BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024M05

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625096.1|  PREDICTED: protein VACUOLELESS1                    363   2e-116   Nicotiana tomentosiformis
ref|XP_004243213.1|  PREDICTED: protein VACUOLELESS1                    361   1e-115   Solanum lycopersicum
ref|XP_006348963.1|  PREDICTED: vacuolar protein sorting-associat...    359   5e-115   
ref|XP_009790374.1|  PREDICTED: protein VACUOLELESS1                    357   2e-114   Nicotiana sylvestris
emb|CDP06151.1|  unnamed protein product                                331   2e-104   Coffea canephora [robusta coffee]
ref|XP_010271338.1|  PREDICTED: protein VACUOLELESS1 isoform X2         326   1e-103   
ref|XP_004144632.1|  PREDICTED: vacuolar protein sorting-associat...    328   5e-103   Cucumis sativus [cucumbers]
ref|XP_010271337.1|  PREDICTED: protein VACUOLELESS1 isoform X1         327   9e-103   Nelumbo nucifera [Indian lotus]
ref|XP_002283428.1|  PREDICTED: protein VACUOLELESS1                    327   1e-102   Vitis vinifera
ref|XP_010681470.1|  PREDICTED: protein VACUOLELESS1                    325   4e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008465445.1|  PREDICTED: protein VACUOLELESS1                    325   5e-102   Cucumis melo [Oriental melon]
gb|EYU33990.1|  hypothetical protein MIMGU_mgv1a001320mg                324   2e-101   Erythranthe guttata [common monkey flower]
gb|KCW89755.1|  hypothetical protein EUGRSUZ_A02017                     321   3e-101   Eucalyptus grandis [rose gum]
gb|EPS58563.1|  hypothetical protein M569_16250                         306   3e-101   Genlisea aurea
ref|XP_011082899.1|  PREDICTED: protein VACUOLELESS1                    321   2e-100   Sesamum indicum [beniseed]
ref|XP_010053830.1|  PREDICTED: protein VACUOLELESS1                    321   2e-100   Eucalyptus grandis [rose gum]
ref|XP_004303883.1|  PREDICTED: protein VACUOLELESS1 isoform X2         317   9e-99    Fragaria vesca subsp. vesca
ref|XP_008342344.1|  PREDICTED: protein VACUOLELESS1                    316   1e-98    Malus domestica [apple tree]
ref|XP_011467591.1|  PREDICTED: protein VACUOLELESS1 isoform X1         317   2e-98    Fragaria vesca subsp. vesca
ref|XP_008229565.1|  PREDICTED: protein VACUOLELESS1                    312   6e-97    Prunus mume [ume]
ref|XP_007214933.1|  hypothetical protein PRUPE_ppa001364mg             310   3e-96    Prunus persica
ref|XP_010087860.1|  Vacuolar protein sorting-associated protein ...    310   4e-96    Morus notabilis
ref|XP_010557595.1|  PREDICTED: protein VACUOLELESS1                    309   1e-95    Tarenaya hassleriana [spider flower]
ref|XP_004499978.1|  PREDICTED: vacuolar protein sorting-associat...    308   2e-95    Cicer arietinum [garbanzo]
ref|XP_002302135.2|  MANGLED family protein                             307   4e-95    
ref|XP_011026232.1|  PREDICTED: protein VACUOLELESS1-like isoform X1    307   5e-95    Populus euphratica
ref|XP_009377216.1|  PREDICTED: LOW QUALITY PROTEIN: protein VACU...    306   7e-95    Pyrus x bretschneideri [bai li]
ref|XP_011044765.1|  PREDICTED: protein VACUOLELESS1-like               305   1e-94    Populus euphratica
gb|AES70033.2|  vacuolar protein sorting-associated-like protein        305   2e-94    Medicago truncatula
gb|KEH16900.1|  vacuolar protein sorting-associated-like protein        305   2e-94    Medicago truncatula
ref|XP_002306748.1|  MANGLED family protein                             305   2e-94    
ref|XP_003599782.1|  Vacuolar protein sorting-associated protein-...    305   2e-94    
gb|KDO51890.1|  hypothetical protein CISIN_1g003205mg                   301   3e-94    Citrus sinensis [apfelsine]
ref|XP_003551927.1|  PREDICTED: vacuolar protein sorting-associat...    303   1e-93    
gb|KJB10620.1|  hypothetical protein B456_001G211500                    299   1e-93    Gossypium raimondii
ref|XP_006437140.1|  hypothetical protein CICLE_v10030701mg             302   2e-93    Citrus clementina [clementine]
gb|KDO51887.1|  hypothetical protein CISIN_1g003205mg                   302   2e-93    Citrus sinensis [apfelsine]
gb|KHG27227.1|  Vacuolar sorting-associated protein 16                  300   5e-93    Gossypium arboreum [tree cotton]
ref|XP_006411003.1|  hypothetical protein EUTSA_v10016232mg             301   7e-93    Eutrema salsugineum [saltwater cress]
ref|XP_003532091.1|  PREDICTED: vacuolar protein sorting-associat...    301   9e-93    Glycine max [soybeans]
gb|KJB10619.1|  hypothetical protein B456_001G211500                    299   9e-93    Gossypium raimondii
gb|KJB10617.1|  hypothetical protein B456_001G211500                    299   1e-92    Gossypium raimondii
gb|KJB10618.1|  hypothetical protein B456_001G211500                    300   1e-92    Gossypium raimondii
gb|KJB10616.1|  hypothetical protein B456_001G211500                    300   3e-92    Gossypium raimondii
ref|XP_007048987.1|  Vacuoleless1 (VCL1) isoform 3                      298   7e-92    
ref|XP_007048986.1|  Vacuoleless1 (VCL1) isoform 2                      298   1e-91    
ref|XP_007146219.1|  hypothetical protein PHAVU_006G022400g             298   1e-91    Phaseolus vulgaris [French bean]
ref|XP_007048985.1|  Vacuoleless1 (VCL1) isoform 1                      298   2e-91    
emb|CDY07756.1|  BnaA03g17550D                                          298   2e-91    Brassica napus [oilseed rape]
gb|ABF69968.1|  vacuolar protein sorting 16 (VPS16) family protein      281   3e-91    Musa acuminata [banana]
ref|XP_008811095.1|  PREDICTED: protein VACUOLELESS1                    296   4e-91    Phoenix dactylifera
gb|KDP24238.1|  hypothetical protein JCGZ_26643                         296   4e-91    Jatropha curcas
emb|CDY14496.1|  BnaC03g20990D                                          296   5e-91    Brassica napus [oilseed rape]
ref|XP_002881559.1|  hypothetical protein ARALYDRAFT_321506             295   2e-90    Arabidopsis lyrata subsp. lyrata
ref|XP_010505412.1|  PREDICTED: protein VACUOLELESS1-like               295   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006296131.1|  hypothetical protein CARUB_v10025283mg             295   3e-90    Capsella rubella
ref|NP_565879.1|  vacuoleless1                                          294   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078020.1|  vacuoleless1                                       294   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133226.1|  PREDICTED: protein VACUOLELESS1                    294   5e-90    Brassica rapa
ref|XP_010509236.1|  PREDICTED: protein VACUOLELESS1                    293   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_002526647.1|  vacuolar protein sorting vps16, putative           288   6e-88    Ricinus communis
ref|XP_010517084.1|  PREDICTED: protein VACUOLELESS1-like               287   2e-87    Camelina sativa [gold-of-pleasure]
ref|XP_009416537.1|  PREDICTED: protein VACUOLELESS1                    283   4e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918871.1|  PREDICTED: protein VACUOLELESS1                    282   1e-85    Elaeis guineensis
ref|XP_006854657.1|  hypothetical protein AMTR_s00030p00200210          260   2e-77    Amborella trichopoda
dbj|BAJ33734.1|  unnamed protein product                                253   8e-75    Eutrema halophilum
ref|XP_001777594.1|  predicted protein                                  217   7e-62    
ref|XP_002963395.1|  hypothetical protein SELMODRAFT_80688              214   1e-60    
ref|XP_002974680.1|  hypothetical protein SELMODRAFT_101752             212   4e-60    
gb|ERZ97236.1|  hypothetical protein GLOINDRAFT_334475                  154   2e-39    
ref|XP_004345413.1|  vacuolar assembling/sorting protein VPS16          148   3e-37    Capsaspora owczarzaki ATCC 30864
gb|KFH65750.1|  hypothetical protein MVEG_07854                         147   7e-37    Mortierella verticillata NRRL 6337
ref|XP_005650736.1|  vacuolar protein sorting-associated protein 16     142   5e-35    Coccomyxa subellipsoidea C-169
ref|XP_005839798.1|  hypothetical protein GUITHDRAFT_161084             139   3e-34    Guillardia theta CCMP2712
emb|CEG71651.1|  hypothetical protein RMATCC62417_07353                 139   4e-34    Rhizopus microsporus
emb|CEP18375.1|  hypothetical protein                                   135   1e-32    Parasitella parasitica
dbj|GAN01171.1|  vacuolar protein sorting vps16 protein                 133   6e-32    Mucor ambiguus
ref|XP_004340672.1|  vacuolar protein sorting 16, putative              126   1e-29    Acanthamoeba castellanii str. Neff
ref|NP_001043804.2|  Os01g0666800                                       121   3e-29    
ref|XP_006682562.1|  hypothetical protein BATDEDRAFT_14644              125   3e-29    Batrachochytrium dendrobatidis JAM81
dbj|BAJ97322.1|  predicted protein                                      123   2e-28    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM83584.1|  unnamed protein product                                117   2e-27    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010232114.1|  PREDICTED: protein VACUOLELESS1                    120   2e-27    Brachypodium distachyon [annual false brome]
gb|EEE55144.1|  hypothetical protein OsJ_02938                          120   2e-27    Oryza sativa Japonica Group [Japonica rice]
dbj|BAB90498.1|  vacuolar protein sorting-associated protein VPS1...    118   1e-26    Oryza sativa Japonica Group [Japonica rice]
emb|CDH59927.1|  vacuolar protein sorting vps16                         116   4e-26    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_004969467.1|  PREDICTED: vacuolar protein sorting-associat...    115   1e-25    Setaria italica
emb|CCJ28605.1|  unnamed protein product                                115   1e-25    Pneumocystis jirovecii
gb|EEC71233.1|  hypothetical protein OsI_03188                          108   3e-25    Oryza sativa Indica Group [Indian rice]
ref|XP_646623.2|  hypothetical protein DDB_G0270754                     112   9e-25    Dictyostelium discoideum AX4
emb|CEJ04541.1|  Putative Vacuolar protein sorting vps16                110   2e-24    Rhizopus microsporus
ref|XP_002598771.1|  hypothetical protein BRAFLDRAFT_212848             111   3e-24    Branchiostoma floridae
ref|XP_007873550.1|  hypothetical protein PNEG_01594                    111   3e-24    Pneumocystis murina B123
emb|CEI87038.1|  hypothetical protein RMCBS344292_01458                 110   4e-24    Rhizopus microsporus
ref|XP_003287306.1|  hypothetical protein DICPUDRAFT_32286              109   9e-24    Dictyostelium purpureum
gb|EPB85961.1|  hypothetical protein HMPREF1544_07293                   108   2e-23    Mucor circinelloides f. circinelloides 1006PhL
gb|AFW83494.1|  hypothetical protein ZEAMMB73_114694                    106   1e-22    
ref|XP_008656726.1|  PREDICTED: protein VACUOLELESS1                    106   1e-22    Zea mays [maize]
ref|XP_005104108.1|  PREDICTED: vacuolar protein sorting-associat...    106   2e-22    
ref|XP_006646183.1|  PREDICTED: vacuolar protein sorting-associat...    106   2e-22    Oryza brachyantha
ref|XP_002591465.1|  hypothetical protein BRAFLDRAFT_105238             105   2e-22    Branchiostoma floridae
ref|XP_002621281.1|  vacuolar protein sorting vps16                     105   2e-22    Blastomyces gilchristii SLH14081
gb|EQL37787.1|  hypothetical protein BDFG_00836                         105   3e-22    Blastomyces dermatitidis ATCC 26199
gb|KFM68340.1|  hypothetical protein X975_12661                         105   3e-22    Stegodyphus mimosarum
ref|XP_002734080.2|  PREDICTED: vacuolar protein sorting-associat...    104   9e-22    Saccoglossus kowalevskii
ref|XP_781126.3|  PREDICTED: vacuolar protein sorting-associated ...    103   2e-21    Strongylocentrotus purpuratus [purple urchin]
gb|KEQ63929.1|  vacuolar protein sorting-associated protein 16          102   2e-21    Aureobasidium melanogenum CBS 110374
emb|CBJ31010.1|  conserved unknown protein                            97.8    5e-21    Ectocarpus siliculosus
gb|EJU02203.1|  vacuolar protein sorting-associated protein 16          101   6e-21    Dacryopinax primogenitus
gb|ELU17286.1|  hypothetical protein CAPTEDRAFT_168734                  101   6e-21    Capitella teleta
ref|XP_001259325.1|  vacuolar protein sorting vps16, putative           100   9e-21    Aspergillus fischeri NRRL 181
gb|KEY77885.1|  vacuolar protein sorting vps16                          100   9e-21    Aspergillus fumigatus var. RP-2014
ref|XP_753294.1|  vacuolar protein sorting vps16                        100   1e-20    Aspergillus fumigatus Af293
ref|XP_002456108.1|  hypothetical protein SORBIDRAFT_03g030590          100   2e-20    
gb|EER38773.1|  vacuolar sorting protein                              99.8    2e-20    Histoplasma capsulatum H143
gb|EEH09936.1|  vacuolar sorting-associated protein                   99.8    3e-20    Histoplasma capsulatum G186AR
gb|EGC44404.1|  vacuolar sorting-associated protein                   99.8    3e-20    Histoplasma capsulatum H88
emb|CDS07252.1|  hypothetical protein LRAMOSA01201                    99.0    4e-20    Lichtheimia ramosa
gb|KEQ75501.1|  vacuolar protein sorting-associated protein 16        99.0    4e-20    Aureobasidium namibiae CBS 147.97
emb|CCL98206.1|  predicted protein                                    99.4    4e-20    Fibroporia radiculosa
gb|KIW64485.1|  hypothetical protein PV04_09414                       99.0    4e-20    Phialophora americana
gb|KIL59455.1|  hypothetical protein M378DRAFT_85025                  99.0    4e-20    Amanita muscaria Koide BX008
ref|XP_001542324.1|  conserved hypothetical protein                   99.0    5e-20    Histoplasma capsulatum NAm1
ref|XP_002428971.1|  vacuolar protein sorting, putative               98.6    8e-20    Pediculus humanus corporis [human body lice]
ref|XP_002953465.1|  hypothetical protein VOLCADRAFT_105988           98.2    1e-19    Volvox carteri f. nagariensis
gb|KFG43269.1|  Vps16, N-terminal region protein                      94.4    1e-19    Toxoplasma gondii FOU
gb|KIW86230.1|  hypothetical protein Z517_01625                       97.4    2e-19    Fonsecaea pedrosoi CBS 271.37
gb|KFG44033.1|  Vps16, N-terminal region protein                      94.4    2e-19    Toxoplasma gondii p89
gb|KFG58811.1|  Vps16, N-terminal region protein                      94.4    2e-19    Toxoplasma gondii RUB
ref|XP_007869321.1|  vacuolar assembling/sorting protein VPS16        97.4    2e-19    Gloeophyllum trabeum ATCC 11539
ref|XP_004367009.1|  hypothetical protein DFA_07142                   97.4    2e-19    Cavenderia fasciculata
gb|KFX91659.1|  hypothetical protein V490_05796                       97.1    2e-19    Pseudogymnoascus sp. VKM F-3557
gb|KIO15844.1|  hypothetical protein M407DRAFT_235273                 95.5    3e-19    Tulasnella calospora MUT 4182
ref|XP_002678979.1|  predicted protein                                96.7    3e-19    Naegleria gruberi strain NEG-M
gb|KFY40837.1|  hypothetical protein V495_05238                       96.7    3e-19    Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|KFY04377.1|  hypothetical protein O988_00818                       96.7    3e-19    Pseudogymnoascus sp. VKM F-3808
ref|XP_001641101.1|  predicted protein                                96.7    3e-19    Nematostella vectensis
gb|KEQ96076.1|  hypothetical protein AUEXF2481DRAFT_64917             96.7    3e-19    Aureobasidium subglaciale EXF-2481
ref|XP_009153640.1|  hypothetical protein HMPREF1120_01377            96.7    3e-19    Exophiala dermatitidis NIH/UT8656
ref|XP_007850547.1|  vacuolar protein sorting vps16                   96.3    4e-19    
dbj|GAD99952.1|  vacuolar protein sorting vps16                       96.3    4e-19    Byssochlamys spectabilis No. 5
ref|XP_007728315.1|  hypothetical protein A1O1_09269                  96.3    4e-19    Capronia coronata CBS 617.96
ref|XP_008730333.1|  hypothetical protein G647_07799                  96.3    5e-19    Cladophialophora carrionii CBS 160.54
ref|XP_007270430.1|  vacuolar protein sorting-associated protein 16   96.3    5e-19    Fomitiporia mediterranea MF3/22
ref|XP_007351763.1|  vacuolar protein sorting-associated protein 16   95.9    5e-19    
gb|KFH03810.1|  Vps16, N-terminal region protein                      94.7    5e-19    Toxoplasma gondii VAND
ref|XP_011420366.1|  PREDICTED: vacuolar protein sorting-associat...  95.9    5e-19    Crassostrea gigas
ref|XP_003009824.1|  vacuolar protein sorting-associated protein      94.0    6e-19    Verticillium alfalfae VaMs.102
gb|KIW38854.1|  hypothetical protein PV06_08684                       95.9    6e-19    Exophiala oligosperma
gb|ETO77515.1|  hypothetical protein F444_07304                       96.3    6e-19    Phytophthora parasitica P1976
gb|ETM48446.1|  hypothetical protein L914_07020                       96.3    7e-19    Phytophthora parasitica
