYILNRDGHS  120

Query  535  SDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATIS  672
            +    IFLT+GAS G+  ILN +I   +D I++P+PQYP+YSA I+
Sbjct  121  AYEGDIFLTNGASTGIEFILNGLISHDHDAIMIPIPQYPIYSALIT  166



>dbj|GAM23260.1| hypothetical protein SAMD00019534_064350 [Acytostelium subglobosum 
LB1]
Length=531

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 126/182 (69%), Gaps = 14/182 (8%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASEL-------QKEGKK------IIFTNVGNPHALG  309
            L  +N+   V+  QYAVRGEL +RA +L       + EG K      I++ N+GNP  L 
Sbjct  53   LTLDNMCPTVRTAQYAVRGELVIRAEKLVSTLDRQKNEGIKLLPFEEIVYCNIGNPQQLK  112

Query  310  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  489
            QKPL+F RQV+ALC+ P LL+ P++  +FPADAIARA+  L  + G  GAYS S+GI  V
Sbjct  113  QKPLSFFRQVVALCECPELLESPHIDKIFPADAIARARA-LLASVGNTGAYSGSQGIASV  171

Query  490  RKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATI  669
             + VA+FI +RDGYP+DPE IFLTDGAS  V +IL  +IR  +DGIL+P+PQYPLYSATI
Sbjct  172  LRSVAKFIEKRDGYPADPESIFLTDGASVAVQRILRLLIRDRSDGILIPIPQYPLYSATI  231

Query  670  SL  675
             L
Sbjct  232  EL  233



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 121/180 (67%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            PL ++++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  40   PLTFDSINPKVLKCEYAVRGEIVSHAQRLQQELQTKPGSYPFDEILYCNIGNPQSLGQQP  99

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F +DAIARA+Q L +  G   GAYS S+GI G+R 
Sbjct  100  VTFFREVLALCDHPSILDKSEAHALFSSDAIARARQILDLIPGRATGAYSHSQGIKGLRD  159

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++ + IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  160  AIAAGIAARDGFPANADDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  219



>dbj|GAA97564.1| hypothetical protein E5Q_04242 [Mixia osmundae IAM 14324]
 gb|KEI42010.1| hypothetical protein L969DRAFT_91476 [Mixia osmundae IAM 14324]
Length=574

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 122/179 (68%), Gaps = 11/179 (6%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK----------IIFTNVGNPHALGQKP  318
            L  +++N NVK  +YAVRG + LRA EL+ + +K          ++  N+GNP  LGQ P
Sbjct  98   LTLDSINHNVKTAEYAVRGAIALRAEELRVKTQKGDTKDLNFKEVVSCNIGNPQQLGQTP  157

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  498
            +TF RQV ALC+ P LLD+P    +F  DAI RA++++    G +GAYS S+G+P +R+ 
Sbjct  158  ITFFRQVAALCECPDLLDNPLAPKLFAQDAIDRAREYIKAI-GSVGAYSHSKGVPLIRQY  216

Query  499  VAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            VA+F+  RDG+ +DPE I+LT GAS GV  I+  +I  PNDG+++P+PQYPLY+A ++L
Sbjct  217  VADFLEERDGHKADPEKIYLTAGASAGVSNIMQLMIASPNDGVMIPIPQYPLYTAALAL  275



>ref|XP_009826737.1| hypothetical protein H257_04062 [Aphanomyces astaci]
 gb|ETV83307.1| hypothetical protein H257_04062 [Aphanomyces astaci]
Length=486

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 118/177 (67%), Gaps = 8/177 (5%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L  + +N  + + +YAVRG L L++ ELQK           KII  N+GNP +LGQKP+ 
Sbjct  15   LTKKTINPRIVEAEYAVRGPLVLKSIELQKRLSAGEKLPFDKIISCNIGNPQSLGQKPIQ  74

Query  325  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVA  504
            F R+V+AL   P L+D P+   +F  DAI+RAK++L    GG GAY  S+G   VR+EVA
Sbjct  75   FHREVLALVNMPGLVDHPSAPSIFKPDAISRAKRYLKRIPGGTGAYGHSKGSDVVREEVA  134

Query  505  EFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            +F+  RDGY +DP+ IFLTDGAS+ V  IL + IR  ND ILVP+PQYPLYSA I++
Sbjct  135  QFLLERDGYEADPDTIFLTDGASQAVQSILLACIRDENDSILVPIPQYPLYSAAIAI  191



>ref|XP_011079322.1| PREDICTED: alanine aminotransferase 2-like [Sesamum indicum]
Length=542

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            PL  + +N  V +C+YAVRGE+ + A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  64   PLTLDTINPKVLECEYAVRGEIVILAQRLQEELKNNPNAHPFDEILYCNIGNPQSLGQQP  123

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD      +F AD+I RA + L    G   GAYS S+GI G+R 
Sbjct  124  ITFFREVLALCDHPALLDKAETRGLFSADSIERASEILHQIPGRATGAYSHSQGIRGLRD  183

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            ++A  I  RDGYP+DP  IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  184  KIAAGIEARDGYPADPNDIFLTDGASPAVHTMMQLLIRSKNDGILCPIPQYPLYSASIAL  243



>ref|XP_008620886.1| alanine transaminase [Saprolegnia diclina VS20]
 gb|EQC25667.1| alanine transaminase [Saprolegnia diclina VS20]
Length=489

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 119/178 (67%), Gaps = 9/178 (5%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  321
            L  + +N  + + +YAVRG + LR+   +K+           KII  N+GNP +LGQKP+
Sbjct  14   LTKQTINPRIVEAEYAVRGAIVLRSDAYKKQLASGDKSLPFDKIIACNIGNPQSLGQKPI  73

Query  322  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  501
            TF R+V++L   P L+D  +   +F ADAIARAK +LS    G GAY  S+G   +R+EV
Sbjct  74   TFHREVLSLINMPGLVDHEDAPKIFKADAIARAKYYLSKIPSGTGAYGHSKGHEVLREEV  133

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
              F+ RRDG+ +DPE IFLTDGAS+ V  +L ++IR  NDGILVP+PQYPLYSATI++
Sbjct  134  CAFLERRDGHAADPETIFLTDGASQAVQSMLLALIRDHNDGILVPIPQYPLYSATIAI  191



>ref|XP_002946490.1| hypothetical protein VOLCADRAFT_120326 [Volvox carteri f. nagariensis]
 gb|EFJ52417.1| hypothetical protein VOLCADRAFT_120326 [Volvox carteri f. nagariensis]
Length=840

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 122/179 (68%), Gaps = 9/179 (5%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQK---EGK------KIIFTNVGNPHALGQKP  318
            PL  + +N+ V   +YAVRGE+   A ++ +   EGK      K+++ N+GNP  LGQKP
Sbjct  294  PLSIDTINKRVINSEYAVRGEIVQLAQKIARDLEEGKGSHPFDKVVWCNIGNPQILGQKP  353

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  498
            +T+ RQV+ALC+ P LLD P +  +FP D IARA+  +    GGLGAYSDS G   +R+ 
Sbjct  354  ITYFRQVLALCECPQLLDHPQIRELFPDDVIARAQLLVKAIPGGLGAYSDSAGALILRQL  413

Query  499  VAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            VA  I RRDGYP+ PE I++TDGAS  V  +++ ++R P D ++VP+PQYPLYSAT++L
Sbjct  414  VARSIARRDGYPASPENIYMTDGASPAVHYMMDLLLREPTDSMMVPIPQYPLYSATLTL  472



>gb|KIZ01751.1| alanine transaminase [Monoraphidium neglectum]
Length=351

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 116/174 (67%), Gaps = 9/174 (5%)
 Frame = +1

Query  181  NLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPLTFPR  333
            ++   + + +YAVRGE+  RA E+ ++ +K         +++ N+GNP  LGQKP+T+ R
Sbjct  3    SIRPRIVQVEYAVRGEIVRRAQEIAEDLEKGHGEHPFDKVVWCNIGNPQILGQKPITYFR  62

Query  334  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFI  513
            QV+ LC+ P LL  P V  +FPAD I RA+QFL+   GGLGAYSDS G    R+++A  I
Sbjct  63   QVLCLCEYPELLKHPEVTALFPADVIKRAEQFLAEIPGGLGAYSDSAGAAVCRRQIAAAI  122

Query  514  GRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             RRDG P D   ++LTDGAS GV  ++  +IR  +D  LVP+PQYPLYSAT++L
Sbjct  123  ERRDGVPCDMSELYLTDGASPGVHYLMEMLIRDSSDAWLVPIPQYPLYSATLTL  176



>ref|XP_008460347.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
melo]
Length=530

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLAQKLQEELSAKPGLHPFDEILYCNIGNPQSLGQQP  111

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAYS S+GI G+R 
Sbjct  112  ITFFREVLALCDHPAILDRSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRD  171

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDGYP+DP  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  172  TIAAGIEERDGYPADPNDIFLTDGASPAVHMMMQLLIRSEGDGILCPIPQYPLYSASIAL  231



>emb|CEG81302.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=231

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 121/180 (67%), Gaps = 12/180 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE---GK-----KIIFTNVGNPHALGQKPLT  324
            +  +++N  VK  +YAVRG+L +RA EL++E   GK     +++  N+GNP  L Q+P+ 
Sbjct  11   MTIKSINPLVKNVEYAVRGKLAIRAEELKQELEEGKEYPFGRVVNCNIGNPQQLNQQPIK  70

Query  325  FPRQVIALCQAPFLLDDPNVGLV---FPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  495
            F RQV +LC  P LL   N  LV   +P DAI RAK+ +  + G +G+YS S+G+P +R+
Sbjct  71   FYRQVSSLCDNPDLLKKENYHLVSQLYPTDAIERAKKLMK-SIGSVGSYSHSQGVPAIRQ  129

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             VA+FI  RDG+PSDP  IFLT GAS GV  +L+ +    N GI++P+PQYPLYSA+++L
Sbjct  130  TVAQFIKERDGHPSDPNHIFLTQGASSGVQTLLSLLTENSNSGIMIPIPQYPLYSASLAL  189



>gb|ETM43767.1| hypothetical protein L914_10885, partial [Phytophthora parasitica]
Length=242

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 113/178 (63%), Gaps = 9/178 (5%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  321
            L  + +N N+ K +YAVRG L LR++E +             K+I  N+GNP  L Q+P+
Sbjct  24   LTADTINPNIVKAEYAVRGALVLRSNEYENRLANGDKSLPFDKVIPCNIGNPQVLDQEPI  83