gb|ETL42068.1|  hypothetical protein L916_07062                       96.3    7e-19    Phytophthora parasitica
gb|ETK88680.1|  hypothetical protein L915_07109                       96.3    7e-19    Phytophthora parasitica
gb|ETL95226.1|  hypothetical protein L917_06946                       96.3    7e-19    Phytophthora parasitica
gb|ETP18545.1|  hypothetical protein F441_07251                       96.3    7e-19    Phytophthora parasitica CJ01A1
ref|XP_664515.1|  hypothetical protein AN6911.2                       95.5    7e-19    Aspergillus nidulans FGSC A4
tpe|CBF71716.1|  TPA: vacuolar protein sorting vps16, putative (A...  95.5    7e-19    Aspergillus nidulans FGSC A4
gb|ETI48788.1|  hypothetical protein F443_07235                       96.3    7e-19    Phytophthora parasitica P1569
ref|XP_002837491.1|  hypothetical protein                             95.5    7e-19    Tuber melanosporum Mel28
gb|ETP46453.1|  hypothetical protein F442_07305                       96.3    7e-19    Phytophthora parasitica P10297
ref|XP_007733017.1|  hypothetical protein A1O3_04699                  95.5    8e-19    Capronia epimyces CBS 606.96
ref|XP_011420359.1|  PREDICTED: vacuolar protein sorting-associat...  95.5    8e-19    Crassostrea gigas
gb|KIY03984.1|  hypothetical protein Z520_00676                       95.1    1e-18    Fonsecaea multimorphosa CBS 102226
ref|XP_008712782.1|  hypothetical protein HMPREF1541_09888            95.1    1e-18    Cyphellophora europaea CBS 101466
ref|XP_008887993.1|  vacuolar protein sorting 16, putative            95.1    1e-18    
gb|KEQ80575.1|  vacuolar protein sorting-associated protein 16        95.1    1e-18    Aureobasidium pullulans EXF-150
gb|KDQ31847.1|  hypothetical protein PLEOSDRAFT_48878                 95.1    1e-18    Pleurotus ostreatus PC15
ref|XP_007301979.1|  vacuolar assembling/sorting protein VPS16        95.1    1e-18    Stereum hirsutum FP-91666 SS1
gb|KFY19049.1|  hypothetical protein V491_04616                       94.7    1e-18    Pseudogymnoascus sp. VKM F-3775
ref|XP_003655439.1|  hypothetical protein THITE_2119126               94.7    1e-18    Thielavia terrestris NRRL 8126
ref|XP_005846081.1|  hypothetical protein CHLNCDRAFT_135924           95.1    1e-18    Chlorella variabilis
gb|KFY18957.1|  hypothetical protein V493_08231                       94.7    1e-18    Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_002369923.1|  hypothetical protein, conserved                  94.7    1e-18    
ref|XP_011318503.1|  hypothetical protein FGSG_02565                  94.7    2e-18    Fusarium graminearum PH-1
dbj|GAA90716.1|  vacuolar protein sorting vps16                       94.7    2e-18    Aspergillus kawachii IFO 4308
ref|XP_001401136.1|  vacuolar protein sorting vps16                   94.7    2e-18    Aspergillus niger CBS 513.88
gb|EHA27921.1|  hypothetical protein ASPNIDRAFT_53870                 94.7    2e-18    Aspergillus niger ATCC 1015
gb|EPR58066.1|  putative vacuolar protein sorting 16                  94.7    2e-18    Toxoplasma gondii GT1
gb|ESS29871.1|  putative vacuolar protein sorting 16                  94.7    2e-18    Toxoplasma gondii VEG
gb|EWZ38287.1|  hypothetical protein FOZG_09966                       94.4    2e-18    Fusarium oxysporum Fo47
gb|KIV93309.1|  hypothetical protein PV10_04533                       94.4    2e-18    Exophiala mesophila
gb|EXM23638.1|  hypothetical protein FOTG_09079                       94.4    2e-18    Fusarium oxysporum f. sp. vasinfectum 25433
gb|EXK40358.1|  hypothetical protein FOMG_07258                       94.4    2e-18    Fusarium oxysporum f. sp. melonis 26406
gb|EWY91619.1|  hypothetical protein FOYG_08668                       94.4    2e-18    Fusarium oxysporum FOSC 3-a
gb|KIW03814.1|  hypothetical protein PV09_05114                       94.4    2e-18    Verruconis gallopava
gb|KFZ12341.1|  hypothetical protein V502_07139                       94.4    2e-18    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|EWG49671.1|  hypothetical protein FVEG_09136                       94.4    2e-18    Fusarium verticillioides 7600
gb|ENH66099.1|  Putative vacuolar protein sorting-associated prot...  94.4    2e-18    Fusarium oxysporum f. sp. cubense race 1
gb|EWG49670.1|  hypothetical protein FVEG_09136                       94.4    2e-18    Fusarium verticillioides 7600
emb|CCG84590.1|  protein of unknown function                          94.4    2e-18    Taphrina deformans PYCC 5710
gb|EMT70745.1|  Putative vacuolar protein sorting-associated prot...  94.4    2e-18    Fusarium oxysporum f. sp. cubense race 4
emb|CCT69282.1|  related to vacuolar protein sorting VACUOLELESS1     94.4    2e-18    Fusarium fujikuroi IMI 58289
gb|KIW33525.1|  hypothetical protein PV07_00366                       94.4    2e-18    Cladophialophora immunda
gb|KFY86286.1|  hypothetical protein V500_07738                       94.4    2e-18    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_002899238.1|  vacuolar protein sorting-associated protein,...  94.7    2e-18    Phytophthora infestans T30-4
ref|XP_007796791.1|  putative vacuolar protein sorting-associated...  94.0    2e-18    
ref|XP_002848487.1|  vacuolar protein sorting-associated protein      94.0    2e-18    Microsporum canis CBS 113480
ref|XP_003855617.1|  hypothetical protein MYCGRDRAFT_68201            94.0    3e-18    Zymoseptoria tritici IPO323
gb|EPS32356.1|  hypothetical protein PDE_07316                        94.0    3e-18    Penicillium oxalicum 114-2
ref|XP_003030158.1|  hypothetical protein SCHCODRAFT_69044            94.0    3e-18    Schizophyllum commune H4-8
gb|KFY99509.1|  hypothetical protein V498_00707                       94.0    3e-18    Pseudogymnoascus sp. VKM F-4517 (FW-2822)
gb|KFY51994.1|  hypothetical protein V496_08707                       94.0    3e-18    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KIW21568.1|  hypothetical protein PV08_02148                       94.0    3e-18    Exophiala spinifera
emb|CCD43976.1|  similar to vacuolar protein sorting vps16            94.0    3e-18    Botrytis cinerea T4
ref|XP_009658018.1|  vacuolar protein sorting-associated protein      93.6    3e-18    Verticillium dahliae VdLs.17
ref|XP_007674604.1|  hypothetical protein BAUCODRAFT_66530            93.6    3e-18    Baudoinia panamericana UAMH 10762
ref|XP_005176360.1|  PREDICTED: vacuolar protein sorting-associat...  93.6    3e-18    Musca domestica
ref|XP_007839731.1|  hypothetical protein PFICI_12959                 93.2    4e-18    Pestalotiopsis fici W106-1
emb|CCX31232.1|  Similar to Probable vacuolar protein sorting-ass...  93.2    4e-18    Pyronema omphalodes CBS 100304
ref|XP_001215326.1|  conserved hypothetical protein                   93.2    4e-18    Aspergillus terreus NIH2624
ref|XP_009260076.1|  hypothetical protein FPSE_08683                  93.2    5e-18    Fusarium pseudograminearum CS3096
gb|KFZ05975.1|  hypothetical protein V501_07859                       93.6    5e-18    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
ref|XP_009537636.1|  hypothetical protein PHYSODRAFT_530775           93.6    5e-18    Phytophthora sojae
ref|XP_007750426.1|  hypothetical protein A1O5_11664                  92.8    6e-18    Cladophialophora psammophila CBS 110553
gb|KFY80059.1|  hypothetical protein V499_01034                       93.2    7e-18    Pseudogymnoascus sp. VKM F-103
emb|CCA23589.1|  vacuolar protein sortingassociated protein putative  92.8    7e-18    Albugo laibachii Nc14
ref|XP_001274640.1|  vacuolar protein sorting vps16, putative         92.8    7e-18    Aspergillus clavatus NRRL 1
gb|KIK56666.1|  hypothetical protein GYMLUDRAFT_230051                92.4    8e-18    Gymnopus luxurians FD-317 M1
ref|XP_004523432.1|  PREDICTED: vacuolar protein sorting-associat...  92.4    8e-18    Ceratitis capitata [medfly]
gb|KIW90849.1|  hypothetical protein Z519_08632                       92.4    8e-18    Cladophialophora bantiana CBS 173.52
emb|CDX91426.1|  BnaC04g07240D                                        85.1    8e-18    
gb|KDR24089.1|  Vacuolar protein sorting-associated protein 16-li...  92.4    8e-18    Zootermopsis nevadensis
gb|EYE92957.1|  vacuolar protein sorting-associated protein 16        92.4    9e-18    Aspergillus ruber CBS 135680
gb|KFY11799.1|  hypothetical protein V492_04262                       92.4    9e-18    Pseudogymnoascus sp. VKM F-4246
gb|KFY39836.1|  hypothetical protein V494_03792                       92.4    9e-18    Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KIW59851.1|  hypothetical protein PV05_00117                       92.0    1e-17    Exophiala xenobiotica
gb|KIJ36797.1|  hypothetical protein M422DRAFT_179088                 91.7    1e-17    Sphaerobolus stellatus SS14
ref|XP_010762126.1|  hypothetical protein PADG_06891                  92.0    1e-17    Paracoccidioides brasiliensis Pb18
ref|XP_003712813.1|  vacuolar protein sorting-associated protein      92.0    1e-17    Magnaporthe oryzae 70-15
gb|KIJ15884.1|  hypothetical protein PAXINDRAFT_168867                92.0    1e-17    Paxillus involutus ATCC 200175
ref|XP_001832533.2|  vacuolar protein sorting 16 isoform 1            92.0    1e-17    Coprinopsis cinerea okayama7#130
ref|XP_006606806.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  90.5    1e-17    
gb|EEH15770.1|  hypothetical protein PABG_05857                       91.7    1e-17    Paracoccidioides brasiliensis Pb03
gb|KEY69049.1|  hypothetical protein S7711_03347                      91.7    2e-17    Stachybotrys chartarum IBT 7711
emb|CEJ82684.1|  Putative Vacuolar sorting protein                    91.7    2e-17    Torrubiella hemipterigena
gb|KFA65450.1|  hypothetical protein S40285_00515                     91.7    2e-17    Stachybotrys chlorohalonata IBT 40285
gb|EFX68012.1|  hypothetical protein DAPPUDRAFT_63503                 91.7    2e-17    Daphnia pulex
ref|XP_009052918.1|  hypothetical protein LOTGIDRAFT_115951           91.3    2e-17    Lottia gigantea
gb|KIM91586.1|  hypothetical protein PILCRDRAFT_133551                91.3    2e-17    Piloderma croceum F 1598
ref|XP_007785089.1|  hypothetical protein W97_09035                   91.3    2e-17    Coniosporium apollinis CBS 100218
emb|CEL57340.1|  Vacuolar protein sorting-associated protein 16 h...  90.9    2e-17    Rhizoctonia solani AG-1 IB
ref|XP_011212493.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    2e-17    Bactrocera dorsalis [papaya fruit fly]
gb|KIO05251.1|  hypothetical protein M404DRAFT_141113                 90.9    3e-17    Pisolithus tinctorius Marx 270
gb|KIK24542.1|  hypothetical protein PISMIDRAFT_645755                90.9    3e-17    Pisolithus microcarpus 441
emb|CCO31224.1|  putative vacuolar protein sorting-associated pro...  90.9    3e-17    Rhizoctonia solani AG-1 IB
ref|XP_011191448.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    3e-17    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_009550055.1|  hypothetical protein HETIRDRAFT_325388           90.9    3e-17    Heterobasidion irregulare TC 32-1
gb|KDQ19047.1|  hypothetical protein BOTBODRAFT_28535                 90.5    3e-17    Botryobasidium botryosum FD-172 SS1
ref|XP_001229607.1|  hypothetical protein CHGG_03091                  90.5    3e-17    Chaetomium globosum CBS 148.51
ref|XP_001996143.1|  GH14334                                          90.5    3e-17    Drosophila grimshawi
gb|KEF53480.1|  hypothetical protein A1O9_10455                       90.5    4e-17    Exophiala aquamarina CBS 119918
gb|KHN97610.1|  Vacuolar protein sorting-associated protein 16        90.5    4e-17    Metarhizium album ARSEF 1941
dbj|GAM90669.1|  hypothetical protein ANO11243_087140                 90.5    4e-17    fungal sp. No.11243
gb|KGO75736.1|  Vps16, N-terminal                                     90.5    4e-17    Penicillium italicum
gb|EEH40515.2|  vacuolar protein sorting-associated protein           90.1    4e-17    Paracoccidioides lutzii Pb01
ref|XP_003300566.1|  hypothetical protein PTT_11835                   90.1    4e-17    
emb|CEG84394.1|  hypothetical protein RMATCC62417_18203               87.0    5e-17    Rhizopus microsporus
gb|KIV87870.1|  hypothetical protein PV11_03388                       90.1    5e-17    Exophiala sideris
gb|KIY47376.1|  vacuolar protein sorting-associated protein 16        90.1    5e-17    Fistulina hepatica ATCC 64428
gb|KIX08743.1|  hypothetical protein Z518_03400                       90.1    5e-17    Rhinocladiella mackenziei CBS 650.93
ref|XP_007761004.1|  hypothetical protein A1O7_08825                  90.1    5e-17    Cladophialophora yegresii CBS 114405
gb|KIK92586.1|  hypothetical protein PAXRUDRAFT_146989                90.1    6e-17    Paxillus rubicundulus Ve08.2h10
emb|CCA70355.1|  related to vacuolar protein sorting VACUOLELESS1     90.1    6e-17    Serendipita indica DSM 11827
ref|XP_002000799.1|  GI10429                                          89.7    7e-17    Drosophila mojavensis
gb|EMD35361.1|  hypothetical protein CERSUDRAFT_66538                 89.7    7e-17    Gelatoporia subvermispora B
ref|XP_007825096.2|  vacuolar sorting protein                         89.4    9e-17    Metarhizium robertsii ARSEF 23
gb|KFG82733.1|  vacuolar protein sorting vps16                        89.4    1e-16    Metarhizium anisopliae
gb|ELR08066.1|  hypothetical protein GMDG_02893                       89.4    1e-16    Pseudogymnoascus destructans 20631-21
gb|ESZ95296.1|  vacuolar protein sorting                              89.4    1e-16    Sclerotinia borealis F-4128
gb|EFW19425.1|  vacuolar protein sorting vps16                        89.0    1e-16    Coccidioides posadasii str. Silveira
ref|XP_008200104.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    1e-16    Tribolium castaneum [rust-red flour beetle]
ref|XP_011500724.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    1e-16    Ceratosolen solmsi marchali
ref|XP_003170422.1|  vacuolar protein sorting-associated protein      89.0    1e-16    Nannizzia gypsea CBS 118893
gb|EFA13302.1|  hypothetical protein TcasGA2_TC001384                 89.0    1e-16    
ref|XP_001239640.1|  hypothetical protein CIMG_09261                  89.0    1e-16    
gb|EZF35996.1|  hypothetical protein H101_00471                       89.0    1e-16    Trichophyton interdigitale H6
ref|XP_002172849.2|  HOPS complex subunit Vps16                       89.0    1e-16    Schizosaccharomyces japonicus yFS275
gb|KID97671.1|  vacuolar protein sorting vps16                        89.0    1e-16    Metarhizium majus ARSEF 297
gb|EAS28057.3|  vacuolar protein sorting vps16                        89.0    1e-16    Coccidioides immitis RS
ref|XP_007290703.1|  vacuolar protein sorting                         88.6    1e-16    
gb|KID75061.1|  vacuolar protein sorting vps16                        88.6    1e-16    
ref|XP_006693134.1|  putative vacuolar protein sorting-associated...  88.6    2e-16    
ref|XP_009850778.1|  hypothetical protein NEUTE1DRAFT_122061          88.6    2e-16    
ref|XP_004084191.2|  PREDICTED: vacuolar protein sorting-associat...  84.0    2e-16    
emb|CCI45876.1|  unnamed protein product                              88.6    2e-16    
ref|XP_002567389.1|  Pc21g03250                                       88.2    2e-16    
gb|EGE07561.1|  vacuolar protein sorting protein vps16                88.2    2e-16    
ref|XP_005431022.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    2e-16    
gb|EGD96647.1|  vacuolar protein sorting vps16                        88.2    2e-16    
ref|XP_007810471.1|  vacuolar protein sorting-associated protein      87.8    2e-16    
gb|EMF15307.1|  vacuolar protein sorting-associated protein           88.2    3e-16    
gb|KGO41557.1|  Vps16, N-terminal                                     87.8    3e-16    
gb|KGO60206.1|  Vps16, N-terminal                                     87.8    3e-16    
ref|XP_002584341.1|  conserved hypothetical protein                   87.8    3e-16    
gb|EFQ25156.1|  hypothetical protein GLRG_00300                       87.8    3e-16    
ref|XP_003067206.1|  Vps16 family protein                             87.8    3e-16    
gb|KDB28142.1|  hypothetical protein H109_00087                       87.4    4e-16    
emb|CDM31032.1|  Probable transposable element                        87.4    4e-16    
ref|XP_003231008.1|  vacuolar protein sorting vps16                   87.4    4e-16    
ref|XP_007371512.1|  vacuolar protein sorting-associated protein 16   87.4    4e-16    
gb|KDN71765.1|  hypothetical protein CSUB01_02661                     87.4    4e-16    
ref|XP_001881053.1|  vacuolar assembling/sorting protein VPS16        87.4    4e-16    
ref|XP_003351543.1|  hypothetical protein SMAC_00085                  87.4    5e-16    
emb|CCC05869.1|  unnamed protein product                              87.4    5e-16    
gb|EPS95124.1|  hypothetical protein FOMPIDRAFT_1043679               87.4    5e-16    
ref|XP_005518015.1|  PREDICTED: vacuolar protein sorting-associat...  87.0    5e-16    
ref|XP_962872.3|  vacuolar protein sorting-associated protein         87.0    5e-16    
gb|KIM67291.1|  hypothetical protein SCLCIDRAFT_179253                87.0    5e-16    
gb|KIJ59378.1|  hypothetical protein HYDPIDRAFT_118596                87.0    5e-16    
gb|KEZ45344.1|  Uncharacterized protein SAPIO_CDS2157                 87.0    6e-16    
gb|EPZ33949.1|  Vps16 domain-containing protein                       86.7    6e-16    
gb|KIP07308.1|  hypothetical protein PHLGIDRAFT_426170                87.0    6e-16    
ref|XP_002096919.1|  GE25939                                          86.7    7e-16    
ref|XP_001980849.1|  GG16085                                          86.7    7e-16    
gb|KHJ32046.1|  putative vacuolar protein sorting-associated protein  86.7    8e-16    
ref|XP_006010586.1|  PREDICTED: vacuolar protein sorting-associat...  86.7    8e-16    
ref|XP_005951517.1|  PREDICTED: vacuolar protein sorting-associat...  86.3    8e-16    
gb|KIK00029.1|  hypothetical protein K443DRAFT_101182                 86.7    8e-16    
ref|XP_007593995.1|  hypothetical protein CFIO01_01875                86.7    8e-16    
ref|XP_007771096.1|  vacuolar assembling sorting protein VPS16        86.7    8e-16    
ref|XP_005463829.1|  PREDICTED: vacuolar protein sorting-associat...  86.3    8e-16    
ref|XP_007384243.1|  vacuolar assembling/sorting protein VPS16        86.3    9e-16    
gb|KII87631.1|  hypothetical protein PLICRDRAFT_111626                86.3    1e-15    
ref|XP_003663128.1|  hypothetical protein MYCTH_2304613               86.3    1e-15    
ref|XP_005951515.1|  PREDICTED: vacuolar protein sorting-associat...  86.3    1e-15    
ref|XP_003458681.1|  PREDICTED: vacuolar protein sorting-associat...  85.9    1e-15    
ref|XP_310557.3|  AGAP000529-PA                                       85.9    1e-15    
gb|ERT01236.1|  hypothetical protein HMPREF1624_02478                 85.9    1e-15    
gb|EKV05733.1|  Vacuolar protein sorting vps16, putative              85.9    1e-15    
emb|CAG01327.1|  unnamed protein product                              85.9    1e-15    
ref|XP_007313955.1|  hypothetical protein SERLADRAFT_365727           85.9    1e-15    
ref|XP_005735068.1|  PREDICTED: vacuolar protein sorting-associat...  85.5    1e-15    
ref|XP_002031925.1|  GM23792                                          85.9    1e-15    
ref|XP_002104149.1|  GD18603                                          85.9    1e-15    
ref|XP_006791952.1|  PREDICTED: vacuolar protein sorting-associat...  85.5    2e-15    
ref|XP_004575656.1|  PREDICTED: vacuolar protein sorting-associat...  85.5    2e-15    
ref|XP_005735066.1|  PREDICTED: vacuolar protein sorting-associat...  85.5    2e-15    
ref|XP_001699374.1|  VPS16-like protein                               85.5    2e-15    
ref|XP_011117417.1|  hypothetical protein AOL_s00004g466              85.5    2e-15    
ref|NP_649877.1|  vacuolar protein sorting 16A                        85.5    2e-15    
ref|XP_001842734.1|  vacuolar protein sorting vps16                   85.5    2e-15    
ref|XP_009494993.1|  hypothetical protein H696_02818                  85.1    2e-15    
ref|XP_005812181.1|  PREDICTED: vacuolar protein sorting-associat...  85.1    2e-15    
gb|KFH40228.1|  vacuolar protein sorting-associated protein-like ...  85.1    2e-15    
ref|XP_005812180.1|  PREDICTED: vacuolar protein sorting-associat...  85.1    3e-15    
gb|KIH92692.1|  hypothetical protein SPBR_02318                       85.1    3e-15    
ref|XP_002795864.1|  vacuolar protein sorting-associated protein      84.7    3e-15    
gb|EME47796.1|  hypothetical protein DOTSEDRAFT_78000                 85.1    3e-15    
ref|XP_001936289.1|  vacuolar protein sorting-associated protein      84.7    3e-15    
ref|XP_003966794.1|  PREDICTED: vacuolar protein sorting-associat...  84.7    3e-15    
ref|XP_009217087.1|  vacuolar protein sorting-associated protein      84.7    3e-15    
ref|XP_006636484.1|  PREDICTED: vacuolar protein sorting-associat...  84.7    3e-15    
ref|XP_007540621.1|  PREDICTED: vacuolar protein sorting-associat...  84.7    3e-15    
gb|ETN68096.1|  vacuolar protein sorting vps16                        84.7    3e-15    
ref|XP_007248949.1|  PREDICTED: vacuolar protein sorting-associat...  84.7    4e-15    
gb|KFH11077.1|  Vps16, N-terminal region protein                      82.4    4e-15    
gb|KJA15614.1|  hypothetical protein HYPSUDRAFT_1068261               84.3    4e-15    
ref|XP_008852713.1|  PREDICTED: vacuolar protein sorting-associat...  84.0    5e-15    
ref|XP_001660915.1|  AAEL010559-PA                                    84.0    5e-15    
ref|XP_008042309.1|  vacuolar protein sorting-associated protein 16   84.0    5e-15    
gb|EHK17629.1|  hypothetical protein TRIVIDRAFT_76046                 84.0    6e-15    
ref|XP_002020368.1|  GL13948                                          84.0    6e-15    
ref|XP_001357562.2|  GA21090                                          84.0    6e-15    
ref|XP_002055907.1|  GJ10645                                          84.0    6e-15    
gb|KIR45019.1|  vacuolar protein sorting-associated protein           84.0    6e-15    
gb|KIK32973.1|  hypothetical protein CY34DRAFT_813942                 84.0    6e-15    
ref|XP_002401625.1|  vacuolar protein-sorting protein, putative       84.0    6e-15    
gb|KIR57748.1|  vacuolar protein sorting-associated protein           84.0    6e-15    
gb|KDR80313.1|  hypothetical protein GALMADRAFT_62817                 84.0    6e-15    
gb|EHK48630.1|  hypothetical protein TRIATDRAFT_158019                84.0    6e-15    
emb|CCE32487.1|  related to vacuolar protein sorting VACUOLELESS1     83.6    6e-15    
ref|XP_011112781.1|  hypothetical protein H072_7007                   83.6    7e-15    
ref|XP_008025837.1|  hypothetical protein SETTUDRAFT_136246           83.6    8e-15    
gb|ELU41202.1|  vacuolar assembling/sorting protein VPS16             83.6    8e-15    
ref|XP_006463395.1|  hypothetical protein AGABI2DRAFT_208148          83.6    8e-15    
ref|XP_002072009.1|  GK22550                                          83.2    9e-15    
ref|XP_007331990.1|  hypothetical protein AGABI1DRAFT_77347           83.2    1e-14    
ref|NP_001258079.1|  vacuolar protein sorting-associated protein ...  83.2    1e-14    
ref|XP_007922652.1|  hypothetical protein MYCFIDRAFT_60175            83.2    1e-14    
ref|XP_007802765.1|  hypothetical protein EPUS_00545                  83.2    1e-14    
gb|KFB37904.1|  AGAP000529-PA-like protein                            82.8    1e-14    
ref|XP_005380824.1|  PREDICTED: vacuolar protein sorting-associat...  82.4    1e-14    
ref|XP_010566769.1|  PREDICTED: vacuolar protein sorting-associat...  82.8    1e-14    
ref|XP_007195891.1|  PREDICTED: vacuolar protein sorting-associat...  82.4    1e-14    
gb|EWC48561.1|  hypothetical protein DRE_01783                        82.8    1e-14    
ref|XP_007393336.1|  hypothetical protein PHACADRAFT_193129           82.8    2e-14    
ref|XP_001824206.1|  vacuolar protein sorting vps16                   82.8    2e-14    
ref|XP_007195887.1|  PREDICTED: vacuolar protein sorting-associat...  82.4    2e-14    
gb|ENH86351.1|  vacuolar protein sorting vps16                        82.4    2e-14    
gb|EMD88012.1|  hypothetical protein COCHEDRAFT_1143839               82.4    2e-14    
ref|XP_005380823.1|  PREDICTED: vacuolar protein sorting-associat...  82.4    2e-14    
ref|XP_007465456.1|  PREDICTED: vacuolar protein sorting-associat...  82.0    2e-14    
ref|XP_009823468.1|  hypothetical protein H257_01794                  82.4    2e-14    
ref|XP_007699491.1|  hypothetical protein COCSADRAFT_116187           82.4    2e-14    
ref|XP_003476674.1|  PREDICTED: vacuolar protein sorting-associat...  82.0    2e-14    
ref|XP_008495020.1|  PREDICTED: vacuolar protein sorting-associat...  82.0    2e-14    
ref|XP_007716056.1|  hypothetical protein COCCADRAFT_105988           82.0    2e-14    
ref|XP_008434411.1|  PREDICTED: vacuolar protein sorting-associat...  82.0    2e-14    
ref|XP_007686147.1|  hypothetical protein COCMIDRAFT_24756            82.0    2e-14    
ref|XP_007898277.1|  PREDICTED: vacuolar protein sorting-associat...  82.0    2e-14    
ref|XP_004634302.1|  PREDICTED: vacuolar protein sorting-associat...  81.6    2e-14    
gb|EGN92883.1|  hypothetical protein SERLA73DRAFT_79230               82.0    2e-14    
ref|XP_007465455.1|  PREDICTED: vacuolar protein sorting-associat...  81.6    3e-14    
ref|XP_001907999.1|  hypothetical protein                             81.6    3e-14    
gb|EKG16533.1|  Vps16                                                 81.6    3e-14    
ref|XP_007127204.1|  PREDICTED: vacuolar protein sorting-associat...  81.6    3e-14    
ref|XP_004661527.1|  PREDICTED: vacuolar protein sorting-associat...  81.6    3e-14    
ref|XP_002477405.1|  predicted protein                                81.6    3e-14    
ref|XP_003476673.1|  PREDICTED: vacuolar protein sorting-associat...  81.6    3e-14    
ref|XP_004285369.1|  PREDICTED: vacuolar protein sorting-associat...  81.3    4e-14    
ref|XP_004317401.1|  PREDICTED: vacuolar protein sorting-associat...  81.3    4e-14    
ref|XP_004634301.1|  PREDICTED: vacuolar protein sorting-associat...  81.3    4e-14    
ref|XP_009098195.1|  PREDICTED: vacuolar protein sorting-associat...  81.6    4e-14    
ref|XP_008078574.1|  SET                                              81.6    4e-14    
ref|XP_004661526.1|  PREDICTED: vacuolar protein sorting-associat...  81.3    4e-14    
ref|XP_005068684.1|  PREDICTED: vacuolar protein sorting-associat...  80.9    5e-14    
ref|XP_002710925.2|  PREDICTED: vacuolar protein sorting-associat...  81.3    5e-14    
gb|AFR93063.2|  vacuolar protein sorting-associated protein           80.9    5e-14    
ref|XP_008323608.1|  PREDICTED: vacuolar protein sorting-associat...  81.3    5e-14    
ref|XP_004285368.1|  PREDICTED: vacuolar protein sorting-associat...  81.3    5e-14    
ref|XP_004697935.1|  PREDICTED: vacuolar protein sorting-associat...  80.9    5e-14    
ref|XP_004317400.1|  PREDICTED: vacuolar protein sorting-associat...  81.3    5e-14    
gb|EQL02195.1|  vacuolar sorting protein                              80.9    5e-14    
ref|XP_006965386.1|  vacuolar sorting protein                         80.9    6e-14    
ref|XP_004886773.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    6e-14    
ref|XP_005068683.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    7e-14    
ref|XP_004585724.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    7e-14    
ref|XP_007064739.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  80.9    7e-14    
ref|XP_004697934.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    8e-14    
ref|XP_003411664.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  80.5    8e-14    
gb|KGQ08995.1|  putative vacuolar protein sorting-associated prot...  80.5    8e-14    
ref|XP_008568870.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    8e-14    
ref|XP_006042780.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    8e-14    
ref|XP_008568869.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    8e-14    
ref|XP_004014429.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    8e-14    
ref|XP_004886770.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    9e-14    
ref|XP_004886771.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    9e-14    
ref|XP_004886769.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    9e-14    
ref|XP_001954740.1|  GF16588                                          80.1    9e-14    
ref|XP_003839994.1|  similar to vacuolar protein sorting vps16        80.1    9e-14    
ref|XP_006042779.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    1e-13    
ref|XP_008568868.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    1e-13    
ref|XP_010809680.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    1e-13    
gb|ENN73877.1|  hypothetical protein YQE_09530                        80.1    1e-13    
ref|NP_536338.1|  vacuolar protein sorting-associated protein 16 ...  80.1    1e-13    
gb|ENN73876.1|  hypothetical protein YQE_09530                        80.1    1e-13    
ref|NP_001153367.1|  vacuolar protein sorting 16 homolog A            80.1    1e-13    
ref|XP_004585723.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    1e-13    
ref|XP_004014428.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    1e-13    
gb|KIR83430.1|  vacuolar protein sorting-associated protein           80.1    1e-13    
ref|XP_010834814.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    1e-13    
gb|KIR31200.1|  vacuolar protein sorting-associated protein           80.1    1e-13    
ref|XP_003788109.1|  PREDICTED: vacuolar protein sorting-associat...  79.7    1e-13    
gb|KGB80280.1|  vacuolar assembling/sorting protein VPS16             80.1    1e-13    
ref|XP_010862318.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    1e-13    
tpg|DAA23165.1|  TPA: vacuolar protein sorting-associated protein...  80.1    1e-13    
ref|XP_005974817.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    1e-13    
ref|XP_005688275.1|  PREDICTED: vacuolar protein sorting-associat...  80.1    1e-13    
ref|XP_006042777.1|  PREDICTED: vacuolar protein sorting-associat...  79.7    1e-13    
ref|XP_008597775.1|  vacuolar protein sorting vps16                   79.7    1e-13    
gb|AAG34678.1|AF308801_1  vacuolar protein sorting protein 16         79.7    1e-13    
ref|NP_072097.2|  vacuolar protein sorting-associated protein 16 ...  79.7    1e-13    
ref|XP_569075.1|  vacuole organization and biogenesis-related pro...  79.7    1e-13    
ref|XP_009434986.1|  PREDICTED: vacuolar protein sorting-associat...  79.7    1e-13    
dbj|BAC33966.1|  unnamed protein product                              79.7    1e-13    
ref|XP_007497007.1|  PREDICTED: vacuolar protein sorting-associat...  79.7    2e-13    
ref|XP_008121385.1|  PREDICTED: vacuolar protein sorting-associat...  79.7    2e-13    
ref|XP_005320597.1|  PREDICTED: vacuolar protein sorting-associat...  79.3    2e-13    
ref|XP_003134377.1|  PREDICTED: vacuolar protein sorting-associat...  79.3    2e-13    
ref|XP_776977.1|  hypothetical protein CNBB5050                       79.3    2e-13    
ref|XP_004772965.1|  PREDICTED: vacuolar protein sorting-associat...  79.3    2e-13    
ref|XP_001496814.1|  PREDICTED: vacuolar protein sorting-associat...  79.3    2e-13    
ref|XP_004398209.1|  PREDICTED: vacuolar protein sorting-associat...  79.3    2e-13    
ref|XP_003788108.1|  PREDICTED: vacuolar protein sorting-associat...  79.3    2e-13    
gb|KIY31247.1|  vacuolar protein sorting-associated protein           79.3    2e-13    
ref|XP_002806793.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  79.3    2e-13    
ref|XP_005894002.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    2e-13    
ref|XP_003192484.1|  vacuole organization and biogenesis-related ...  79.3    2e-13    
gb|KIR50703.1|  vacuolar protein sorting-associated protein           79.3    2e-13    
gb|KIR76852.1|  vacuolar protein sorting-associated protein           79.3    2e-13    
ref|XP_006984591.1|  PREDICTED: vacuolar protein sorting-associat...  79.3    2e-13    
ref|XP_001800643.1|  hypothetical protein SNOG_10369                  79.3    2e-13    
sp|Q920Q4.3|VPS16_MOUSE  RecName: Full=Vacuolar protein sorting-a...  79.3    2e-13    
ref|XP_004383068.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    2e-13    
ref|XP_011279227.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    2e-13    
ref|XP_006500493.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    2e-13    
ref|XP_003134376.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    2e-13    
ref|XP_003941102.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    2e-13    
ref|NP_085036.3|  vacuolar protein sorting-associated protein 16 ...  79.0    2e-13    
ref|XP_006732343.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    2e-13    
ref|XP_005320596.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    2e-13    
ref|NP_001015522.1|  vacuolar protein sorting-associated protein ...  79.0    2e-13    
ref|XP_004772964.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    2e-13    
ref|XP_008046183.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    2e-13    
ref|XP_010609328.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    3e-13    
ref|XP_005568560.1|  PREDICTED: vacuolar protein sorting-associat...  78.6    3e-13    
dbj|BAB71013.1|  unnamed protein product                              78.6    3e-13    
ref|XP_005894001.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    3e-13    
gb|KIR25553.1|  vacuolar protein sorting-associated protein           79.0    3e-13    
ref|XP_004383066.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    3e-13    