Query  322  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  501
             F RQV+AL   P L+D P    +F  DAIARAK ++    GG GAY  S+G   VR+EV
Sbjct  84   EFQRQVLALVNVPGLVDQPEAQKLFQPDAIARAKFYIDNIPGGTGAYGHSKGSAVVREEV  143

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            A F+ RRDG+P+DPE I+LTDGAS  V   L ++IR  ND I+ P+PQYPLYSA I++
Sbjct  144  ARFLQRRDGHPADPEDIYLTDGASPAVQNSLLALIRDENDAIMAPIPQYPLYSAAIAI  201



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 120/180 (67%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+ + ++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  52   PVTFASINPKVLKCEYAVRGEIVSHAQRLQQELQTKPDSHPFDEILYCNIGNPQSLGQQP  111

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F +DAIARA+Q L +  G   GAYS S+GI GVR 
Sbjct  112  VTFFREVLALCDHPSILDKSETHALFSSDAIARARQILDLIPGRATGAYSHSQGIKGVRD  171

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++ + IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  172  AIAAGITARDGFPANADDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  231



>gb|KDO53769.1| hypothetical protein CISIN_1g009517mg [Citrus sinensis]
Length=360

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (66%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            ++LN  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P+TF 
Sbjct  59   DSLNPKVLKCEYAVRGEIVSIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFF  118

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P +LD      +F AD+I RA Q L    G   GAYS S+GI G+R  +A 
Sbjct  119  REVLALCDHPSILDRSETQGLFSADSIERAWQILDQIPGRATGAYSHSQGIKGLRDTIAA  178

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P+DP  IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  179  GIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  234



>ref|XP_002304255.2| hypothetical protein POPTR_0003s07020g [Populus trichocarpa]
 gb|EEE79234.2| hypothetical protein POPTR_0003s07020g [Populus trichocarpa]
Length=481

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 117/180 (65%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  3    PVSLDNINPKVLKCEYAVRGEIVTLAQALQEELKSKPGSHPFDEILYCNIGNPQSLGQQP  62

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R 
Sbjct  63   ITFFREVLALCDHPSILDRSETQGLFSADAIERAWQILDQIPGRATGAYSHSQGIKGLRD  122

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P+DP  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  123  TIAAGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  182



>gb|KDO24164.1| hypothetical protein SPRG_10592 [Saprolegnia parasitica CBS 223.65]
Length=489

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 119/178 (67%), Gaps = 9/178 (5%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  321
            L  + +N  + + +YAVRG + LR+   +K+           KII  N+GNP +LGQKP+
Sbjct  14   LTKQTINPRIVEAEYAVRGAIVLRSDAYKKQLASGDKSLPFDKIIACNIGNPQSLGQKPI  73

Query  322  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  501
            +F R+V++L   P L+D  +   +F ADAIARAK +LS    G GAY  S+G   +R+EV
Sbjct  74   SFHREVLSLINMPGLVDHEDAPKIFKADAIARAKYYLSKIPSGTGAYGHSKGHEVLREEV  133

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
              F+ RRDG+ +DPE IFLTDGAS+ V  +L ++IR  NDGILVP+PQYPLYSATI++
Sbjct  134  CAFLERRDGHAADPETIFLTDGASQAVQSMLLALIRDQNDGILVPIPQYPLYSATIAI  191



>ref|XP_005775483.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
 gb|EOD23054.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
Length=541

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 125/185 (68%), Gaps = 16/185 (9%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPL  321
            L    +N NV   QYAVRGEL  RA+ +++E          KK++  N+GNP A+GQ P+
Sbjct  48   LTLGEINPNVLSAQYAVRGELVQRAAAIKEEMAAGSANVPFKKVLECNIGNPQAVGQSPI  107

Query  322  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARA------KQFLSMTSGGLGAYSDSRGIP  483
             F RQV++L   P LLD P V  +F  DAIARA      K++L+    G+GAYSDS+G  
Sbjct  108  GFNRQVLSLMVCPALLDQPGVDALFAPDAIARATRLARAKEYLAAIPSGVGAYSDSQGFR  167

Query  484  GVRKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIR-GPNDGILVPVPQYPLYS  660
             VR++VA+FI  RDG P+ PE IFLTDGASKGV  +L+ I+R G +DG+LVP+PQYPLYS
Sbjct  168  IVREQVADFISSRDGLPASPEDIFLTDGASKGVGFLLSLILRGGGSDGLLVPIPQYPLYS  227

Query  661  ATISL  675
            AT++L
Sbjct  228  ATLAL  232



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  + +N  V KCQYAVRG +   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  9    PVSIDTINPKVLKCQYAVRGAIVSHAQRLQQELQTSQGSLPFDEILYCNIGNPQSLGQQP  68

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LL   N+  +F  DAI RA++ L +  G   GAYS S+GI G+R 
Sbjct  69   ITFFREVLALCDHPALLGKSNIDALFSKDAIGRAQKILDLIPGRATGAYSHSQGIKGLRD  128

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++ + IFLTDGAS GV  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  129  AIAAGIAIRDGFPANADDIFLTDGASPGVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  188



>ref|XP_009382959.1| PREDICTED: alanine aminotransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=522

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 117/176 (66%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            + +N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P+TF 
Sbjct  48   DTINPKVLKCEYAVRGEIVSHAQRLQQELQDKPGSHPFDEILYCNIGNPQSLGQQPVTFF  107

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P LLD      +F ADAIARA Q L +  G   GAYS S+GI G+R  +A 
Sbjct  108  REVLALCDHPSLLDKSETHALFSADAIARAWQILDVIPGRATGAYSHSQGIKGLRDAIAA  167

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P++P+ IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  168  GIADRDGFPANPDDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  223



>ref|XP_011072689.1| PREDICTED: alanine aminotransferase 2 [Sesamum indicum]
Length=547

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  +++N  V +C+YAVRGE+   A +LQ+E KK         I++ N+GNP +LGQ+P
Sbjct  69   PVKLDSINPKVLECEYAVRGEIVTLAQKLQEELKKNPGSHPFDEILYCNIGNPQSLGQQP  128

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F AD+I RA Q L    G   GAYS S+GI G+R 
Sbjct  129  ITFFREVLALCDHPAILDKAETQGLFSADSIERAFQILDQIPGRATGAYSHSQGIKGLRD  188

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P+DP  IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  189  TIAAGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSKNDGILCPIPQYPLYSASIAL  248



>ref|XP_005833147.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
 gb|EKX46167.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
Length=473

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 119/174 (68%), Gaps = 8/174 (5%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLTFPR  333
            +++N  V + QYAVRG L LRA + ++  ++        I++ N+GNPH L QKP+TF R
Sbjct  6    DSINPKVLEAQYAVRGALVLRAMQHERALQQKQTLPFNEILYCNIGNPHQLKQKPITFFR  65

Query  334  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFI  513
            QV+AL   P LLD      VFPADAIARAK F   T GG GAYS+S+G+  VR+ VA+FI
Sbjct  66   QVLALTDYPDLLDMQGCSEVFPADAIARAKDFHKNTPGGTGAYSESQGLRHVRENVAKFI  125

Query  514  GRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +RDG  +  + IFLTDGAS+GV   +  +++   DGI++P+PQYPLY+ATISL
Sbjct  126  AKRDGVTAYADDIFLTDGASQGVHISIMCLVKNELDGIMIPIPQYPLYTATISL  179



>ref|XP_004144444.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=528

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 115/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  50   PLSIATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQP  109

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAYS S+GI G+R 
Sbjct  110  ITFFREVLALCDHPAILDKSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRD  169

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDGYP+DP   FLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  170  TIAAGIEARDGYPADPNDFFLTDGASPAVHMMMQLLIRSEGDGILCPIPQYPLYSASIAL  229



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+ ++++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  48   PVTFDSINPKVLKCEYAVRGEIVSHAQRLQQELQTKPGSRPFDEILYCNIGNPQSLGQQP  107

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F ADAIARA Q L +  G   GAYS S+GI G+R 
Sbjct  108  ITFFREVLALCDHPSILDKSETHALFSADAIARAWQILDLIPGRAGGAYSHSQGIKGLRD  167

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++   IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  168  AIAAGIAARDGFPANANDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  227



>gb|KGN58474.1| hypothetical protein Csa_3G646610 [Cucumis sativus]
Length=535

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 115/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  57   PLSIATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQP  116

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAYS S+GI G+R 
Sbjct  117  ITFFREVLALCDHPAILDKSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRD  176

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDGYP+DP   FLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  177  TIAAGIEARDGYPADPNDFFLTDGASPAVHMMMQLLIRSEGDGILCPIPQYPLYSASIAL  236



>emb|CDO97792.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  +++N  V KC+YAVRGE+   A +L+++ K+         II+ N+GNP +LGQ+P
Sbjct  9    PVTLQSVNPKVLKCEYAVRGEIVTLAQKLEQDLKQNPDSHPFDEIIYCNIGNPQSLGQQP  68

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R+
Sbjct  69   ITFFREVLALCDHPAILDRSETQGLFSADAIERAFQILDQIPGRATGAYSHSQGIKGLRE  128

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P+DP  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  129  TIAAGIAERDGFPADPNDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  188



>ref|XP_010917381.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Elaeis 
guineensis]
Length=470

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMT-SGGLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAYS S+GI G+R+
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAYSHSQGIKGLRE  171

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++ + IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  172  AIAVGIAERDGFPANADDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  231



>ref|XP_010917380.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Elaeis 
guineensis]
Length=488

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMT-SGGLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAYS S+GI G+R+
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAYSHSQGIKGLRE  171

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++ + IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  172  AIAVGIAERDGFPANADDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  231



>gb|KFH67262.1| alanine transaminase [Mortierella verticillata NRRL 6337]
Length=540

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 121/180 (67%), Gaps = 12/180 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L  +N+NE V+K +YAVRGEL +R+ EL+ E         K+++  N+GNP AL QKP+T
Sbjct  62   LTSKNMNEQVRKAEYAVRGELAIRSEELKNELAKGVKLPFKRVVGCNIGNPQALDQKPIT  121

Query  325  FPRQVIALCQAPFLLDDPNVGL---VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  495
            F RQV +L + P LL D N  L   ++P+DAI RAK  L    G +GAYS S+GIP +R+
Sbjct  122  FFRQVASLTEYPELLKDENRELALKIYPSDAIDRAKLLLKHI-GSVGAYSHSQGIPHIRE  180

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             VA+FI +RDG+ +DP  IFLT GAS GV   L  I+     GI++P+PQYPLY+AT+S+
Sbjct  181  NVAKFIEKRDGFAADPSKIFLTQGASAGVQLTLQMIVENNKVGIMIPIPQYPLYTATLSV  240