>ref|XP_009625096.1| PREDICTED: protein VACUOLELESS1 [Nicotiana tomentosiformis]
Length=843

 Score =   363 bits (931),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 178/192 (93%), Gaps = 3/192 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ V+VAAEWQLL+NRYYRKPELYQMQWKHVDLTRNKVAC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAAVTVAAEWQLLHNRYYRKPELYQMQWKHVDLTRNKVACAPFGGPIAVIRDDAKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGVQI+ETVWKNPGGRL+GMSWTDDQTL+CITQDGT+YRY+I AEP+
Sbjct  61   AESALRKLRIFNSAGVQISETVWKNPGGRLIGMSWTDDQTLVCITQDGTIYRYNIHAEPI  120

Query  440  E---SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
            E    L+LG DCFTHSVV+C+FW NGVVCINEAFQV+CIPDF NP PIKLAD GLEDFPL
Sbjct  121  EPNSQLTLGADCFTHSVVECIFWGNGVVCINEAFQVYCIPDFNNPKPIKLADTGLEDFPL  180

Query  611  SMTVIEPQYTMS  646
               VIEPQYTMS
Sbjct  181  CTAVIEPQYTMS  192



>ref|XP_004243213.1| PREDICTED: protein VACUOLELESS1 [Solanum lycopersicum]
Length=843

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 177/192 (92%), Gaps = 3/192 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ V+VAAEWQLLYNRYYRKPE+Y MQWKHVDLTRNKVAC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAAVTVAAEWQLLYNRYYRKPEIYLMQWKHVDLTRNKVACAPFGGPIAVIRDDAKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGVQI+ETVWKNPGGRL+GMSWTDDQ L+CITQDGTVYRY+I AEP+
Sbjct  61   AESALRKLRIFNSAGVQISETVWKNPGGRLIGMSWTDDQILVCITQDGTVYRYNIHAEPI  120

Query  440  E---SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
            E    L+LG DCFTHSVV+CVFW NGVVCINEAFQV+CIPDF NP P+KLAD GLEDFPL
Sbjct  121  EPNSQLTLGADCFTHSVVECVFWGNGVVCINEAFQVYCIPDFNNPKPVKLADTGLEDFPL  180

Query  611  SMTVIEPQYTMS  646
             M VIEPQYTMS
Sbjct  181  CMAVIEPQYTMS  192



>ref|XP_006348963.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Solanum tuberosum]
Length=844

 Score =   359 bits (922),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 176/192 (92%), Gaps = 3/192 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ V+VAAEWQLLYNRYYRKPE+YQMQWKHVDLTRNKVAC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAAVTVAAEWQLLYNRYYRKPEIYQMQWKHVDLTRNKVACAPFGGPIAVIRDDAKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNS GVQI+ETVWKNPGGRL+GMSWTDDQ L+CITQDGTVYRY+I AEP+
Sbjct  61   AESALRKLRIFNSTGVQISETVWKNPGGRLIGMSWTDDQILVCITQDGTVYRYNIHAEPI  120

Query  440  E---SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
            E    L+LG DCFTHSVV+CVFW NGVVCINEAFQV+CIPDF NP P+KLAD  LEDFPL
Sbjct  121  EPNSQLTLGADCFTHSVVECVFWGNGVVCINEAFQVYCIPDFNNPKPVKLADTDLEDFPL  180

Query  611  SMTVIEPQYTMS  646
             M VIEPQYTMS
Sbjct  181  CMAVIEPQYTMS  192



>ref|XP_009790374.1| PREDICTED: protein VACUOLELESS1 [Nicotiana sylvestris]
Length=843

 Score =   357 bits (917),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 177/192 (92%), Gaps = 3/192 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ V+VAAEWQLL+NRYYRKPELYQMQWK+VDLTRNKVAC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAAVTVAAEWQLLHNRYYRKPELYQMQWKNVDLTRNKVACAPFGGPIAVIRDDAKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGVQI+ETVWKNPGGRL+GMSWTDDQ L+CITQDGTVYRY+I AEP+
Sbjct  61   AESALRKLRIFNSAGVQISETVWKNPGGRLIGMSWTDDQILVCITQDGTVYRYNIHAEPI  120

Query  440  E---SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
            E    L+LG DCFTHSVV+C+FW NGVVCINEAFQV+CIPDF NP PIKLAD GLEDFPL
Sbjct  121  EPNSQLTLGADCFTHSVVECIFWGNGVVCINEAFQVYCIPDFNNPKPIKLADTGLEDFPL  180

Query  611  SMTVIEPQYTMS  646
               VIEPQYTMS
Sbjct  181  CTAVIEPQYTMS  192



>emb|CDP06151.1| unnamed protein product [Coffea canephora]
Length=840

 Score =   331 bits (849),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVAC+PFGGPIA IRDDAKIVQLY
Sbjct  1    MAAVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACAPFGGPIAAIRDDAKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIFNSAGVQI+ETVW+N GGRL+GM+W+DD  LICITQDGTVY Y   AE +
Sbjct  61   SESALRKLRIFNSAGVQISETVWRNAGGRLIGMAWSDDLKLICITQDGTVYCYSFHAELI  120

Query  440  ESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  619
            ++LSLG+D   HS+V+CVFW NGVVCINEA +++CIP F NP+PI+LAD GLED PL M 
Sbjct  121  KTLSLGQDGLKHSIVECVFWGNGVVCINEAVELYCIPHFNNPSPIRLADTGLEDMPLCMA  180