>ref|XP_006680648.1| hypothetical protein BATDEDRAFT_20287 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78436.1| hypothetical protein BATDEDRAFT_20287 [Batrachochytrium dendrobatidis 
JAM81]
Length=492

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 124/181 (69%), Gaps = 12/181 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQK---EG------KKIIFTNVGNPHALGQKPL  321
            +  E++N+ V + +YAVRG   +RA +L+K   EG      K+I+  N+GNP  L Q P+
Sbjct  13   MSLESINQKVVQFEYAVRGAQAIRAEQLRKQLVEGPNDLPFKEIVSCNIGNPQQLKQLPI  72

Query  322  TFPRQVIALCQAPFLLDDPNVGL---VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVR  492
            TF RQV ALC+ P L++  N+ +   +F  DAI RAK+ L+   G  GAY+ S+GIP VR
Sbjct  73   TFYRQVSALCEYPDLMNAANLPVTSKIFAKDAIERAKELLTAMGGSTGAYTHSQGIPLVR  132

Query  493  KEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATIS  672
            + VAEFI +RDG+PSDP+ IFLT GAS GV  +L ++I   + GI++P+PQYPLY+A+IS
Sbjct  133  QRVAEFIEKRDGFPSDPDSIFLTAGASPGVQMVLQTLISSDDVGIMIPIPQYPLYTASIS  192

Query  673  L  675
            L
Sbjct  193  L  193



>ref|XP_003573850.1| PREDICTED: alanine aminotransferase 2 [Brachypodium distachyon]
Length=481

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 122/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  330
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQNQPGSLPFHEILYCNIGNPQSLGQQPVTFF  67

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P+LL    +  +F AD+I+RAKQ L++  G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPYLLQREEIKSLFSADSISRAKQILALIPGRATGAYSHSQGIKGLRDAIAA  127

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P++ + IFLTDGAS GV  ++  +IR   DGILVP+PQYPLYSA+I+L
Sbjct  128  GITARDGFPANADDIFLTDGASPGVHLMMQLLIRNEKDGILVPIPQYPLYSASIAL  183



>ref|XP_005838227.1| hypothetical protein GUITHDRAFT_103164 [Guillardia theta CCMP2712]
 gb|EKX51247.1| hypothetical protein GUITHDRAFT_103164 [Guillardia theta CCMP2712]
Length=483

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 115/177 (65%), Gaps = 8/177 (5%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  324
            L  E +N  V   QYA+RG L LRA + ++  K+        II+ N+GNP  L QKP+T
Sbjct  13   LTAETINPKVLDAQYAIRGALVLRAMQHERNLKESVRMPFDEIIYCNIGNPQQLNQKPIT  72

Query  325  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVA  504
            F RQV+AL   P L++ P    +FP DAI RA+ F S   GG GAYS+S+GI  VR+ VA
Sbjct  73   FFRQVLALMDYPDLVEMPKAKKLFPEDAIERARMFFSNIPGGTGAYSESQGIRLVREHVA  132

Query  505  EFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            E+I +RD   +  + IFLTDG S+GV   +N +IR   DGIL+P+PQYPLY+ATISL
Sbjct  133  EYISKRDNLVASADDIFLTDGVSQGVNMSMNVLIRNEKDGILIPIPQYPLYTATISL  189



>tpg|DAA59363.1| TPA: putative MATE efflux family protein isoform 1 [Zea mays]
 tpg|DAA59364.1| TPA: putative MATE efflux family protein isoform 2 [Zea mays]
Length=399

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  391  VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPSDPELIFLTDGA  570
            +FPADAIARAK +L+M  GGLGAYSDSRGIPG+RKEVA+FI +RDGYPSDPELI+LTDGA
Sbjct  1    MFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIRKEVADFIHKRDGYPSDPELIYLTDGA  60

Query  571  SKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            SKGVMQILN+IIR   DGILVPVPQYPLYSATISL
Sbjct  61   SKGVMQILNTIIRNEMDGILVPVPQYPLYSATISL  95



>ref|XP_010917379.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Elaeis 
guineensis]
Length=516

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMT-SGGLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAYS S+GI G+R+
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAYSHSQGIKGLRE  171

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++ + IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  172  AIAVGIAERDGFPANADDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  231



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 118/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+  E +N  VKKC+YAVRGE+   A  LQ+E          ++I++ N+GNP ALGQ+P
Sbjct  52   PITVETINPKVKKCEYAVRGEIVSHAQRLQQELQTKPRSHPFEEILYCNIGNPQALGQQP  111

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMT-SGGLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD      +F +DAIA+A + L +      GAYS S+GI G+R+
Sbjct  112  ITFFREVLALCNYPALLDRDETHALFSSDAIAKAWEILDLIPDRATGAYSHSQGIKGLRE  171

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P+  + IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  172  AIAVGIAERDGFPAKADDIFLTDGASPAVHMMMQLLIRSEEDGILCPIPQYPLYSASIAL  231



>gb|EPZ32571.1| Aminotransferase, class I/classII domain-containing protein [Rozella 
allomycis CSF55]
Length=284

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 120/182 (66%), Gaps = 14/182 (8%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  321
            L   N+N  + + QYAVRGE+ +RA +L+KE          KKII  N+GNP  L QKP+
Sbjct  10   LQLRNINSKILQTQYAVRGEIAIRAEQLRKELESNPQSFPFKKIINCNIGNPQQLNQKPI  69

Query  322  TFPRQVIALCQAPFLLDDP----NVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  489
            TF RQ+++L + P L  +      +  ++P D I RA+Q L   SG +GAYS S+GIP V
Sbjct  70   TFFRQIMSLLEYPELFKNTEYLDKIKYIYPNDVINRAQQILRQ-SGPIGAYSHSKGIPYV  128

Query  490  RKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATI  669
            R  VA++I  RDGY S+PE IFLT+GAS  V  IL+ II+  + G+L+P+PQYPLYSA++
Sbjct  129  RNAVAKYIHERDGYESNPEHIFLTNGASPAVQMILSVIIQHLDVGVLIPIPQYPLYSASL  188

Query  670  SL  675
            +L
Sbjct  189  AL  190



>gb|KDO53768.1| hypothetical protein CISIN_1g009517mg [Citrus sinensis]
Length=434

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (66%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            ++LN  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P+TF 
Sbjct  59   DSLNPKVLKCEYAVRGEIVSIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFF  118

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P +LD      +F AD+I RA Q L    G   GAYS S+GI G+R  +A 
Sbjct  119  REVLALCDHPSILDRSETQGLFSADSIERAWQILDQIPGRATGAYSHSQGIKGLRDTIAA  178

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P+DP  IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  179  GIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  234



>ref|WP_012096788.1| aminotransferase class I/II [Anaeromyxobacter sp. Fw109-5]
 gb|ABS26209.1| aminotransferase class I and II [Anaeromyxobacter sp. Fw109-5]
Length=457

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQA  357
            E++   V++ QYAVRG +  RA EL+++G+++I+ N+GNP +LGQ+PL++ RQV+A+ + 
Sbjct  6    EDVAPVVREAQYAVRGPIVARAQELERQGREVIYCNIGNPQSLGQRPLSWVRQVLAIAEW  65

Query  358  PFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDGYPS  537
            P LL+    G  F AD +A A++ L  +  GLGAY++S+G   VR+ VA FI  RDG  +
Sbjct  66   PELLERVPAG-TFAADVVAVAREVLRGSEHGLGAYTESKGYHFVREAVAAFIRDRDGIEA  124

Query  538  DPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            D E ++LTDGASKGV  +L  ++    DGIL+P+PQYPLYSATI+L
Sbjct  125  DAEHVYLTDGASKGVQSVLRLLVTDARDGILIPIPQYPLYSATITL  170



>ref|XP_010917378.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Elaeis 
guineensis]
Length=534

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMT-SGGLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAYS S+GI G+R+
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAYSHSQGIKGLRE  171

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++ + IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  172  AIAVGIAERDGFPANADDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  231



>ref|XP_011127540.1| hypothetical protein AOL_s00215g36 [Arthrobotrys oligospora ATCC 
24927]
 gb|EGX43300.1| hypothetical protein AOL_s00215g36 [Arthrobotrys oligospora ATCC 
24927]
Length=487

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 124/181 (69%), Gaps = 13/181 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPL  321
            L+Y+N+N +VK  +YAVRGEL ++A  +++E +          +IF N+GNP  L QKP+
Sbjct  10   LNYDNINPHVKAAKYAVRGELAVKAEAIRREIELDPSSHPFDHVIFANIGNPQQLDQKPI  69

Query  322  TFPRQVIALCQAPFLLDDPNVGL---VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVR  492
            TF RQV++L Q P LL + N  +   ++P DA+ RAK  L      +GAYS S+G P +R
Sbjct  70   TFFRQVLSLIQYPDLLQESNAEVAKQLYPEDALERAKWLLKSVKS-VGAYSHSQGAPPLR  128

Query  493  KEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATIS  672
              VA++I +RDG+P+DPE I+LT GAS GV  +L+ I  GPN G+++P+PQYPLY+AT++
Sbjct  129  DSVAKYIEQRDGHPADPESIYLTTGASSGVNTLLHVIAAGPNTGVMIPIPQYPLYTATLA  188

Query  673  L  675
            L
Sbjct  189  L  189



>gb|ETM43759.1| hypothetical protein L914_10880, partial [Phytophthora parasitica]
Length=227

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 110/178 (62%), Gaps = 9/178 (5%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  321
            L     N  V K +YAVRG L LR++E +             KII  N+GNP  L Q+P+
Sbjct  9    LTTATFNPKVVKAEYAVRGALVLRSNEYENRLANGDKSLPFDKIIPCNIGNPQVLKQEPI  68

Query  322  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  501
             F RQV+AL   P L+D P    +F  DAIARAK ++    GG GAY  S+G   VR+EV
Sbjct  69   EFHRQVLALVNVPGLVDQPEAQKLFQPDAIARAKFYIDNIPGGTGAYGHSKGSAVVREEV  128

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            A F+ RRDG+P+DPE I+LTDGAS  V   L ++IR  ND I+ P+PQYPLYSA I++
Sbjct  129  ARFLQRRDGHPADPEDIYLTDGASPAVQNSLLALIRDENDAIMAPIPQYPLYSAAIAI  186



>ref|XP_002906656.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
 gb|EEY66057.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
Length=499