Query  620  VIEPQYTMS  646
            VIEPQYTMS
Sbjct  181  VIEPQYTMS  189



>ref|XP_010271338.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Nelumbo nucifera]
Length=691

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+Y MQWK  DL RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MAAVSVAAEWQLLYNRYYRKPEIYTMQWKQFDLNRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGVQ++ETVW++ GGRLVGM+WTDDQ L+C+ QDGTVYRY++ AE  
Sbjct  61   AESALRKLRIFNSAGVQLSETVWRHSGGRLVGMAWTDDQILVCVVQDGTVYRYNVHAELQ  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E ++S+GK+CF  +VV+CVFW NG+VCI EA Q+FCIPDF+NPNP KLADP LE+FPL M
Sbjct  121  EPNISMGKECFEQNVVECVFWGNGMVCITEANQIFCIPDFQNPNPCKLADPLLEEFPLCM  180

Query  617  TVIEPQYTMS  646
            TVIEPQYTMS
Sbjct  181  TVIEPQYTMS  190



>ref|XP_004144632.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cucumis sativus]
 ref|XP_004166595.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cucumis sativus]
 gb|KGN54934.1| hypothetical protein Csa_4G608100 [Cucumis sativus]
Length=844

 Score =   328 bits (840),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLL+NRYYRKPELY M+WKH+DL RNKVAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLHNRYYRKPELYPMRWKHIDLGRNKVACAPFGGPIAIIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFN AG+Q+AETVW+NPGGRL+GM+WTDDQTL+C+ QDGTVYRY+I AE L
Sbjct  61   AESALRKLRIFNCAGIQLAETVWRNPGGRLIGMAWTDDQTLVCVVQDGTVYRYNIHAELL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E + S+GK+CF  +VV+CVFW NGVVCI EA Q+FCI DFKNPN  KL+DPG+ED P  M
Sbjct  121  EPNFSMGKECFEQNVVECVFWGNGVVCITEANQIFCISDFKNPNACKLSDPGIEDLPHCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYTMS
Sbjct  181  VVIEPQYTMS  190



>ref|XP_010271337.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Nelumbo nucifera]
Length=841

 Score =   327 bits (838),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+Y MQWK  DL RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MAAVSVAAEWQLLYNRYYRKPEIYTMQWKQFDLNRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGVQ++ETVW++ GGRLVGM+WTDDQ L+C+ QDGTVYRY++ AE  
Sbjct  61   AESALRKLRIFNSAGVQLSETVWRHSGGRLVGMAWTDDQILVCVVQDGTVYRYNVHAELQ  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E ++S+GK+CF  +VV+CVFW NG+VCI EA Q+FCIPDF+NPNP KLADP LE+FPL M
Sbjct  121  EPNISMGKECFEQNVVECVFWGNGMVCITEANQIFCIPDFQNPNPCKLADPLLEEFPLCM  180

Query  617  TVIEPQYTMS  646
            TVIEPQYTMS
Sbjct  181  TVIEPQYTMS  190



>ref|XP_002283428.1| PREDICTED: protein VACUOLELESS1 [Vitis vinifera]
 emb|CBI22093.3| unnamed protein product [Vitis vinifera]
Length=838

 Score =   327 bits (837),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 172/190 (91%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+Y MQWKH+DL+RNKVA +PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYPMQWKHIDLSRNKVAGAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGVQI+ETVWK+PGGRLVGM+WTDDQTLIC+ QDGTV+RY++ AE  
Sbjct  61   AESALRKLRIFNSAGVQISETVWKHPGGRLVGMAWTDDQTLICVVQDGTVFRYNVHAELQ  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E ++S+GK+CF  +VV+CVFW NG+VCI EA Q+FCI DFKNPNP KLADP L+++PL +
Sbjct  121  EPNISMGKECFEQNVVECVFWGNGMVCITEANQIFCISDFKNPNPCKLADPNLDEYPLCV  180

Query  617  TVIEPQYTMS  646
             VIEPQYTMS
Sbjct  181  AVIEPQYTMS  190



>ref|XP_010681470.1| PREDICTED: protein VACUOLELESS1 [Beta vulgaris subsp. vulgaris]
Length=844

 Score =   325 bits (834),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 170/194 (88%), Gaps = 6/194 (3%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYA  262
            + VS+AAEWQLLYNRYYRKPELY M+WKH+DL RNKVAC+PFGGPIAVIRDD+KIVQLYA
Sbjct  3    AAVSIAAEWQLLYNRYYRKPELYSMRWKHIDLNRNKVACAPFGGPIAVIRDDSKIVQLYA  62

Query  263  ESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE  442
            ESALRKLRIFNSAG QIAETVW+NPGGRL+GMSWTD+QTLICI QDGTVYRYDI A+ +E
Sbjct  63   ESALRKLRIFNSAGNQIAETVWRNPGGRLIGMSWTDEQTLICIVQDGTVYRYDIHAQVIE  122

Query  443  -SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNP-----IKLADPGLEDF  604
             SLSLGK+CF  SVV+CVFW NGVVC+NEAFQ FC+PDF N +      +KLADP L+D 
Sbjct  123  PSLSLGKECFEQSVVECVFWGNGVVCMNEAFQFFCVPDFSNFDSDNKGVVKLADPSLDDP  182

Query  605  PLSMTVIEPQYTMS  646
            PL M VIEP+YTMS
Sbjct  183  PLCMAVIEPKYTMS  196



>ref|XP_008465445.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
 ref|XP_008465446.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
Length=844

 Score =   325 bits (833),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLL+NRYYRKPELY M+WKH+DL RNKVAC+PFGGP+A+IRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLHNRYYRKPELYPMRWKHIDLGRNKVACAPFGGPVAIIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFN AG+Q+AETVW+NPGGRL+GM+WTDDQTL+C+ QDGTVYRY+I AE L
Sbjct  61   AESALRKLRIFNCAGIQLAETVWRNPGGRLIGMAWTDDQTLVCVVQDGTVYRYNIHAELL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E + S+GK+CF  +VV+CVFW NGVVCI EA Q+FCI DFKNP   KL+DPG+ED P  M
Sbjct  121  EPNFSMGKECFEQNVVECVFWGNGVVCITEANQIFCISDFKNPKSCKLSDPGIEDLPHCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYTMS
Sbjct  181  VVIEPQYTMS  190



>gb|EYU33990.1| hypothetical protein MIMGU_mgv1a001320mg [Erythranthe guttata]
Length=840

 Score =   324 bits (830),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELYQMQWK+VDLTRNK+AC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAGVSVAAEWQLLYNRYYRKPELYQMQWKNVDLTRNKIACAPFGGPIAVIRDDAKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIF S+G  I+ETVWKNPGGRL+G+SWTDD TL+CITQDGTVY YDI AE +
Sbjct  61   AESALRKLRIFTSSGRLISETVWKNPGGRLIGISWTDDLTLVCITQDGTVYSYDIHAELV  120

Query  440  ESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  619
             + SLGK+CF +SVV+CVFW +GVVCINEAF++F +PDFK P  +KLAD  LE+ P  M 
Sbjct  121  STFSLGKECFANSVVECVFWGSGVVCINEAFEIFAVPDFKTPKTVKLADSNLEELPHCMA  180

Query  620  VIEPQYTMS  646
            VIEPQYT S
Sbjct  181  VIEPQYTKS  189



>gb|KCW89755.1| hypothetical protein EUGRSUZ_A02017 [Eucalyptus grandis]
Length=742

 Score =   321 bits (822),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEW LLYNRYYRKPELY M+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWLLLYNRYYRKPELYPMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGV IAETVWK+PGGRL+GMSWTDDQTLIC+ QDGTV+RY+I AE L
Sbjct  61   AESALRKLRIFNSAGVLIAETVWKHPGGRLIGMSWTDDQTLICLVQDGTVFRYNIHAELL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E ++S+GK+CF  +VVDCVFW NG+VCI +A Q+FC+ DFKNP P KL+D GLED PL +
Sbjct  121  EPNISMGKECFEQNVVDCVFWGNGLVCITDANQLFCVSDFKNPQPYKLSDSGLEDLPLCV  180

Query  617  TVIEPQYTMS  646
             VIEPQY MS
Sbjct  181  AVIEPQYVMS  190



>gb|EPS58563.1| hypothetical protein M569_16250, partial [Genlisea aurea]
Length=258

 Score =   306 bits (783),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAA WQLLYNRYYRKPELYQMQWK+VDLTRNK+AC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAGVSVAAGWQLLYNRYYRKPELYQMQWKNVDLTRNKIACAPFGGPIAVIRDDAKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESA+RKLR+F S+G  I+ET+W+NPGGRL+GMSWTDD  L+CITQDGT+Y Y+I AE +
Sbjct  61   AESAIRKLRLFTSSGCLISETIWRNPGGRLIGMSWTDDLMLVCITQDGTIYFYNIHAELV  120

Query  440  ESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  619
             + SLGK+CF +SVV+CVFW +GVVCINEAF++F +PDFK P  +KLAD  L++ P  M 
Sbjct  121  NTFSLGKECFENSVVECVFWGSGVVCINEAFRIFSVPDFKVPKTVKLADCNLDELPHCMA  180

Query  620  VIEPQYTMS  646
            VI+PQYT S
Sbjct  181  VIDPQYTKS  189



>ref|XP_011082899.1| PREDICTED: protein VACUOLELESS1 [Sesamum indicum]
Length=840

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ V+VAAEWQLLYNRYYRKPELYQMQWK+VDLTRNK+AC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAGVAVAAEWQLLYNRYYRKPELYQMQWKNVDLTRNKIACAPFGGPIAVIRDDAKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIF S+G  I+ETVWKNPGGRL+GMSWTDD TLICITQDGTVY Y+I AE +
Sbjct  61   AESALRKLRIFTSSGRLISETVWKNPGGRLIGMSWTDDLTLICITQDGTVYSYNIHAELI  120

Query  440  ESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  619
             + SLGK+CF +SVV+CVFW NGVVCINEAF++F +PDFK P  +KLAD  LE+ P  + 
Sbjct  121  STFSLGKECFDNSVVECVFWGNGVVCINEAFEIFAVPDFKVPKTVKLADCNLEELPHCIA  180

Query  620  VIEPQYTMS  646
            VIEPQYT S
Sbjct  181  VIEPQYTKS  189



>ref|XP_010053830.1| PREDICTED: protein VACUOLELESS1 [Eucalyptus grandis]
Length=843

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEW LLYNRYYRKPELY M+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWLLLYNRYYRKPELYPMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGV IAETVWK+PGGRL+GMSWTDDQTLIC+ QDGTV+RY+I AE L
Sbjct  61   AESALRKLRIFNSAGVLIAETVWKHPGGRLIGMSWTDDQTLICLVQDGTVFRYNIHAELL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E ++S+GK+CF  +VVDCVFW NG+VCI +A Q+FC+ DFKNP P KL+D GLED PL +
Sbjct  121  EPNISMGKECFEQNVVDCVFWGNGLVCITDANQLFCVSDFKNPQPYKLSDSGLEDLPLCV  180

Query  617  TVIEPQYTMS  646
             VIEPQY MS
Sbjct  181  AVIEPQYVMS  190



>ref|XP_004303883.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=857

 Score =   317 bits (812),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+Y+M W HVDL+RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEVYRMTWSHVDLSRNKVACAPFGGPIAVIRDDSKIVQLR  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
             ESA RKLRIFNS+G+ + ET+WK+PGGRL+GMSWTDDQTL+C+ QDGTVYRY+I AE +
Sbjct  61   GESAQRKLRIFNSSGLLLGETIWKHPGGRLIGMSWTDDQTLVCLVQDGTVYRYNILAEIV  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E S+S+GK+CF  +VVDCVFW NGVVCI E+ Q+FC+ DF+NPNP++LADPG+ED P  M
Sbjct  121  EPSISMGKECFERNVVDCVFWGNGVVCITESNQLFCVSDFQNPNPVQLADPGIEDPPYCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYTMS
Sbjct  181  AVIEPQYTMS  190



>ref|XP_008342344.1| PREDICTED: protein VACUOLELESS1 [Malus domestica]
Length=840

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+Y+M WKHV+L RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYRMSWKHVELNRNKVACAPFGGPIAVIRDDSKIVQLG  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
             ESA RKLRIF+SAG  + ET+WK+PGGRL+GM+WTDDQ L+C+ QDGTV+RY I AE +
Sbjct  61   GESAQRKLRIFSSAGHLLGETIWKHPGGRLIGMAWTDDQNLVCLVQDGTVFRYTIHAELV  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E S+S+GK+CF  +VVDCVFW NGVVCI E  Q+FCI DFKNPNPIKLADPG+ED PL M
Sbjct  121  EPSISMGKECFERNVVDCVFWGNGVVCITETNQLFCISDFKNPNPIKLADPGIEDPPLCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYTMS
Sbjct  181  AVIEPQYTMS  190



>ref|XP_011467591.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=891

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+Y+M W HVDL+RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEVYRMTWSHVDLSRNKVACAPFGGPIAVIRDDSKIVQLR  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
             ESA RKLRIFNS+G+ + ET+WK+PGGRL+GMSWTDDQTL+C+ QDGTVYRY+I AE +
Sbjct  61   GESAQRKLRIFNSSGLLLGETIWKHPGGRLIGMSWTDDQTLVCLVQDGTVYRYNILAEIV  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E S+S+GK+CF  +VVDCVFW NGVVCI E+ Q+FC+ DF+NPNP++LADPG+ED P  M
Sbjct  121  EPSISMGKECFERNVVDCVFWGNGVVCITESNQLFCVSDFQNPNPVQLADPGIEDPPYCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYTMS
Sbjct  181  AVIEPQYTMS  190



>ref|XP_008229565.1| PREDICTED: protein VACUOLELESS1 [Prunus mume]
Length=841

 Score =   312 bits (799),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+Y+M WKHV+L RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYRMSWKHVELNRNKVACAPFGGPIAVIRDDSKIVQLG  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
             ESA RKLRIF+S+G  + ET+WK+PGGRL+GM+WTDDQTL+C+ QDGTV+RY I AE L
Sbjct  61   GESAQRKLRIFSSSGHLLGETIWKHPGGRLIGMAWTDDQTLVCLVQDGTVFRYTIHAELL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E S+S+G++CF  +VVDCVFW NG+VCI E  Q+FCI DFKNPNP+KLADP +ED PL M
Sbjct  121  EPSISMGQECFERNVVDCVFWGNGLVCITETNQLFCISDFKNPNPVKLADPEIEDPPLCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYTMS
Sbjct  181  AVIEPQYTMS  190



>ref|XP_007214933.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
 gb|EMJ16132.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
Length=844

 Score =   310 bits (794),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+Y+M WKHV+L RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYRMSWKHVELNRNKVACAPFGGPIAVIRDDSKIVQLG  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
             ESA RKLRIF+S+G  + ET+WK+PGGRL+GM+WTDDQTL+C+ QDGTV+RY I  E L
Sbjct  61   GESAQRKLRIFSSSGHLLGETIWKHPGGRLIGMAWTDDQTLVCLVQDGTVFRYTIHTELL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E S+S+G++CF  +VVDCVFW NG+VCI E  Q+FCI DFKNPNP+KLADP +ED PL M
Sbjct  121  EPSISMGQECFERNVVDCVFWGNGLVCITETNQLFCISDFKNPNPVKLADPEIEDPPLCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYTMS
Sbjct  181  AVIEPQYTMS  190



>ref|XP_010087860.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
 gb|EXB30296.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
Length=842

 Score =   310 bits (793),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY+M W HVDL+RN+VAC+PFGGPIAVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYRMGWLHVDLSRNRVACAPFGGPIAVIRDDSKIVQLH  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIFNSAGV ++ETVWKNPGGRLV MSWTDDQTL C+ QDGTVYRY++ A+ L
Sbjct  61   SESALRKLRIFNSAGVLLSETVWKNPGGRLVAMSWTDDQTLACVVQDGTVYRYNVYAKLL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E ++S+GK+CF  +VVDCVFW NG+VCI E+ Q+FCI DFKNP   +LAD G+E+ P  M
Sbjct  121  EPNISMGKECFEQNVVDCVFWGNGLVCITESNQLFCISDFKNPKSSQLADTGIEEPPHCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYTMS
Sbjct  181  AVIEPQYTMS  190



>ref|XP_010557595.1| PREDICTED: protein VACUOLELESS1 [Tarenaya hassleriana]
Length=861

 Score =   309 bits (791),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 167/195 (86%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLL+NRYYRKPE+YQM+WKHVDL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLFNRYYRKPEIYQMRWKHVDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+ I+ETVWKNPGGRLVGMSW+DDQTLICI QDGTVYRY+I +EP+
Sbjct  61   AESALRKLRIFNSAGILISETVWKNPGGRLVGMSWSDDQTLICIVQDGTVYRYNIHSEPI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            E + S+GK+CF  +VV+CVFW NGVVC+ E  Q+ CIPDFK   P KLAD PG+ +    
Sbjct  121  EPNFSMGKECFEQNVVECVFWGNGVVCLTEGGQLSCIPDFKTMKPCKLADVPGMTEDEML  180

Query  602  FPLSMTVIEPQYTMS  646
             P  + V EPQYTMS
Sbjct  181  RPYCLAVREPQYTMS  195



>ref|XP_004499978.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cicer arietinum]
Length=850

 Score =   308 bits (788),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY M+WKHVDL RNKVA +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHVDLARNKVAAAPFGGPLAVIRDDSKIVQLH  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
             ESALRKLRIF+S+G  +A+TVW+NPGGRL+GMSWTDD TL+C+ QDGTVYRYD+ A  +
Sbjct  61   GESALRKLRIFSSSGHLLADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYRYDVHARLI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +LSLGK+CF  +V DC FW NGVVCI EA Q+FCI DFKNPN +KLADPG+ + P  M
Sbjct  121  EPNLSLGKECFESNVADCAFWGNGVVCITEANQLFCIADFKNPNAVKLADPGIVEPPRCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYT+S
Sbjct  181  AVIEPQYTVS  190



>ref|XP_002302135.2| MANGLED family protein [Populus trichocarpa]
 gb|EEE81408.2| MANGLED family protein [Populus trichocarpa]
Length=844

 Score =   307 bits (786),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 166/192 (86%), Gaps = 3/192 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            MS VSVAAEWQLL +RYYRKPELY M+WKH+DL+RNKVAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MSNVSVAAEWQLLTDRYYRKPELYPMRWKHIDLSRNKVACAPFGGPIALIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGV ++ETVWK+PGGRL+GMSWT+DQTLICI QDGT+YRY++  E L
Sbjct  61   AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNVHGECL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD--PGLEDFPL  610
            E + S+GKDCF  +VVDCVFW NGVVC+ EA ++FC+PDFK   P KLA+   G+E+ P 
Sbjct  121  EPNFSMGKDCFEQNVVDCVFWGNGVVCLTEAGKLFCVPDFKEIKPCKLAEIGVGVEELPH  180

Query  611  SMTVIEPQYTMS  646
             M VIEPQYT+S
Sbjct  181  CMAVIEPQYTVS  192



>ref|XP_011026232.1| PREDICTED: protein VACUOLELESS1-like isoform X1 [Populus euphratica]
Length=844

 Score =   307 bits (786),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 166/192 (86%), Gaps = 3/192 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            MS VSVAAEWQLL +RYYRKPELY M+WKH+DL+RNKVAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MSNVSVAAEWQLLTDRYYRKPELYPMRWKHIDLSRNKVACAPFGGPIALIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGV ++ETVWK+PGGRL+GMSWT+DQTLICI QDGT+YRY++  E L
Sbjct  61   AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNVHGECL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD--PGLEDFPL  610
            E + S+GKDCF  +VVDCVFW NGVVC+ EA ++FC+PDFK   P KLA+   G+E+ P 
Sbjct  121  EPNFSMGKDCFEQNVVDCVFWGNGVVCLTEAGKLFCVPDFKEIKPCKLAEIGVGVEELPH  180

Query  611  SMTVIEPQYTMS  646
             M VIEPQYT+S
Sbjct  181  CMAVIEPQYTVS  192



>ref|XP_009377216.1| PREDICTED: LOW QUALITY PROTEIN: protein VACUOLELESS1 [Pyrus x 
bretschneideri]
Length=831

 Score =   306 bits (784),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 163/190 (86%), Gaps = 2/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+Y+M WKHV+L RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYRMSWKHVELNRNKVACAPFGGPIAVIRDDSKIVQLG  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
             ESA RKLRIF+SAG  + ET+WK+PGGRL+GM+WTDDQ L+C+ QDGTV+RY I AE +
Sbjct  61   GESAQRKLRIFSSAGHLLGETIWKHPGGRLIGMAWTDDQNLVCLVQDGTVFRYTIHAELV  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E S+S+GKD F  +VVDCVFW NGVVCI E  Q+FCI DFKNPNPIKLADP +ED PL M
Sbjct  121  EPSISMGKD-FERNVVDCVFWGNGVVCITETNQLFCISDFKNPNPIKLADPAIEDPPLCM  179

Query  617  TVIEPQYTMS  646
             VIEPQYTMS
Sbjct  180  AVIEPQYTMS  189



>ref|XP_011044765.1| PREDICTED: protein VACUOLELESS1-like [Populus euphratica]
Length=844

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 166/192 (86%), Gaps = 3/192 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLL NRYYRKPELY M+WKH+DL+RNKVAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLINRYYRKPELYPMRWKHIDLSRNKVACAPFGGPIAIIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSWT+DQTLICI QDGT+YRY++  E L
Sbjct  61   AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNVHCEVL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL--EDFPL  610
            E + S+GK+CF  +VVDCVFW NGVVC+ EA ++FC+PDFK   P KLA+ G+  E+ P 
Sbjct  121  EPNFSMGKECFEQNVVDCVFWGNGVVCLTEAGKLFCVPDFKQIKPCKLAEVGIGAEELPQ  180

Query  611  SMTVIEPQYTMS  646
             M VIEPQYT+S
Sbjct  181  CMAVIEPQYTVS  192



>gb|AES70033.2| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score =   305 bits (782),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY M+WKHVDL RNK+A +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHVDLARNKIAAAPFGGPLAVIRDDSKIVQLH  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
             ESALRKLR+F+S+G  +A+TVW+NPGGRL+GMSWTDD TL+C+ QDGTVYRYD+ A  +
Sbjct  61   GESALRKLRLFSSSGHLLADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYRYDVHARLI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +LSLGK+CF  +V DC FW NGVVCI E+ Q+FCI DFKNPN +KLADPG+ + P  M
Sbjct  121  EPNLSLGKECFESNVADCAFWGNGVVCITESNQLFCIADFKNPNAVKLADPGIVEPPRCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYT+S
Sbjct  181  AVIEPQYTVS  190



>gb|KEH16900.1| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score =   305 bits (782),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY M+WKHVDL RNK+A +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHVDLARNKIAAAPFGGPLAVIRDDSKIVQLH  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
             ESALRKLR+F+S+G  +A+TVW+NPGGRL+GMSWTDD TL+C+ QDGTVYRYD+ A  +
Sbjct  61   GESALRKLRLFSSSGHLLADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYRYDVHARLI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +LSLGK+CF  +V DC FW NGVVCI E+ Q+FCI DFKNPN +KLADPG+ + P  M
Sbjct  121  EPNLSLGKECFESNVADCAFWGNGVVCITESNQLFCIADFKNPNAVKLADPGIVEPPRCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYT+S
Sbjct  181  AVIEPQYTVS  190



>ref|XP_002306748.1| MANGLED family protein [Populus trichocarpa]
 gb|EEE93744.1| MANGLED family protein [Populus trichocarpa]
Length=844

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 165/192 (86%), Gaps = 3/192 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLL NRYYRKPELY M+WKH+DL+RNKVAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLINRYYRKPELYPMRWKHIDLSRNKVACAPFGGPIAIIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+  +ETVWK+PGGRL+GMSWT+DQTLICI QDGT+YRY++  E L
Sbjct  61   AESALRKLRIFNSAGILFSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNVHCEVL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL--EDFPL  610
            E + S+GK+CF  +VVDCVFW NGVVC+ EA ++FC+PDFK   P KLA+ G+  E+ P 
Sbjct  121  EPNFSMGKECFEQNVVDCVFWGNGVVCLTEAGKLFCVPDFKQIKPCKLAEVGIGAEELPH  180

Query  611  SMTVIEPQYTMS  646
             M VIEPQYT+S
Sbjct  181  CMAVIEPQYTVS  192



>ref|XP_003599782.1| Vacuolar protein sorting-associated protein-like protein [Medicago 
truncatula]
Length=856

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY M+WKHVDL RNK+A +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHVDLARNKIAAAPFGGPLAVIRDDSKIVQLH  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
             ESALRKLR+F+S+G  +A+TVW+NPGGRL+GMSWTDD TL+C+ QDGTVYRYD+ A  +
Sbjct  61   GESALRKLRLFSSSGHLLADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYRYDVHARLI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +LSLGK+CF  +V DC FW NGVVCI E+ Q+FCI DFKNPN +KLADPG+ + P  M
Sbjct  121  EPNLSLGKECFESNVADCAFWGNGVVCITESNQLFCIADFKNPNAVKLADPGIVEPPRCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYT+S
Sbjct  181  AVIEPQYTVS  190



>gb|KDO51890.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=691

 Score =   301 bits (772),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQL+YNRYYRKPELYQM+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGV I+ETVWKNPGGRL+GMSW++DQTLIC+ QDGTVYRY+I AE +
Sbjct  61   AESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E + S+GK+CF  +VV+CVFW NGVVC+ EA + FC+ DF      +LA P +E+ P  +
Sbjct  121  EPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCV  180

Query  617  TVIEPQYTMS  646
             VIEP+YTM+
Sbjct  181  AVIEPKYTMT  190



>ref|XP_003551927.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score =   303 bits (776),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY M WKHVDL R KVA +PFGGPIAVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMPWKHVDLARTKVAAAPFGGPIAVIRDDSKIVQLH  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLR+F+S+G  +A+ VW++PGGRLVGMSWTDDQTL+C+ QDGTVYRYD+ A  +
Sbjct  61   AESALRKLRLFSSSGRPLADAVWRHPGGRLVGMSWTDDQTLLCVVQDGTVYRYDVHANLI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +LSLGK+CF  +V DCVFW NG+VCI EA Q+FCI DF+NP+ +KLADP +E+ P  M
Sbjct  121  EPNLSLGKECFEDNVADCVFWGNGLVCITEANQLFCIADFRNPSAVKLADPEIEEMPHCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYT+S
Sbjct  181  AVIEPQYTVS  190



>gb|KJB10620.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=680

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGAEDLPNCM  180

Query  617  TVIEPQYTMS  646
             VIEP+YT+S
Sbjct  181  AVIEPKYTVS  190



>ref|XP_006437140.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
 ref|XP_006484899.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Citrus sinensis]
 gb|ESR50380.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
Length=839

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQL+YNRYYRKPELYQM+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGV I+ETVWKNPGGRL+GMSW++DQTLIC+ QDGTVYRY+I AE +
Sbjct  61   AESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E + S+GK+CF  +VV+CVFW NGVVC+ EA + FC+ DF      +LA P +E+ P  +
Sbjct  121  EPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCV  180

Query  617  TVIEPQYTMS  646
             VIEP+YTM+
Sbjct  181  AVIEPKYTMT  190



>gb|KDO51887.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=839

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQL+YNRYYRKPELYQM+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGV I+ETVWKNPGGRL+GMSW++DQTLIC+ QDGTVYRY+I AE +
Sbjct  61   AESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E + S+GK+CF  +VV+CVFW NGVVC+ EA + FC+ DF      +LA P +E+ P  +
Sbjct  121  EPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCV  180

Query  617  TVIEPQYTMS  646
             VIEP+YTM+
Sbjct  181  AVIEPKYTMT  190



>gb|KHG27227.1| Vacuolar sorting-associated protein 16 [Gossypium arboreum]
Length=789

 Score =   300 bits (769),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGTEDLPNCM  180

Query  617  TVIEPQYTMS  646
             VIEP+YT+S
Sbjct  181  AVIEPKYTVS  190



>ref|XP_006411003.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
 gb|ESQ52456.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
Length=858

 Score =   301 bits (771),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 166/195 (85%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            E ++++GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DFK   P KLAD PGL +    
Sbjct  121  EPNMTMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFKTMKPYKLADVPGLTEDDLL  180

Query  602  FPLSMTVIEPQYTMS  646
             P  + V EPQYTMS
Sbjct  181  QPTCLAVREPQYTMS  195



>ref|XP_003532091.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score =   301 bits (770),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY M WKHVDL R KVA +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMPWKHVDLARTKVAAAPFGGPVAVIRDDSKIVQLH  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLR+F+S+G  +A+ VW++PGGRLVGMSWTDDQTL+C+ QDGTVYRYD+ A  +
Sbjct  61   AESALRKLRLFSSSGRPLADAVWRHPGGRLVGMSWTDDQTLLCVVQDGTVYRYDVHANLI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +LSLGK+CF  +V DC FW +G+VCI EA Q+FCI DF+NP+ +KLADPG+++ P  M
Sbjct  121  EPNLSLGKECFEDNVADCAFWGHGLVCITEANQLFCIADFRNPSAVKLADPGIDEMPHCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYT+S
Sbjct  181  AVIEPQYTVS  190