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 9/178 (5%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  321
            L  + +N N+ K +YAVRG L LR++E +             K+I  N+GNP  L Q+P+
Sbjct  24   LTADTINPNIVKAEYAVRGALVLRSNEYENRLANGDKSLPFDKVIPCNIGNPQVLKQEPI  83

Query  322  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  501
             F RQV+AL   P L+D P    +FP DAIARAK ++    GG GAY  S+G   VR+EV
Sbjct  84   EFQRQVLALVNVPGLVDQPEAQKLFPPDAIARAKFYIDNIVGGTGAYGHSKGSAVVREEV  143

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            A F+ RRDG+P+DPE I+LTDGAS  V   L S+IR  ND I+ P+PQYPLYSA I++
Sbjct  144  ARFMQRRDGHPADPEDIYLTDGASPAVQNSLLSLIRDENDAIMAPIPQYPLYSAAIAI  201



>ref|XP_010273809.1| PREDICTED: alanine aminotransferase 2-like [Nelumbo nucifera]
Length=522

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 113/176 (64%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFP  330
            E +N  V  C+YAVRGE+   A  LQ+E          K+I++ N+GNP +LGQ+P+T+ 
Sbjct  48   ETINPKVLNCEYAVRGEIVTHAQHLQQELQEKPGSHPFKEILYCNIGNPQSLGQQPITYF  107

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R  +A 
Sbjct  108  REVLALCDHPTILDRSETQGLFSADAIERAWQILDQIPGRATGAYSHSQGIKGLRDAIAA  167

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P+DP  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  168  GIAARDGFPADPNDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  223



>gb|AGT60040.1| aminotransferase [uncultured bacterium]
Length=462

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 116/169 (69%), Gaps = 1/169 (1%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  348
            + + NLN+ +   +YAVRG++  RA EL+K GKKI + N+GNPHA  QKPL++ R+V++L
Sbjct  2    ITFNNLNQKLIDAEYAVRGKIVTRAQELEKTGKKITYCNIGNPHAFAQKPLSYVREVLSL  61

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
             + P LL+     L F +D+I RA+  L     G+GAYS S G+  VR+ VA+FI  RD 
Sbjct  62   LEFPDLLERDLTNL-FHSDSIERARYILRQIPEGVGAYSASAGVEFVREAVAKFIATRDN  120

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             P++ + I LTDGASK    ++ +II+  NDG++VPVPQYP+YSA ++L
Sbjct  121  IPTNHDRIILTDGASKAAQSVIAAIIKNQNDGLMVPVPQYPMYSAALTL  169



>dbj|GAN09782.1| alanine transaminase [Mucor ambiguus]
Length=512

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 120/181 (66%), Gaps = 13/181 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  321
            L  E ++  VK  +YAVRG L +RA  L ++ KK         ++F N+GNP  L QKP+
Sbjct  33   LTTETMHPLVKSVEYAVRGALPIRAEALSQQLKKDPSKLNFDRVVFCNIGNPQQLNQKPI  92

Query  322  TFPRQVIALCQAPFLLDDPNVGLV---FPADAIARAKQFLSMTSGGLGAYSDSRGIPGVR  492
            TF RQV +LC+ P LL   N  LV   +PADAIARA Q L    G +GAYS S+GI  +R
Sbjct  93   TFFRQVASLCENPELLKTENRALVSKLYPADAIARA-QVLLKNIGSVGAYSHSKGITHIR  151

Query  493  KEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATIS  672
            + VA+FI RRDGY ++PE IFLT GAS+GV +++  + +    GI++P+PQYPLYSAT+S
Sbjct  152  ENVAKFIERRDGYAANPEDIFLTQGASEGVQKVIQLLTQNQQSGIMIPIPQYPLYSATLS  211

Query  673  L  675
            L
Sbjct  212  L  212



>ref|XP_010937250.1| PREDICTED: alanine aminotransferase 2 [Elaeis guineensis]
Length=526

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 118/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +L Q+P
Sbjct  48   PVTLDSINPKVIKCEYAVRGEIVSHAQRLQQELQTKPGAHPFDEILYCNIGNPQSLAQQP  107

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F ADAIARA Q L +  G   GAYS S+GI G+R 
Sbjct  108  ITFFREVLALCDHPSILDKSETHALFSADAIARAWQILDLIPGRATGAYSHSQGIKGLRD  167

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++ + IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  168  AIAAGIAARDGFPANADDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  227



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 117/180 (65%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V +CQYAVRGE+   A  LQK+ +         +II+ N+GNP +LGQ+P
Sbjct  53   PVTAQNINPQVLQCQYAVRGEIVTLAQNLQKDLQANPGSHSFDEIIYCNIGNPQSLGQQP  112

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAYS S+GI G+R 
Sbjct  113  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQIVEQIPGRATGAYSHSQGIQGLRD  172

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++   IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  173  TIAAGIQERDGFPANANDIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASITL  232



>ref|XP_004241856.1| PREDICTED: alanine aminotransferase 2-like [Solanum lycopersicum]
Length=542

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 115/176 (65%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            +N+N  V KC+YAVRGE+   A  LQ+  K         +I++ N+GNP AL Q+P+TF 
Sbjct  68   DNINPKVLKCEYAVRGEIVSIAQTLQQRLKDNPGSHPFDEILYCNIGNPQALAQQPITFF  127

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R  +A 
Sbjct  128  REVLALCDHPSILDKSETQGLFSADAIERAFQILEQIPGRATGAYSHSQGIKGLRDTIAS  187

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +G RDG+P+DP  +FLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  188  GMGARDGFPADPNDLFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  243



>ref|XP_008460348.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Cucumis melo]
Length=513

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 111/171 (65%), Gaps = 9/171 (5%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  345
            PL    +N+ V KC+YAVRGE+   A        +I++ N+GNP +LGQ+P+TF R+V+A
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLA--------QILYCNIGNPQSLGQQPITFFREVLA  103

Query  346  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAEFIGRR  522
            LC  P +LD      +F  DAIARA Q L    G   GAYS S+GI G+R  +A  I  R
Sbjct  104  LCDHPAILDRSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRDTIAAGIEER  163

Query  523  DGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            DGYP+DP  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  164  DGYPADPNDIFLTDGASPAVHMMMQLLIRSEGDGILCPIPQYPLYSASIAL  214



>ref|XP_011109633.1| hypothetical protein H072_3664 [Dactylellina haptotyla CBS 200.50]
 gb|EPS42354.1| hypothetical protein H072_3664 [Dactylellina haptotyla CBS 200.50]
Length=487

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 124/181 (69%), Gaps = 13/181 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  321
            L+Y+N+N +VK  +YAVRGEL ++A  +++E ++         +IF N+GNP  L QKP+
Sbjct  10   LNYDNINPHVKAAKYAVRGELAVKAEAIRRELEQNPSSHPFDHVIFANIGNPQQLDQKPI  69

Query  322  TFPRQVIALCQAPFLLDDPNVGL---VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVR  492
            TF RQV++L Q P LL + N      ++P DA+ RAK  L  +   +GAYS S+G P +R
Sbjct  70   TFFRQVLSLIQYPDLLKESNAEAAKQLYPEDALERAKWLLK-SVKSVGAYSHSQGAPPLR  128

Query  493  KEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATIS  672
              VA++I +RDGYP+DPE I+LT GAS GV  +L+ I   PN G+++P+PQYPLY+AT++
Sbjct  129  DSVAKYIEQRDGYPADPESIYLTTGASSGVNTLLHVIAASPNTGVMIPIPQYPLYTATLA  188

Query  673  L  675
            L
Sbjct  189  L  189



>gb|AIT69927.1| alanine transaminase [Saccharina japonica]
 gb|AIW62927.1| alanine transaminase [Saccharina japonica]
Length=501

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 125/181 (69%), Gaps = 14/181 (8%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  321
            PLD   +NENVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  21   PLDGTTINENVKSAKYAVRGNVLERSMELQRRMAAGEKLPFDTIVPCNIGNPHACLQSPL  80

Query  322  TFPRQVIALCQAPFLLDD-PNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  498
            +F R+V++LC +P L  D P+V   F  D + RAK + +   GG+GAY++S+GIP VR+E
Sbjct  81   SFHREVLSLCISPTLASDHPHV---FKKDVVERAKAYTAGLGGGVGAYTNSQGIPAVREE  137

Query  499  VAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIR--GPNDGILVPVPQYPLYSATIS  672
            +A FI  RDG+P+  + I+LT+GAS+GV  +L  ++R  G +DG+L P+PQYPLYSA+++
Sbjct  138  IAAFIAERDGHPARADHIYLTNGASEGVRILLTCLLRSGGLHDGLLTPIPQYPLYSASLT  197

Query  673  L  675
            L
Sbjct  198  L  198



>gb|AIT69925.1| alanine transaminase [Saccharina sculpera]
Length=501

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 125/181 (69%), Gaps = 14/181 (8%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  321
            PLD   +NENVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  21   PLDGTTINENVKSAKYAVRGNVLERSMELQRRMAAGEKLPFDTIVPCNIGNPHACLQSPL  80

Query  322  TFPRQVIALCQAPFLLDD-PNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  498
            +F R+V++LC +P L  D P+V   F  D + RAK + +   GG+GAY++S+GIP VR+E
Sbjct  81   SFHREVLSLCISPTLASDHPHV---FKKDVVERAKAYTAGLGGGVGAYTNSQGIPAVREE  137

Query  499  VAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIR--GPNDGILVPVPQYPLYSATIS  672
            +A FI  RDG+P+  + I+LT+GAS+GV  +L  ++R  G +DG+L P+PQYPLYSA+++
Sbjct  138  IAAFIAERDGHPARADHIYLTNGASEGVRILLTCLLRSGGLHDGLLTPIPQYPLYSASLT  197

Query  673  L  675
            L
Sbjct  198  L  198



>ref|NP_001237553.1| alanine aminotransferase 1 [Glycine max]
 gb|ABW17196.1| alanine aminotransferase 1 [Glycine max]
Length=486

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 118/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQK+ +         +I++ N+GNP +LGQ+P
Sbjct  8    PVTAQNINPKVLKCEYAVRGEVVTLAQNLQKDLQANPGSHPFDEILYCNIGNPQSLGQQP  67

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F  DAI RA Q +    G   GAYS S+G+ G+R 
Sbjct  68   ITFFREVLALCDHPAILDKSETQGLFSTDAIQRAWQIVDQIPGRATGAYSHSQGVKGLRD  127

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++P+ IF+TDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  128  TIAAGIEERDGFPANPDDIFMTDGASPAVHNMMQLLIRSENDGILCPIPQYPLYSASIAL  187