>gb|KJB10619.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=772

 Score =   299 bits (766),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGAEDLPNCM  180

Query  617  TVIEPQYTMS  646
             VIEP+YT+S
Sbjct  181  AVIEPKYTVS  190



>gb|KJB10617.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=795

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGAEDLPNCM  180

Query  617  TVIEPQYTMS  646
             VIEP+YT+S
Sbjct  181  AVIEPKYTVS  190



>gb|KJB10618.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=844

 Score =   300 bits (769),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGAEDLPNCM  180

Query  617  TVIEPQYTMS  646
             VIEP+YT+S
Sbjct  181  AVIEPKYTVS  190



>gb|KJB10616.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=888

 Score =   300 bits (769),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGAEDLPNCM  180

Query  617  TVIEPQYTMS  646
             VIEP+YT+S
Sbjct  181  AVIEPKYTVS  190



>ref|XP_007048987.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
 gb|EOX93144.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
Length=809

 Score =   298 bits (762),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY M+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHMDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIF S+G  I+ETVWK+PGGRL+GMSWT+DQTLICI QDGTVYRY++ AE +
Sbjct  61   SESALRKLRIFTSSGALISETVWKHPGGRLIGMSWTEDQTLICIVQDGTVYRYNVHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E ++SLGK+CF  +VV+C+FW NGVVC+ E   +F IPDFK  +P +LA+ G ED P  M
Sbjct  121  EPNVSLGKECFEQNVVECMFWGNGVVCLTEGGLLFGIPDFKVMSPCQLAETGAEDLPNCM  180

Query  617  TVIEPQYTMS  646
             VIEP+YT+S
Sbjct  181  AVIEPKYTVS  190



>ref|XP_007048986.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
 gb|EOX93143.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
Length=844

 Score =   298 bits (763),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY M+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHMDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIF S+G  I+ETVWK+PGGRL+GMSWT+DQTLICI QDGTVYRY++ AE +
Sbjct  61   SESALRKLRIFTSSGALISETVWKHPGGRLIGMSWTEDQTLICIVQDGTVYRYNVHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E ++SLGK+CF  +VV+C+FW NGVVC+ E   +F IPDFK  +P +LA+ G ED P  M
Sbjct  121  EPNVSLGKECFEQNVVECMFWGNGVVCLTEGGLLFGIPDFKVMSPCQLAETGAEDLPNCM  180

Query  617  TVIEPQYTMS  646
             VIEP+YT+S
Sbjct  181  AVIEPKYTVS  190



>ref|XP_007146219.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
 gb|ESW18213.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
Length=843

 Score =   298 bits (762),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY M WKHVDL R KVA +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMPWKHVDLARTKVAVAPFGGPVAVIRDDSKIVQLH  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLR+F+S+G  +A+TVW++ GGRL+GMSWTDDQTL+CI QDGTVYRYD+ A  +
Sbjct  61   AESALRKLRLFSSSGRPLADTVWRHSGGRLIGMSWTDDQTLLCIVQDGTVYRYDVHANLI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E +LSLGK+CF  +V DC FW NG+VCI EA Q+FCI DF+NP  +KLADP +++ P  M
Sbjct  121  EPNLSLGKECFEDNVADCAFWGNGLVCITEANQLFCIADFRNPKAVKLADPMIDEMPHCM  180

Query  617  TVIEPQYTMS  646
             VIEPQYT+S
Sbjct  181  AVIEPQYTVS  190



>ref|XP_007048985.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
 gb|EOX93142.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
Length=874

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPELY M+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHMDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIF S+G  I+ETVWK+PGGRL+GMSWT+DQTLICI QDGTVYRY++ AE +
Sbjct  61   SESALRKLRIFTSSGALISETVWKHPGGRLIGMSWTEDQTLICIVQDGTVYRYNVHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            E ++SLGK+CF  +VV+C+FW NGVVC+ E   +F IPDFK  +P +LA+ G ED P  M
Sbjct  121  EPNVSLGKECFEQNVVECMFWGNGVVCLTEGGLLFGIPDFKVMSPCQLAETGAEDLPNCM  180

Query  617  TVIEPQYTMS  646
             VIEP+YT+S
Sbjct  181  AVIEPKYTVS  190



>emb|CDY07756.1| BnaA03g17550D [Brassica napus]
Length=858

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGV ++ETVWK+PGGRL+GMSW+DDQTLI I QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWSDDQTLISIVQDGTIYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            + ++++GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DFK   P KLAD PGL D    
Sbjct  121  QPNVTMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFKTMKPYKLADVPGLTDDDML  180

Query  602  FPLSMTVIEPQYTMS  646
             P  + V EPQYTMS
Sbjct  181  QPTCLAVREPQYTMS  195



>gb|ABF69968.1| vacuolar protein sorting 16 (VPS16) family protein [Musa acuminata]
Length=280

 Score =   281 bits (719),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M++VSVA EWQLLYNR+YRK  +Y MQW  +DL+R+++A +PFGGP+A IRDD+KIVQLY
Sbjct  1    MTSVSVAGEWQLLYNRFYRKLTIYTMQWGRIDLSRHRIAAAPFGGPVAAIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESA RKL IFN+AG  +A  +W  PGGRLVGM+WTDDQ L+C+ QDGTVYRY++ AE  
Sbjct  61   AESARRKLLIFNAAGRALASAIWDRPGGRLVGMAWTDDQVLVCVVQDGTVYRYNVHAELC  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
                S+GK+CF   VVDCVFW NG+VCI E F +FC+PDFKNP P +L+DPG++++PL +
Sbjct  121  APQFSMGKECFEQGVVDCVFWGNGMVCITEGFLIFCVPDFKNPVPCRLSDPGIDEYPLCV  180

Query  617  TVIEPQYTMS  646
             VI+PQYTMS
Sbjct  181  AVIDPQYTMS  190



>ref|XP_008811095.1| PREDICTED: protein VACUOLELESS1 [Phoenix dactylifera]
Length=844

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 158/190 (83%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ V+VAAEWQLL++RYYRK E+Y MQW  +DL R++VAC+PFGGP+A IRDD+KIVQLY
Sbjct  1    MAAVAVAAEWQLLHDRYYRKLEIYSMQWGRMDLARHRVACAPFGGPVAAIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE-P  436
            AESA RKL IFNSAGV +A   W  PGGRLVGM+WTDDQ+L+C+ QDGTVYRY++RAE  
Sbjct  61   AESARRKLHIFNSAGVHLASAAWDRPGGRLVGMAWTDDQSLVCVVQDGTVYRYNLRAELS  120

Query  437  LESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
                S+GK+CF   VV+CVFW NG++C+ E  Q+FC+PDFKNP P KLADPG+E++PL +
Sbjct  121  APQFSMGKECFEQGVVECVFWGNGMICLTEDRQIFCVPDFKNPKPCKLADPGIEEYPLCV  180

Query  617  TVIEPQYTMS  646
            TV+EPQYTMS
Sbjct  181  TVVEPQYTMS  190



>gb|KDP24238.1| hypothetical protein JCGZ_26643 [Jatropha curcas]
Length=847

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQ+L NR+YRK E+YQMQWKHVDL+RNKVAC+ FGGPIA+IRDD+KIVQLY
Sbjct  1    MANVSVAAEWQVLLNRFYRKLEIYQMQWKHVDLSRNKVACAQFGGPIAIIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSWTDDQTLICI QDGT+YRY+I AE L
Sbjct  61   SESALRKLRIFNSAGILVSETVWKHPGGRLIGMSWTDDQTLICIVQDGTIYRYNINAECL  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL---EDFP  607
            E + S+GK+CF  +VVDCVFW NGVVC+ EA ++FC+ DFK+  P K+AD  +   E+ P
Sbjct  121  EPNFSMGKECFEQNVVDCVFWGNGVVCLTEAGKLFCVADFKDIKPYKMADLVVEMEEELP  180

Query  608  LSMTVIEPQYTMS  646
              M VIEPQYT+S
Sbjct  181  HCMAVIEPQYTVS  193



>emb|CDY14496.1| BnaC03g20990D [Brassica napus]
Length=858

 Score =   296 bits (758),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGV ++ETVWK+PGGRL+GMSW+DDQTLI I QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWSDDQTLISIVQDGTIYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            + ++++GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DFK   P KLAD PGL +    
Sbjct  121  QPNVTMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFKTMKPYKLADVPGLTEDDML  180

Query  602  FPLSMTVIEPQYTMS  646
             P  + V EPQYTMS
Sbjct  181  QPTCLAVREPQYTMS  195



>ref|XP_002881559.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57818.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
Length=858

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 166/195 (85%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYDRYYRKPEIYQMKWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            E ++S+GK+CF  +VV+CVFW NGVVC+ E  Q+ CI DFK   P KL D PGL +    
Sbjct  121  EPNMSMGKECFEQNVVECVFWGNGVVCLTEGGQLVCIFDFKTMKPSKLPDVPGLAEDDLL  180

Query  602  FPLSMTVIEPQYTMS  646
             P+ +TV EP+YTMS
Sbjct  181  QPICLTVREPKYTMS  195



>ref|XP_010505412.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MTNVSVAAEWQLLYDRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+ ++ET+WK+PGGRL+GMSW+DDQTLIC+ QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGLLLSETIWKHPGGRLIGMSWSDDQTLICVVQDGTIYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            E ++S+GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DF    PIKL D PGL +    
Sbjct  121  EPNMSMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFDTMKPIKLPDVPGLTEDDML  180

Query  602  FPLSMTVIEPQYTMS  646
             P  + V EP+YTMS
Sbjct  181  QPTCLAVREPKYTMS  195



>ref|XP_006296131.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
 gb|EOA29029.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
Length=858

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYDRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+ ++ET+WK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGILLSETIWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            E ++S+GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DF+   P KL D PGL +    
Sbjct  121  EPNMSMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFEMMKPFKLPDVPGLTEDDML  180

Query  602  FPLSMTVIEPQYTMS  646
             P  + V EP+YTMS
Sbjct  181  QPTCLAVREPEYTMS  195



>ref|NP_565879.1| vacuoleless1 [Arabidopsis thaliana]
 sp|Q93VQ0.1|VCL1_ARATH RecName: Full=Protein VACUOLELESS1; AltName: Full=Vacuolar protein 
sorting-associated protein 16 homolog [Arabidopsis thaliana]
 gb|AAK43713.1|AF359240_1 VCL1 [Arabidopsis thaliana]
 gb|AAK82510.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AAM98105.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AEC09479.1| vacuoleless1 [Arabidopsis thaliana]
Length=858

 Score =   294 bits (753),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 166/195 (85%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYDRYYRKPEIYQMKWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            E ++S+G++CF  +VV+CVFW NGVVC+ E  Q+ CI DFK   P KL D PGL +    
Sbjct  121  EPNMSMGQECFEQNVVECVFWGNGVVCLTEGGQLICIFDFKTMKPSKLPDVPGLAEDDLL  180

Query  602  FPLSMTVIEPQYTMS  646
             P+ +TV EP+YTMS
Sbjct  181  QPICLTVREPKYTMS  195



>ref|NP_001078020.1| vacuoleless1 [Arabidopsis thaliana]
 gb|AEC09480.1| vacuoleless1 [Arabidopsis thaliana]
Length=834

 Score =   294 bits (752),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 166/195 (85%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYDRYYRKPEIYQMKWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            E ++S+G++CF  +VV+CVFW NGVVC+ E  Q+ CI DFK   P KL D PGL +    
Sbjct  121  EPNMSMGQECFEQNVVECVFWGNGVVCLTEGGQLICIFDFKTMKPSKLPDVPGLAEDDLL  180

Query  602  FPLSMTVIEPQYTMS  646
             P+ +TV EP+YTMS
Sbjct  181  QPICLTVREPKYTMS  195



>ref|XP_009133226.1| PREDICTED: protein VACUOLELESS1 [Brassica rapa]
Length=858

 Score =   294 bits (752),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 164/195 (84%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAGV ++ETVWK+PGGRL+GMSW+DDQTLI I QDGT+Y Y+I AE +
Sbjct  61   AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWSDDQTLISIVQDGTIYCYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            + ++++GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DFK   P KLAD PGL D    
Sbjct  121  QPNVTMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFKTMKPYKLADVPGLTDDDML  180

Query  602  FPLSMTVIEPQYTMS  646
             P  + V EPQYTMS
Sbjct  181  QPTCLAVREPQYTMS  195



>ref|XP_010509236.1| PREDICTED: protein VACUOLELESS1 [Camelina sativa]
Length=858

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MTNVSVAAEWQLLYDRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+ ++ET+WK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGLLLSETIWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            E ++S+GK+CF  +VV+CVFW NGVVC+ E  Q+ CI DF+   P KL D PGL +    
Sbjct  121  EPNMSMGKECFEQNVVECVFWGNGVVCLTEGGQLVCISDFETMKPSKLPDVPGLTEDDML  180

Query  602  FPLSMTVIEPQYTMS  646
             P S+ V EP+YTMS
Sbjct  181  QPTSLAVREPKYTMS  195



>ref|XP_002526647.1| vacuolar protein sorting vps16, putative [Ricinus communis]
 gb|EEF35735.1| vacuolar protein sorting vps16, putative [Ricinus communis]
Length=851

 Score =   288 bits (737),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 163/192 (85%), Gaps = 3/192 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            MS VSVAAEWQLL   +YRK E+YQMQWK++D TR  VAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MSNVSVAAEWQLLTTTFYRKQEIYQMQWKNIDFTRYIVACAPFGGPIAIIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            +ESALRKLRIFNSAG+ I+ETVWK+PGGRL+GMSWT+DQTLICI QDGT+YRY+I AE +
Sbjct  61   SESALRKLRIFNSAGILISETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNIHAEII  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL--EDFPL  610
            E + S+GK+CF  +VV+CVFW NGVVC+ +A ++FC+ DFK+  P+K+AD GL  E+ P 
Sbjct  121  EPNYSMGKECFEQNVVECVFWGNGVVCLTQAGKLFCVADFKDVKPVKMADLGLEFEEKPH  180

Query  611  SMTVIEPQYTMS  646
             M VIEPQ+T+S
Sbjct  181  CMAVIEPQFTVS  192



>ref|XP_010517084.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score =   287 bits (735),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 162/195 (83%), Gaps = 6/195 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MTNVSVAAEWQLLYDRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESALRKLRIFNSAG+  +ET+WK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGLLHSETIWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  601
            E ++S+GK+C   +VV+CVFW NGVVC+ E  Q+FCI DF    P KL D PGL +    
Sbjct  121  EPNMSMGKECDEQNVVECVFWGNGVVCLTEGGQLFCISDFDTMKPSKLPDVPGLTEDDML  180