>ref|XP_009783410.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Nicotiana 
sylvestris]
Length=525

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 115/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  + LN  V  C+YAVRGE+   A +LQ+E K+         I++ N+GNP +L Q+P
Sbjct  47   PVTRDTLNPKVLNCEYAVRGEIVTLAQKLQEEIKENPGSHPFDEILYCNIGNPQSLAQQP  106

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R 
Sbjct  107  ITFFREVLALCDHPAILDKSETQGLFSADAIERAFQILDQIPGRATGAYSHSQGIKGLRD  166

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDGYP DP  +FLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  167  TIASGIEARDGYPVDPNDLFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  226



>ref|XP_006426797.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40037.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=529

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 114/172 (66%), Gaps = 6/172 (3%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQ-----KEGKKIIFTNVGNPHALGQKPLTFPRQVI  342
            ++LN  V KC+YAVRGE+   A ELQ         +I++ N+GNP +LGQ+P+TF R+V+
Sbjct  59   DSLNPKVLKCEYAVRGEIVSIAQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFFREVL  118

Query  343  ALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAEFIGR  519
            ALC  P +LD      +F AD+I RA Q L    G   GAYS S+GI G+R  +A  I  
Sbjct  119  ALCDHPSILDRSETQGLFSADSIERAWQILDQIPGRATGAYSHSQGIKGLRDTIAAGIEA  178

Query  520  RDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            RDG+P+DP  IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  179  RDGFPADPNDIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  230



>sp|P34106.1|ALA2_PANMI RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Panicum miliaceum]
 emb|CAA49199.1| alanine aminotransferase [Panicum miliaceum]
Length=482

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 119/176 (68%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  330
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQHLQQQLQTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P LL+      +F ADAI+RAKQ LS   G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILSTIPGRATGAYSHSQGIKGLRDAIAA  127

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P++ + IF+TDGAS GV  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  128  GIASRDGFPANADDIFVTDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSASIAL  183



>ref|XP_010318453.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X3 [Solanum lycopersicum]
Length=470

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 13/178 (7%)
 Frame = +1

Query  181  NLNENVKKCQYAVRGELYLRASELQK------------EGKKIIFTNVGNPHALGQKPLT  324
            +LN  V KC YA+RGE+   A  LQ+            E  +I++ N+GNPH+LGQKP+T
Sbjct  11   DLNPKVLKCAYAIRGEIVTHAQILQQDLFENPGSHPFNEFMQILYCNIGNPHSLGQKPIT  70

Query  325  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFL-SMTSGGLGAYSDSRGIPGVRKEV  501
            F R+V+ALC  P LLD      +F AD+I RA Q L  +     GAYS S+GI G+R ++
Sbjct  71   FFREVLALCDHPLLLDRRETKALFSADSIERAIQILDQIPCRATGAYSHSQGIKGLRDKI  130

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            A  I  RDG+P+DP  IFLTDGAS  V  ++  +I   NDGIL P+PQYPLYSA+I+L
Sbjct  131  ASGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIGSENDGILCPIPQYPLYSASITL  188



>ref|XP_011036545.1| PREDICTED: alanine aminotransferase 2-like [Populus euphratica]
Length=533

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 115/176 (65%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P+TF 
Sbjct  59   DNINPKVLKCEYAVRGEIVTLAQALQEELKSKPGSHPFDEILYCNIGNPQSLGQQPITFF  118

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R  +A 
Sbjct  119  REVLALCDHPSILDRSETQGLFSADAIERAWQILDQIPGRATGAYSHSQGIKGLRDTIAA  178

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P+DP  IFLTDGAS  V  ++  ++R   DGIL P+PQYPLYSA+I+L
Sbjct  179  GIEARDGFPADPNDIFLTDGASPAVHMMMQLLMRSEKDGILCPIPQYPLYSASIAL  234



>ref|XP_002906651.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
 gb|EEY66052.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
Length=491

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 111/174 (64%), Gaps = 9/174 (5%)
 Frame = +1

Query  181  NLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPR  333
              N NV K +YAVRG L LR++E +             K+I  N+GNP  L Q+P+ F R
Sbjct  13   TFNPNVVKAEYAVRGALVLRSNEYENRLANGDKSLPFDKVIPCNIGNPQVLKQEPIEFHR  72

Query  334  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFI  513
            QV+AL   P L+D P    +FP DAIARAK ++    GG GAY  S+G   VR+EVA F+
Sbjct  73   QVLALVNVPGLVDQPEAQKLFPPDAIARAKFYMDNIVGGTGAYGHSKGSAVVRQEVARFL  132

Query  514  GRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             RRDG+P+DPE I+LTDGAS  V   L ++IR  ND IL P+PQYPLYSA I++
Sbjct  133  KRRDGHPADPEDIYLTDGASPAVQNSLLALIRDENDAILAPIPQYPLYSAAIAI  186



>ref|XP_004155894.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=488

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+   N+N  V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  10   PISIHNINPKVLKCEYAVRGEIVALAQTLQEELLTNPGSRPFEEILYCNIGNPQSLGQQP  69

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +L+   V  +F  DAI RA Q L    G   GAYS S+GI G+R 
Sbjct  70   ITFFREVLALCDYPSILERKEVEGLFSEDAIKRASQILKQIPGKATGAYSHSQGIKGLRD  129

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +AE I  RDG+P++P  IFLTDGAS  V  ++  +I    DGIL P+PQYPLYSA+I+L
Sbjct  130  AIAEGINARDGFPANPNHIFLTDGASPAVHMMMQLLISSEKDGILCPIPQYPLYSASIAL  189



>ref|XP_008654837.1| PREDICTED: uncharacterized protein LOC100193705 isoform X1 [Zea 
mays]
Length=482

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 119/176 (68%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  330
            ENLN  V KC+YAVRGE+ + A  LQ++           +I+F N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILFCNIGNPQSLGQQPVTFF  67

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P LL+      +F ADAI+RAKQ L+   G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILATIPGRATGAYSHSQGIKGLRDAIAA  127

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P++ + IF+TDGAS GV  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  128  GITSRDGFPANADDIFITDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSASIAL  183



>ref|XP_004141733.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
 gb|KGN45438.1| hypothetical protein Csa_7G448000 [Cucumis sativus]
Length=488

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+   N+N  V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  10   PISIHNINPKVLKCEYAVRGEIVALAQTLQEELLTNPGSRPFEEILYCNIGNPQSLGQQP  69

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +L+   V  +F  DAI RA Q L    G   GAYS S+GI G+R 
Sbjct  70   ITFFREVLALCDYPSILERKEVEGLFSEDAIKRASQILKQIPGKATGAYSHSQGIKGLRD  129

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +AE I  RDG+P++P  IFLTDGAS  V  ++  +I    DGIL P+PQYPLYSA+I+L
Sbjct  130  AIAEGINARDGFPANPNHIFLTDGASPAVHMMMQLLISSEKDGILCPIPQYPLYSASIAL  189



>ref|XP_006342898.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=487

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+   +LN  V KC YA+RGE+   A  LQ++           +I++ N+GNPH+LGQKP
Sbjct  9    PITLNDLNPKVLKCAYAIRGEIVTHAQTLQQDLTENPGSHPFNEILYCNIGNPHSLGQKP  68

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFL-SMTSGGLGAYSDSRGIPGVRK  495
            ++F R+V+ALC  P LLD      +F AD+I +A Q L  +     GAYS S+GI G+R 
Sbjct  69   ISFFREVLALCDHPLLLDRSETKALFSADSIEQAIQILDQIPCRATGAYSHSQGIKGLRD  128

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            ++A  I  RDG+P+DP  IFLTDGAS  V  ++  +I   NDGIL P+PQYPLYSA+I+L
Sbjct  129  KIASGIEVRDGFPADPNDIFLTDGASPAVHMMMQLLIGSENDGILCPIPQYPLYSASITL  188



>ref|XP_006369083.1| alanine aminotransferas family protein [Populus trichocarpa]
 gb|ERP65652.1| alanine aminotransferas family protein [Populus trichocarpa]
Length=481

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 115/176 (65%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            + +N  V KC+YAVRGE+   A  +Q+E K         +I++ N+GNP +LGQ+P+TF 
Sbjct  7    DTINPKVLKCEYAVRGEIVTLAQAVQEELKSKPGSRPFDEILYCNIGNPQSLGQQPITFF  66

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P +LD      +F ADAI RA+Q L    G   GAYS S+GI G+R  +A 
Sbjct  67   REVLALCDHPSILDKSETRGLFSADAIERARQILDQIPGRATGAYSHSQGIKGLRDAIAA  126

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P+DP  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  127  GIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  182



>gb|KDO53767.1| hypothetical protein CISIN_1g009517mg [Citrus sinensis]
Length=533

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (66%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            ++LN  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P+TF 
Sbjct  59   DSLNPKVLKCEYAVRGEIVSIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFF  118

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P +LD      +F AD+I RA Q L    G   GAYS S+GI G+R  +A 
Sbjct  119  REVLALCDHPSILDRSETQGLFSADSIERAWQILDQIPGRATGAYSHSQGIKGLRDTIAA  178

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P+DP  IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  179  GIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  234



>gb|EJK48082.1| hypothetical protein THAOC_33157 [Thalassiosira oceanica]
Length=613

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 123/169 (73%), Gaps = 3/169 (2%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQA  357
            + +++++++ QYAVRGE+ + A EL+ EG++IIFTNVGNPHA+GQK +T+ RQV+ALC  
Sbjct  127  DTMSQSLRRMQYAVRGEVVMLAEELKAEGREIIFTNVGNPHAVGQKCITYYRQVLALCDL  186

Query  358  P--FLLDDPNVGLVFPADAIARAKQFL-SMTSGGLGAYSDSRGIPGVRKEVAEFIGRRDG  528
            P    +D P+V  +FP D IARA+ +  ++ +GG G+YS S+G+   R+ VA+FI  RDG
Sbjct  187  PDECGVDHPDVERLFPKDVIARARLYKDAIGTGGTGSYSHSQGVKEFREHVAKFIEARDG  246

Query  529  YPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            + S    IFLT+GAS G+  IL +++    D +++P+PQYP+YSA I+L
Sbjct  247  HESFAGDIFLTNGASTGIQNILVALMSSDRDAVMIPIPQYPIYSALIAL  295



>ref|XP_006426798.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40038.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=533

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (66%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            ++LN  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P+TF 
Sbjct  59   DSLNPKVLKCEYAVRGEIVSIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFF  118

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P +LD      +F AD+I RA Q L    G   GAYS S+GI G+R  +A 
Sbjct  119  REVLALCDHPSILDRSETQGLFSADSIERAWQILDQIPGRATGAYSHSQGIKGLRDTIAA  178

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P+DP  IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  179  GIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  234



>ref|XP_004235528.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Solanum lycopersicum]
Length=484

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 114/175 (65%), Gaps = 10/175 (6%)
 Frame = +1

Query  181  NLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPR  333
            +LN  V KC YA+RGE+   A  LQ++           +I++ N+GNPH+LGQKP+TF R
Sbjct  11   DLNPKVLKCAYAIRGEIVTHAQILQQDLFENPGSHPFNEILYCNIGNPHSLGQKPITFFR  70

Query  334  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFL-SMTSGGLGAYSDSRGIPGVRKEVAEF  510
            +V+ALC  P LLD      +F AD+I RA Q L  +     GAYS S+GI G+R ++A  
Sbjct  71   EVLALCDHPLLLDRRETKALFSADSIERAIQILDQIPCRATGAYSHSQGIKGLRDKIASG  130

Query  511  IGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            I  RDG+P+DP  IFLTDGAS  V  ++  +I   NDGIL P+PQYPLYSA+I+L
Sbjct  131  IEARDGFPADPNDIFLTDGASPAVHMMMQLLIGSENDGILCPIPQYPLYSASITL  185



>gb|EMT23015.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=508

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 121/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  330
            +NLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    DNLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P LL    +  +F AD+I+RAKQ L++  G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPDLLKKEEIKTLFSADSISRAKQILALIPGRATGAYSHSQGIKGLRDAIAS  127

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P++ + IFLTDGAS GV  ++  +IR   DGILVP+PQYPLYSA+I+L
Sbjct  128  GIASRDGFPANADDIFLTDGASPGVHLMMQLLIRNEKDGILVPIPQYPLYSASIAL  183



>ref|XP_006465804.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Citrus 
sinensis]
Length=533

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (66%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            ++LN  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P+TF 
Sbjct  59   DSLNPKVLKCEYAVRGEIVSIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFF  118

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P +LD      +F AD+I RA Q L    G   GAYS S+GI G+R  +A 
Sbjct  119  REVLALCDHPSILDRSETQGLFSADSIERAWQILDQIPGRATGAYSHSQGIKGLRDTIAA  178

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P+DP  IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  179  GIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  234



>gb|AIT69928.1| alanine transaminase [Scytosiphon dotyi]
Length=500

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 126/181 (70%), Gaps = 14/181 (8%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  321
            PL+   +NENVK  +YAVRG +  R+ ELQ++   G+K+ F      N+GNPHA  Q PL
Sbjct  20   PLNGATINENVKAAKYAVRGAVLERSMELQRKMAAGEKLPFDTIVPCNIGNPHACLQVPL  79

Query  322  TFPRQVIALCQAPFL-LDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  498
            +F R+V++LC +P L  D P+V   F  D I RAK + +  +GG+GAY++S+GIP VR+E
Sbjct  80   SFHREVLSLCISPNLATDHPHV---FKKDVIERAKHYAAGLTGGVGAYTNSQGIPAVREE  136

Query  499  VAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIR--GPNDGILVPVPQYPLYSATIS  672
            +A FI  RDG+P+  + I+LT+GAS+GV  +L  ++R  G  DG+L P+PQYPLYSA+++
Sbjct  137  IAAFIAERDGHPARADRIYLTNGASEGVRILLTCLLRSGGKKDGLLTPIPQYPLYSASLT  196

Query  673  L  675
            L
Sbjct  197  L  197



>ref|XP_007217248.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
 gb|EMJ18447.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
Length=544

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 114/180 (63%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+  +N+N  + KC+YAVRGE+   A  LQ+E           +I++ N+GNP +LGQ P
Sbjct  66   PVTLQNINPKILKCEYAVRGEIVTLAQRLQEELLANPGSHPFDEILYCNIGNPQSLGQHP  125

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R 
Sbjct  126  ITFFREVLALCDHPSILDKSETQGLFSADAIERAWQILDQIPGRATGAYSHSQGIKGLRD  185

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDGYP+DP  IFLTDGAS  V  ++  +I    DGIL P+PQYPLYSA+I+L
Sbjct  186  TIAAGIEARDGYPADPNDIFLTDGASPAVHMMMQLLISSEQDGILCPIPQYPLYSASIAL  245



>ref|XP_010318452.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X1 [Solanum lycopersicum]
Length=487

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 13/178 (7%)
 Frame = +1

Query  181  NLNENVKKCQYAVRGELYLRASELQK------------EGKKIIFTNVGNPHALGQKPLT  324
            +LN  V KC YA+RGE+   A  LQ+            E  +I++ N+GNPH+LGQKP+T
Sbjct  11   DLNPKVLKCAYAIRGEIVTHAQILQQDLFENPGSHPFNEFMQILYCNIGNPHSLGQKPIT  70

Query  325  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFL-SMTSGGLGAYSDSRGIPGVRKEV  501
            F R+V+ALC  P LLD      +F AD+I RA Q L  +     GAYS S+GI G+R ++
Sbjct  71   FFREVLALCDHPLLLDRRETKALFSADSIERAIQILDQIPCRATGAYSHSQGIKGLRDKI  130

Query  502  AEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            A  I  RDG+P+DP  IFLTDGAS  V  ++  +I   NDGIL P+PQYPLYSA+I+L
Sbjct  131  ASGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIGSENDGILCPIPQYPLYSASITL  188



>ref|XP_009627254.1| PREDICTED: alanine aminotransferase 2-like [Nicotiana tomentosiformis]
Length=543

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  + LN  V  C+YAVRGE+   A +LQ+E K+         I++ N+GNP +L Q+P
Sbjct  65   PVTLDTLNPKVLNCEYAVRGEIVTLAQKLQQEIKENPGSHPFDEILYCNIGNPQSLAQQP  124

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R 
Sbjct  125  ITFFREVLALCDHPAILDKSETQGLFSADAIERAFQILDQIPGRATGAYSHSQGIKGLRD  184

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P+DP  +FLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  185  TIASGIEARDGFPADPNDLFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  244



>gb|AIT69918.1| alanine transaminase [Desmarestia viridis]
Length=497

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 123/181 (68%), Gaps = 14/181 (8%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  321
            PLD   +N NVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  17   PLDGTTINSNVKSAKYAVRGNVLERSMELQRRMAAGEKLPFDKIVPCNIGNPHACMQLPL  76

Query  322  TFPRQVIALCQAPFLLDD-PNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  498
            +F R+V++LC +P L  D PN    F  D + RAK + S   GG+GAY++S+GIP VR+E
Sbjct  77   SFHREVLSLCISPSLASDHPNA---FKRDVVERAKSYTSGLGGGVGAYTNSQGIPAVREE  133

Query  499  VAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIR--GPNDGILVPVPQYPLYSATIS  672
            +A FI  RDG+P+  + I+LT+GAS+GV  +L  ++R  G +DG+L P+PQYPLYSA+++
Sbjct  134  IAAFIAERDGHPARADRIYLTNGASEGVRILLTCLLRSGGKHDGLLTPIPQYPLYSASLA  193

Query  673  L  675
            L
Sbjct  194  L  194



>ref|XP_008462239.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Cucumis 
melo]
Length=488

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 117/180 (65%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+   N+N  V KC+YAVRGE+   A ++Q+E          ++I++ N+GNP +LGQ+P
Sbjct  10   PVSIHNINPKVLKCEYAVRGEIVALAQKIQEELLTNPGSRPFEEILYCNIGNPQSLGQQP  69

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +L+   V  +F  DAI RA + L    G   GAYS S+GI G+R 
Sbjct  70   ITFFREVLALCDHPSILERKEVEGLFSEDAIKRASEILKQIPGKATGAYSHSQGIKGLRD  129

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +AE I  RDG+P+DP  IFLTDGAS  V  ++  +I    DGIL P+PQYPLYSA+I+L
Sbjct  130  AIAEGINARDGFPADPNDIFLTDGASPAVHMMMQLLITSEKDGILCPIPQYPLYSASIAL  189



>ref|XP_003528736.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
1 [Glycine max]
 gb|KHN01474.1| Alanine aminotransferase 2, mitochondrial [Glycine soja]
Length=541

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 118/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQK+ +         +I++ N+GNP +LGQ+P
Sbjct  63   PVTAQNINPKVLKCEYAVRGEVVTLAQNLQKDLQANPGSHPFDEILYCNIGNPQSLGQQP  122

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F  DAI RA Q +    G   GAYS S+G+ G+R 
Sbjct  123  ITFFREVLALCDHPAILDKSETQGLFSTDAIQRAWQIVDQIPGRATGAYSHSQGVKGLRD  182

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++P+ IF+TDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  183  TIAAGIEERDGFPANPDDIFMTDGASPAVHNMMQLLIRSENDGILCPIPQYPLYSASIAL  242



>ref|XP_004303756.1| PREDICTED: alanine aminotransferase 2 [Fragaria vesca subsp. 
vesca]
Length=541

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 117/176 (66%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            +N+N  V KC+YAVRGE+ + A +LQ++ K         +I++ N+GNP +LGQ+P+T+ 
Sbjct  67   DNINPKVVKCEYAVRGEIVILAGKLQEQLKANPGSLPFDEILYCNIGNPQSLGQQPITYF  126

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P +LD      +F AD+I RA + L    G   GAYS S+GI G+R  +A 
Sbjct  127  REVLALCDHPAILDKSETQGLFSADSIERAWEILDQIPGRATGAYSHSQGIKGLRDSIAA  186

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDGYPSDP  +FLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  187  GIEARDGYPSDPNDLFLTDGASPAVHTMMTLLIRSEKDGILCPIPQYPLYSASIAL  242



>emb|CDS05712.1| hypothetical protein LRAMOSA08240 [Absidia idahoensis var. thermophila]
Length=506

 Score =   167 bits (423),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 120/180 (67%), Gaps = 11/180 (6%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L  +N+N +++  +YAVRG + +RA E++ +         K ++  N+GNP  L QKP+T
Sbjct  8    LTVDNINPHIRDMEYAVRGRIAIRAEEIRDQLNKGDQLPFKTVVNCNIGNPQQLEQKPIT  67

Query  325  FPRQVIALCQAPFLLDDPN---VGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  495
            F RQV +LC+ P LL D     V  ++P+DAIARA++ ++M     GAYS S+G+ G+R+
Sbjct  68   FFRQVASLCENPELLADDKQDIVSQLYPSDAIARARKLMAMIGSSTGAYSHSQGVAGIRQ  127

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             VA F+  RDG+P+DP  I+LT GAS GV  IL+ + +    GIL+P+PQYPLYSAT++L
Sbjct  128  TVARFLEERDGHPADPNHIYLTQGASAGVQSILSIMTQNSQTGILIPIPQYPLYSATLTL  187



>ref|XP_001769989.1| predicted protein [Physcomitrella patens]
 gb|EDQ65165.1| predicted protein [Physcomitrella patens]
Length=484

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N  V   +YAVRGE+ +RA  L +E K         +II+ N+GNP +LGQKP
Sbjct  6    PVSIQSINPKVLNAEYAVRGEIVIRAQALAEELKSNPGSHPFDEIIYCNIGNPQSLGQKP  65

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD P    +F +DAI+RA + ++   G   GAYS S+G+   R 
Sbjct  66   ITFFREVVALCDHPSLLDKPETHALFSSDAISRASRIINKIPGQTTGAYSHSQGVTVCRD  125

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            ++A  I  RDGYP++PE IF+TDGAS GV  ++  ++    DGIL P+PQYPLYSA+I+L
Sbjct  126  DIAAGIAARDGYPANPEDIFVTDGASPGVHMMMQLLLSSEKDGILCPIPQYPLYSASIAL  185



>gb|EPB88721.1| alanine transaminase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=512

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 120/181 (66%), Gaps = 13/181 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  321
            L  E ++  VK  +YAVRG L +RA  L ++ KK         ++F N+GNP  L QKP+
Sbjct  33   LTTETMHPLVKSVEYAVRGALPIRAEALSQQLKKDPSKLNFDRVVFCNIGNPQQLNQKPI  92

Query  322  TFPRQVIALCQAPFLLDDPNVGLV---FPADAIARAKQFLSMTSGGLGAYSDSRGIPGVR  492
            TF RQV +LC+ P LL   N  LV   +PADAIARA Q L    G +GAYS S+GI  +R
Sbjct  93   TFFRQVASLCENPELLKTENRALVSKLYPADAIARA-QVLLKNIGSVGAYSHSKGITHIR  151

Query  493  KEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATIS  672
            + VA+FI RRDGY ++P+ IFLT GAS+GV +++  + +    GI++P+PQYPLYSAT+S
Sbjct  152  ENVAKFIERRDGYAANPDDIFLTQGASEGVQKVIQLLTQNQQSGIMIPIPQYPLYSATLS  211

Query  673  L  675
            L
Sbjct  212  L  212



>ref|XP_004983099.1| PREDICTED: alanine aminotransferase 2-like [Setaria italica]
Length=482

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 120/176 (68%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  330
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQNQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P LL+   +  +F ADAI+RAKQ L+   G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPCLLEKEEIKSLFSADAISRAKQILATIPGRATGAYSHSQGIKGLRDAIAA  127

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P++ + IF+TDGAS GV  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  128  GIASRDGFPANADDIFITDGASPGVHLMMQLLIRNEKDGILCPIPQYPLYSASIAL  183



>ref|XP_010029516.1| PREDICTED: alanine aminotransferase 2-like [Eucalyptus grandis]
 gb|KCW56436.1| hypothetical protein EUGRSUZ_I02163 [Eucalyptus grandis]
Length=539

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A  LQ+E K+         I++ N+GNP +LGQ+P
Sbjct  61   PVTLDTINPKVLKCEYAVRGEIVSIAQRLQQELKENPGSHPFDEILYCNIGNPQSLGQQP  120

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R 
Sbjct  121  ITFFREVLALCDHPSILDKSETQGLFSADAIERAWQILDQIPGRATGAYSHSQGIKGLRD  180

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P+DP  IFLTDGAS  V  ++  + R  +DGIL P+PQYPLYSA+I+L
Sbjct  181  TIAAGIEARDGFPADPNDIFLTDGASPAVHMMMQLLTRSESDGILCPIPQYPLYSASITL  240



>gb|EWC46913.1| hypothetical protein DRE_03925 [Drechslerella stenobrocha 248]
Length=487

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 124/181 (69%), Gaps = 13/181 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  321
            L+Y+N+N +VK+ +YAVRGEL  +A  ++++ ++         +IF N+GNP  L QKP+
Sbjct  10   LNYDNINPHVKEAKYAVRGELANKAESIRRDLEQDPSSHPFDHVIFANIGNPQQLDQKPI  69

Query  322  TFPRQVIALCQAPFLLDDPNVGL---VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVR  492
            TF RQV++L Q P LL++ N      ++P DA+ RA+  L      +GAYS S+G P +R
Sbjct  70   TFFRQVLSLIQYPDLLNEANAEAARQLYPEDALERARWLLKSVKS-VGAYSHSQGAPALR  128

Query  493  KEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATIS  672
              VA +I +RDG+P+DPE I+LT GAS GV  +L+ +  GPN G+++P+PQYPLY+AT++
Sbjct  129  NSVARYIEQRDGHPADPESIYLTTGASSGVNTLLHVVAAGPNTGVMIPIPQYPLYTATLA  188

Query  673  L  675
            L
Sbjct  189  L  189



>gb|KHN39571.1| Alanine aminotransferase 2, mitochondrial [Glycine soja]
Length=536

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 117/180 (65%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQK+ +         +I++ N+GNP +LGQ+P
Sbjct  58   PVTAQNINPKVLKCEYAVRGEVVTLAQNLQKDLQANPGSHPFDEILYCNIGNPQSLGQQP  117

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F  DAI RA Q +    G   GAYS S+G+ G+R 
Sbjct  118  ITFFREVLALCDHPAILDKSETQGLFSTDAIQRAWQIVDQIPGRATGAYSHSQGVKGLRD  177

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P++P+ IF+TDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I L
Sbjct  178  TIAAGIEERDGFPANPDDIFMTDGASPAVHNMMQLLIRSENDGILCPIPQYPLYSASIDL  237



>gb|ETO72417.1| hypothetical protein F444_11427 [Phytophthora parasitica P1976]
Length=293

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 109/173 (63%), Gaps = 9/173 (5%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPRQ  336
             N  V K +YAVRG L LR++E +             KII  N+GNP  L Q+P+ F RQ
Sbjct  14   FNPKVVKAEYAVRGALVLRSNEYENRLANGDKSLPFDKIIPCNIGNPQVLNQEPIEFHRQ  73

Query  337  VIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAEFIG  516
            V+AL   P L+D P    +F  DAIARAK ++    GG GAY  S+G   VR+EVA F+ 
Sbjct  74   VLALVNVPGLVDQPEAQKLFQPDAIARAKFYIDNIPGGTGAYGHSKGSAVVREEVARFLQ  133

Query  517  RRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            RRDG+P+DPE I+LTDGAS  V   L ++IR  ND I+ P+PQYPLYSA I++
Sbjct  134  RRDGHPADPEDIYLTDGASPAVQNSLLALIRDENDAIMAPIPQYPLYSAAIAI  186



>ref|XP_006357426.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=541

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQ+  K         +I++ N+GNP +L Q+P
Sbjct  63   PITMDNINPKVLKCEYAVRGEIVSIAQTLQQNLKDNPGSHPFDEILYCNIGNPQSLAQQP  122

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R 
Sbjct  123  VTFFREVLALCDHPSILDKSETQGLFSADAIERAFQILEQIPGRATGAYSHSQGIKGLRD  182

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  +  RDG+P+DP  +FLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  183  TIASGMEARDGFPADPNDLFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  242



>gb|EPS60556.1| hypothetical protein M569_14246, partial [Genlisea aurea]
Length=491

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 114/180 (63%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+    +N  V +C+YAVRGE+   A +LQ+   K         I++ N+GNP +LGQ+P
Sbjct  14   PVKISTINPKVLECEYAVRGEIVTLAQKLQQHLDKNPGSHPFDEIVYCNIGNPQSLGQQP  73

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F  D+I RA Q L    G   GAYS S+GI G+R 
Sbjct  74   ITFFREVLALCDHPAILDKSETQGLFSTDSIERAFQILDQIPGRATGAYSHSQGIKGLRD  133

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+PSDP  IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  134  TIAAGIEARDGFPSDPNDIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  193



>ref|XP_010537653.1| PREDICTED: alanine aminotransferase 2, mitochondrial [Tarenaya 
hassleriana]
Length=540

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 117/180 (65%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N  V KC+YAVRGE+   A  LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  62   PVTVQSINPKVLKCEYAVRGEIVSIAQRLQEDLKVNKDAYPFDEIIYCNIGNPQSLGQQP  121

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +T+ R+V+ALC  P LLD+     +F ADAI RA + L    G   GAYS S+G+ G+R 
Sbjct  122  ITYFREVLALCDHPALLDESQTHGLFSADAIGRAWKILDQIPGRATGAYSHSQGVKGLRD  181

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P DP  IFLTDGAS  V  ++  +I   NDGIL P+PQYPLYSA+I+L
Sbjct  182  TIAAGIEARDGFPCDPNDIFLTDGASPAVHMMMQLLISSENDGILCPIPQYPLYSASIAL  241



>ref|XP_008380735.1| PREDICTED: alanine aminotransferase 2 [Malus domestica]
Length=543

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  65   PVTLQNINPKVLKCEYAVRGEIVTLAQRLQEELKANPGSHPFDEILYCNIGNPQSLGQQP  124

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+++ALC  P +LD      +F ADAI RA + L    G   GAYS S+GI G+R 
Sbjct  125  ITFFREILALCDHPAILDKSETQGLFSADAIERAWEILDQIPGRATGAYSHSQGIKGLRD  184

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDGYP++P  IFLTDGAS  V  ++  +I    DGIL P+PQYPLYSA+I+L
Sbjct  185  TIAAGIEARDGYPANPNDIFLTDGASPAVHMMMQLLISSEKDGILCPIPQYPLYSASIAL  244



>gb|KEQ94204.1| hypothetical protein AUEXF2481DRAFT_41383 [Aureobasidium subglaciale 
EXF-2481]
Length=544

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 123/181 (68%), Gaps = 13/181 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  321
            L  EN+N+NV + +YAVRGEL +++ + +++ +K         II  N+GNP  L QKP+
Sbjct  79   LTIENINQNVVEAEYAVRGELAVKSEKYREQLRKGDSSLPFDTIISANIGNPQQLDQKPI  138

Query  322  TFPRQVIALCQAPFLLDDPNV---GLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVR  492
            TF RQV++L + P LL+ P+V    L +  D+I RAK+ L      +GAYS S+G PG+R
Sbjct  139  TFFRQVLSLMENPLLLEHPDVLTKTLGYKQDSIDRAKKLLDDVKS-VGAYSASKGAPGIR  197

Query  493  KEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATIS  672
            + VA FI +RDGYP+DPE IFL+ GAS GV  ++N +    N G+LVP+PQYPLY+AT++
Sbjct  198  QSVANFIEKRDGYPADPESIFLSAGASGGVSTMMNVMCADANSGVLVPIPQYPLYTATLA  257

Query  673  L  675
            L
Sbjct  258  L  258



>emb|CBI35796.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 115/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  E +N  V +C+YAVRGE+   A  LQ+E ++         I++ N+GNP +LGQ+P
Sbjct  4    PVTLETINPKVLECEYAVRGEIVTLAQRLQQELQEKPGSLPFDEILYCNIGNPQSLGQQP  63

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+VIALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R 
Sbjct  64   ITFFREVIALCDHPPILDKSETQGLFSADAIERAWQILDQIPGRATGAYSHSQGIKGLRD  123

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+PS+P  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I L
Sbjct  124  TIAAGIEARDGFPSNPNDIFLTDGASPAVHMMMQLLIRTEKDGILCPIPQYPLYSASIVL  183



>ref|XP_008228107.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Prunus 
mume]
Length=544

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 114/180 (63%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+  +N+N  + KC+YAVRGE+   A  LQ+E           +I++ N+GNP +LGQ P
Sbjct  66   PVTLQNINPKILKCEYAVRGEIVTLAQRLQEELLANPGSHPFDEILYCNIGNPQSLGQHP  125

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R 
Sbjct  126  ITFFREVLALCDHPSILDKSETQGLFSADAIERAWQILDQIPGRATGAYSHSQGIKGLRD  185

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             ++  I  RDGYP+DP  IFLTDGAS  V  ++  +I    DGIL P+PQYPLYSA+I+L
Sbjct  186  TISAGIEARDGYPADPNDIFLTDGASPAVHMMMQLLISSEQDGILCPIPQYPLYSASIAL  245



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  68   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNPQSLGQQP  127

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V++LC  P LLD      ++ +DAI RA Q L    G   GAYS S+GI G+R 
Sbjct  128  VTFFREVLSLCDHPALLDKSETHALYSSDAIERAWQILDKIPGRATGAYSHSQGIKGLRD  187

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            E+A  I  RDG+ +  + IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  188  EIAAGIAARDGFHASGDNIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  247



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  68   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNPQSLGQQP  127

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V++LC  P LLD      ++ +DAI RA Q L    G   GAYS S+GI G+R 
Sbjct  128  VTFFREVLSLCDHPALLDKSETHALYSSDAIERAWQILDKIPGRATGAYSHSQGIKGLRD  187

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            E+A  I  RDG+ +  + IFLTDGAS  V  ++  +IR  NDGIL P+PQYPLYSA+I+L
Sbjct  188  EIAAGIAARDGFHASGDNIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASIAL  247



>gb|EMS19811.1| 1-aminocyclopropane-1-carboxylate synthase [Rhodosporidium toruloides 
NP11]
 emb|CDR35527.1| RHTO0S01e01332g1_1 [Rhodosporidium toruloides]
Length=529

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 12/175 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASEL----QKEGK-------KIIFTNVGNPHALGQK  315
            L  E +N++V + QYAVRG + LRA EL    +++GK        ++  N+GNP  L QK
Sbjct  54   LTNERMNKHVLEAQYAVRGAIPLRAEELREQLEEKGKDAGLPFDTVVNCNIGNPQQLDQK  113

Query  316  PLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  495
            PLTF RQV AL + P LLD P+   +FP+DAI RA+  L    G +GAYS S G+P +RK
Sbjct  114  PLTFLRQVSALTEYPDLLDHPSTSSIFPSDAIERARSLLKEI-GSVGAYSHSMGVPAIRK  172

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYS  660
             VA+FI  RDG+PS P  I+LT GAS GV  IL  +I  P DG+L+P+PQYPLY+
Sbjct  173  RVAQFIENRDGHPSSPGKIYLTAGASTGVSNILQILISSPLDGVLIPIPQYPLYT  227



>gb|KJB57088.1| hypothetical protein B456_009G147700 [Gossypium raimondii]
Length=504

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+    +N  V +C+YAVRGE+   A +LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  56   PVSLNTINPKVIECEYAVRGEIVTLAQKLQEEIQTKPDAHPFEEILYCNIGNPQSLGQQP  115

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P +LD      +F AD+I RA Q L    G   GAYS S+GI G+R 
Sbjct  116  ITFFREVLALCDHPAILDKSETQGLFSADSIERAWQILDQIPGRATGAYSHSQGIKGLRD  175

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P+DP  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  176  TIAAGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  235



>gb|AIT69920.1| alanine transaminase [Scytosiphon lomentaria]
Length=500

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 125/181 (69%), Gaps = 14/181 (8%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  321
            PL    +NENVK  +YAVRG +  R+ ELQ++   G+K+ F      N+GNPHA  Q PL
Sbjct  20   PLTGSTINENVKAAKYAVRGAVLERSMELQRKMAAGEKLPFDTIVPCNIGNPHACLQVPL  79

Query  322  TFPRQVIALCQAPFL-LDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  498
            +F R+V++LC +P L  D P+V   F  D + RAK + +  +GG+GAY++S+GIP VR+E
Sbjct  80   SFHREVLSLCISPNLATDHPHV---FKEDVVERAKHYAAGLTGGVGAYTNSQGIPAVREE  136

Query  499  VAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIR--GPNDGILVPVPQYPLYSATIS  672
            +A FI  RDG+P+  + I+LT+GAS+GV  +L  ++R  G  DG+L P+PQYPLYSA+++
Sbjct  137  IAAFIAERDGHPARADRIYLTNGASEGVRILLTCLLRSGGKEDGLLTPIPQYPLYSASLT  196

Query  673  L  675
            L
Sbjct  197  L  197



>ref|XP_002265294.2| PREDICTED: alanine aminotransferase 2 [Vitis vinifera]
Length=526

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 115/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  E +N  V +C+YAVRGE+   A  LQ+E ++         I++ N+GNP +LGQ+P
Sbjct  48   PVTLETINPKVLECEYAVRGEIVTLAQRLQQELQEKPGSLPFDEILYCNIGNPQSLGQQP  107

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+VIALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R 
Sbjct  108  ITFFREVIALCDHPPILDKSETQGLFSADAIERAWQILDQIPGRATGAYSHSQGIKGLRD  167

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+PS+P  IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I L
Sbjct  168  TIAAGIEARDGFPSNPNDIFLTDGASPAVHMMMQLLIRTEKDGILCPIPQYPLYSASIVL  227



>ref|XP_010939849.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Elaeis guineensis]
Length=475

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 114/170 (67%), Gaps = 10/170 (6%)
 Frame = +1

Query  196  VKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFPRQVIAL  348
            V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P+TF R+V+AL
Sbjct  7    VLKCEYAVRGEIVSHAQRLQQELQTKPGSYPFDEILYCNIGNPQSLGQQPVTFFREVLAL  66

Query  349  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAEFIGRRD  525
            C  P +LD      +F +DAIARA+Q L +  G   GAYS S+GI G+R  +A  I  RD
Sbjct  67   CDHPSILDKSEAHALFSSDAIARARQILDLIPGRATGAYSHSQGIKGLRDAIAAGIAARD  126

Query  526  GYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            G+P++ + IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  127  GFPANADDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIAL  176



>gb|AAC62456.1| alanine aminotransferase [Zea mays]
Length=482

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 118/176 (67%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  330
            ENLN  V KC+YAVRGE+ + A   Q++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRRQQQLQTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P LL+      +F ADAI+RAKQ L+   G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILATIPGRATGAYSHSQGIKGLRDAIAA  127

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P++ + IF+TDGAS GV  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  128  GIMSRDGFPANADDIFITDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSASIAL  183



>gb|AFW68850.1| alanine aminotransferase [Zea mays]
Length=482

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 119/176 (68%), Gaps = 10/176 (6%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  330
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  331  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAE  507
            R+V+ALC  P LL+      +F ADAI+RAKQ L+   G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILATIPGRATGAYSHSQGIKGLRDAIAA  127

Query  508  FIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             I  RDG+P++ + IF+TDGAS GV  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  128  GIMSRDGFPANADDIFITDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSASIAL  183



>emb|CEI91975.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=490

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 120/177 (68%), Gaps = 12/177 (7%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKE---GK-----KIIFTNVGNPHALGQKPLTFPR  333
            +++N  VK  +YAVRG+L +RA EL++E   GK     +++  N+GNP  L Q+P+ F R
Sbjct  14   KSINPLVKNVEYAVRGKLAIRAEELKQELEEGKEYPFSRVVNCNIGNPQQLNQQPIKFYR  73

Query  334  QVIALCQAPFLLDDPNVGLV---FPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVA  504
            QV +LC  P LL   N  LV   +P DAI RAK+ +  + G +G+YS S+G+P +R+ VA
Sbjct  74   QVSSLCDNPDLLKKENYHLVSQLYPTDAIERAKKLMK-SIGSVGSYSHSQGVPAIRQTVA  132

Query  505  EFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
            +FI  RDGYP+DP  IFLT GAS GV  +L+ +    N GI++P+PQYPLYSA+++L
Sbjct  133  QFIKERDGYPADPNHIFLTQGASSGVQTLLSLLTENSNSGIMIPIPQYPLYSASLAL  189



>gb|ACJ85860.1| unknown [Medicago truncatula]
Length=524

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 114/180 (63%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KCQYAVRGE+   A  LQK  +         +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAYS S+GI G+R 
Sbjct  106  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQLVDQIPGRATGAYSHSQGIQGLRD  165

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P +   IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  166  TIAAGIEERDGFPCNANDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASITL  225



>gb|AFK39904.1| unknown [Medicago truncatula]
Length=524

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 114/180 (63%), Gaps = 10/180 (6%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KCQYAVRGE+   A  LQK  +         +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  319  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  495
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAYS S+GI G+R 
Sbjct  106  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQLVDQIPGRATGAYSHSQGIQGLRD  165

Query  496  EVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNSIIRGPNDGILVPVPQYPLYSATISL  675
             +A  I  RDG+P +   IFLTDGAS  V  ++  +IR   DGIL P+PQYPLYSA+I+L
Sbjct  166  TIAAGIEERDGFPCNANDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASITL  225



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420