Query  602  FPLSMTVIEPQYTMS  646
             P  + V EP+YTMS
Sbjct  181  QPTCLAVREPKYTMS  195



>ref|XP_009416537.1| PREDICTED: protein VACUOLELESS1 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   283 bits (724),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M++VSVA EWQLLYNR+YRK  +Y MQW  +DL+R+++A +PFGGP+A IRDD+KIVQLY
Sbjct  1    MTSVSVAGEWQLLYNRFYRKLTIYTMQWGRIDLSRHRIAAAPFGGPVAAIRDDSKIVQLY  60

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
            AESA RKL IFN+AG  +A  +W  PGGRLVGM+WTDDQ L+C+ QDGTVYRY++ AE  
Sbjct  61   AESARRKLLIFNAAGRALASAIWDRPGGRLVGMAWTDDQVLVCVVQDGTVYRYNVHAELC  120

Query  440  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
                S+GK+CF   VVDCVFW NG+VCI E F +FC+PDFKNP P +L+DPG++++PL +
Sbjct  121  APQFSMGKECFEQGVVDCVFWGNGMVCITEGFLIFCVPDFKNPVPCRLSDPGIDEYPLCV  180

Query  617  TVIEPQYTMS  646
             VI+PQYTMS
Sbjct  181  AVIDPQYTMS  190



>ref|XP_010918871.1| PREDICTED: protein VACUOLELESS1 [Elaeis guineensis]
Length=846

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +2

Query  104  EWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKL  283
            EWQLL++RYYRK E+Y MQW  +DL R++VAC+PFGGPIA IRDD+KIVQLYAESA RKL
Sbjct  11   EWQLLHDRYYRKLEIYSMQWGRMDLARHRVACAPFGGPIAAIRDDSKIVQLYAESARRKL  70

Query  284  RIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE-PLESLSLGK  460
             IFNSAGV +A   W  PGGRLVGM+WTDDQ+L+C+ QDGTVY Y++RAE      S+GK
Sbjct  71   HIFNSAGVPLASAAWDRPGGRLVGMAWTDDQSLVCVVQDGTVYFYNLRAELSAPQFSMGK  130

Query  461  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  640
            +CF   VV+CVFW NG++C+ E  Q+FC+PDFKNP P KLADPG+E++PL + VIEPQYT
Sbjct  131  ECFEQGVVECVFWGNGMICLTEDRQIFCVPDFKNPKPCKLADPGIEEYPLCVAVIEPQYT  190

Query  641  MS  646
            MS
Sbjct  191  MS  192



>ref|XP_006854657.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
 gb|ERN16124.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
Length=855

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 151/188 (80%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   TVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  265
            +VSVAAEWQ+L + YY+KPELY M W+++DL+R+K+AC+PFGGPIA +RD++KI+QL +E
Sbjct  2    SVSVAAEWQILSSHYYQKPELYSMCWRNMDLSRHKLACAPFGGPIAALRDESKIIQLLSE  61

Query  266  SALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE-  442
             A RKL+IFN+AG+ +A TVW  PGGRLV M+WTD QTL C+ QDGT++ YDI A  LE 
Sbjct  62   PARRKLQIFNAAGIPLASTVWDRPGGRLVAMAWTDHQTLACLVQDGTLFFYDIHAHILEP  121

Query  443  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  622
            SLS+G++C   +VV+CVFW NGVVC+ E   +FC+PD K+  P K ADPGLE+ PL M V
Sbjct  122  SLSMGRECREQNVVECVFWGNGVVCLTEGNLIFCVPDLKDLRPCKFADPGLEEPPLCMAV  181

Query  623  IEPQYTMS  646
            IEP++TMS
Sbjct  182  IEPKHTMS  189



>dbj|BAJ33734.1| unnamed protein product [Thellungiella halophila]
Length=833

 Score =   253 bits (645),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = +2

Query  155  MQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKN  334
            M+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLYAESALRKLRIFNSAG+ ++ETVWK+
Sbjct  1    MRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGILLSETVWKH  60

Query  335  PGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE-SLSLGKDCFTHSVVDCVFWHNGV  511
            PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +E ++++GK+CF  +VV+CVFW NGV
Sbjct  61   PGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELIEPNMTMGKECFEQNVVECVFWGNGV  120

Query  512  VCINEAFQVFCIPDFKNPNPIKLAD-PGLED----FPLSMTVIEPQYTMS  646
            VC+ E  Q+FCI DFK   P KLAD PGL +     P  + V EPQYTMS
Sbjct  121  VCLTEGGQLFCISDFKTMKPYKLADVPGLTEDDLLQPTCLAVREPQYTMS  170



>ref|XP_001777594.1| predicted protein [Physcomitrella patens]
 gb|EDQ57637.1| predicted protein [Physcomitrella patens]
Length=837

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 136/188 (72%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   TVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  265
             +S+AAEW+ LYNRYYRK E+Y M W  +DL+R+KVAC+ FGGPIA++RD++K+VQL AE
Sbjct  2    AISIAAEWEALYNRYYRKLEVYTMCWNGIDLSRHKVACARFGGPIAMVRDESKMVQLRAE  61

Query  266  SALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL-E  442
            SA  KL +F+++G  ++   W  PGGRL+ + WTD++ L+ +  DGTV++Y+I  E + E
Sbjct  62   SARAKLLLFSASGKLLSSVPWDRPGGRLITLGWTDEEILLAVVHDGTVFQYNIHGELIPE  121

Query  443  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  622
             LSLG++C+   V DC+ W +G+V I E  Q+F IP+ +    +KLADP LED P  M V
Sbjct  122  QLSLGQECWDQGVADCIIWGSGLVVITEQNQLFSIPNLETKKVVKLADPHLEDPPHCMAV  181

Query  623  IEPQYTMS  646
            +EPQYT S
Sbjct  182  VEPQYTFS  189



>ref|XP_002963395.1| hypothetical protein SELMODRAFT_80688 [Selaginella moellendorffii]
 gb|EFJ35266.1| hypothetical protein SELMODRAFT_80688 [Selaginella moellendorffii]
Length=839

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   TVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  265
             VSVAAEW  + NRYYRK E+Y+M W +V+L+ +KVAC+ FGG IA+IRDD KIV+L +E
Sbjct  2    AVSVAAEWSAIANRYYRKQEIYRMAWHNVELSGHKVACARFGGMIAIIRDDTKIVRLRSE  61

Query  266  SALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL-E  442
             A  KL IF S+G+ +A   W  PGGRL+ M W+D++ L C+ QDG+V+RYD+  + L +
Sbjct  62   PARPKLLIFRSSGLLVASITWDRPGGRLIAMGWSDEEILHCVMQDGSVFRYDVHGKLLPD  121

Query  443  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  622
             +  G++C+   +++C+ W NG+VC+ EA  VFCIPD  +P  +KLA   LED P  M +
Sbjct  122  KVWFGQECWDQGIMECIIWGNGIVCLTEANAVFCIPDLGSPQFVKLAQLTLEDPPHCMAI  181

Query  623  IEPQYTMS  646
            IEPQ+T+S
Sbjct  182  IEPQHTVS  189



>ref|XP_002974680.1| hypothetical protein SELMODRAFT_101752 [Selaginella moellendorffii]
 gb|EFJ24200.1| hypothetical protein SELMODRAFT_101752 [Selaginella moellendorffii]
Length=839

 Score =   212 bits (540),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 133/187 (71%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   VSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES  268
            VSVAAEW  + NRYYRK E+Y+M W +V+L+ +KVAC+ FGG IA+IRDD KIV+L +E 
Sbjct  3    VSVAAEWSAIANRYYRKQEIYRMAWHNVELSGHKVACARFGGMIAIIRDDTKIVRLRSEP  62

Query  269  ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL-ES  445
            A  KL IF S+G+ +A   W  PGGRL+ M W+D++ L C+ QDG+V+RYD+  + L + 
Sbjct  63   ARPKLLIFRSSGLLVASITWDRPGGRLIAMGWSDEEILHCVMQDGSVFRYDVHGKLLPDK  122

Query  446  LSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVI  625
            +  G++C+   +++C+ W NG+VC+ EA  VFCIPD  +P  +KL    LED P  M +I
Sbjct  123  VWFGQECWDQGIMECIIWGNGIVCLTEANAVFCIPDLGSPQFVKLTQLTLEDPPHCMAII  182

Query  626  EPQYTMS  646
            EPQ+T+S
Sbjct  183  EPQHTVS  189



>gb|ERZ97236.1| hypothetical protein GLOINDRAFT_334475 [Rhizophagus irregularis 
DAOM 181602]
Length=820

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 115/182 (63%), Gaps = 4/182 (2%)
 Frame = +2

Query  104  EWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-K  280
            +W  L +R+YRK E+Y M WK +DL++  +A +P+GGPIA+IRDD K++ L  +  ++  
Sbjct  8    DWNQLQDRFYRKQEIYAMLWKQLDLSKFMIAGAPYGGPIAMIRDDKKVILLQKQQPVKPT  67

Query  281  LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGK  460
            + ++ SAG  + +  W    GR+V M W++ + L+ + +DGT+  YDI  E    LSL K
Sbjct  68   IYLYTSAGKLMEQLQWDK--GRIVAMGWSESEKLVVVLEDGTIRLYDINGE-YTQLSLVK  124

Query  461  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  640
            +   +SV+DC  W  G+V +   F++  + +F+ P P  +ADPGL + P S TVI PQYT
Sbjct  125  EAKEYSVIDCQIWGTGLVALTGNFKLIVLTNFEEPRPHLMADPGLNEPPHSWTVIPPQYT  184

Query  641  MS  646
            +S
Sbjct  185  LS  186



>ref|XP_004345413.1| vacuolar assembling/sorting protein VPS16 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE95370.1| vacuolar assembling/sorting protein VPS16 [Capsaspora owczarzaki 
ATCC 30864]
Length=835

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 122/201 (61%), Gaps = 14/201 (7%)
 Frame = +2

Query  74   LRMSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKV-------ACSPFGGPIAVIR  232
            + +  ++ AA W  L +R+YRK E+Y M W+ +DL    +       + +PFGGPIA++R
Sbjct  1    MELEEINPAASWSPLQDRFYRKLEMYDMAWRSIDLAWRSIDLAMYVISAAPFGGPIALMR  60

Query  233  DDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY  412
            D++KI++  A+   R + I+N+AG   A+  W   G R+VG+ W++ + LIC+ +DGTV 
Sbjct  61   DNSKIIR--AQRTKRDIFIYNAAGTPFAQIPWD--GARIVGLGWSEQEELICVLEDGTVR  116

Query  413  RYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLAD  586
             +D++ EP+ + + G +    +V++C F+ +GVV +  AF  + I  F    P P +LA+
Sbjct  117  IFDVQGEPIRTFTFGHEVKDQTVIECKFYGSGVVILTGAFVFYAITTFSEEAPQPRRLAE  176

Query  587  -PGLEDFPLSMTVIEPQYTMS  646
             P +   P S  VIEPQ++++
Sbjct  177  IPEMTAAPTSWVVIEPQFSIN  197



>gb|KFH65750.1| hypothetical protein MVEG_07854 [Mortierella verticillata NRRL 
6337]
Length=820

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 112/183 (61%), Gaps = 4/183 (2%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-  277
            A+W  L +R+YRK E+Y M W+ +DL++  +A +PFGGP+A+ RDD K++ L  +   + 
Sbjct  6    ADWIQLQDRFYRKQEIYTMVWEQIDLSKCMIAAAPFGGPLALARDDRKVLLLQKQQPAKP  65

Query  278  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  457
             + ++ S+G ++    W    GR++GM WTD + L+C+ +DG V  Y+I  E     SLG
Sbjct  66   SINLYTSSGKRMEPIQWDK--GRIIGMGWTDTEQLLCVLEDGLVRMYNILGE-YTQFSLG  122

Query  458  KDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQY  637
            K+   + V+D   W  G+V +  +FQ+  + +F  P P  LAD G+ + P S TVI P++
Sbjct  123  KEAKENKVIDVQIWGTGLVALTGSFQLIAVTNFDEPRPKVLADAGINEPPHSWTVIPPKF  182

Query  638  TMS  646
            T+S
Sbjct  183  TLS  185



>ref|XP_005650736.1| vacuolar protein sorting-associated protein 16 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26192.1| vacuolar protein sorting-associated protein 16 [Coccomyxa subellipsoidea 
C-169]
Length=859

 Score =   142 bits (357),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 70/186 (38%), Positives = 110/186 (59%), Gaps = 3/186 (2%)
 Frame = +2

Query  92   SVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESA  271
            + A EW+   +R+Y K ELY M W  V L + +VAC+ +GGPIA++RDD K+V +     
Sbjct  3    AAAGEWEACGDRFYEKHELYTMAWSDVKLDQMRVACARYGGPIAMVRDDRKLVVVSGGIT  62

Query  272  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL-ESL  448
               +RIF +AG  +A  +W +  GR+ GM WT+++ L+ I   G V+ Y +  + L  S 
Sbjct  63   KPVVRIFTAAGETLAAFLWDH--GRIAGMGWTNEEDLLIIEDGGEVHMYSMHGQKLPRSF  120

Query  449  SLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIE  628
            SLG +     V DCV + +G+V +  A +++ + + + P P KLA  GL + P    VIE
Sbjct  121  SLGAEVAAERVTDCVVYGDGLVALTGAHRLWTVSNLEEPRPQKLALSGLTEPPHCFAVIE  180

Query  629  PQYTMS  646
            P++T+S
Sbjct  181  PRHTLS  186



>ref|XP_005839798.1| hypothetical protein GUITHDRAFT_161084 [Guillardia theta CCMP2712]
 gb|EKX52818.1| hypothetical protein GUITHDRAFT_161084 [Guillardia theta CCMP2712]
Length=824

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 108/186 (58%), Gaps = 5/186 (3%)
 Frame = +2

Query  98   AAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A  W  L++RYYRK E+Y+M W  VDL++  VA SPF GP A++RDD KI  + A S   
Sbjct  9    AGGWNKLFDRYYRKQEIYEMSWSDVDLSKMIVAGSPFAGPFAMLRDDKKISLISAGSLRP  68

Query  278  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  457
             L I++S+G  +A    +   GR+V M WT D+ LI +  DGTV ++      +++ S+G
Sbjct  69   TLNIYSSSGSLLASIPAQWKTGRVVEMGWTSDEKLIVVLDDGTVMQFSAVGRLIQTFSMG  128

Query  458  KDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDF---PLSMTVIE  628
            ++  T  V+ C  W +GVVC++ +  +  + +F+ P P ++  P L D    P  M +IE
Sbjct  129  EEFRTDRVLLCCIWGSGVVCLSRSHSLVFVDNFEEPIPRRM--PRLGDIASSPTCMVIIE  186

Query  629  PQYTMS  646
            P  T S
Sbjct  187  PSMTQS  192



>emb|CEG71651.1| hypothetical protein RMATCC62417_07353 [Rhizopus microsporus]
Length=820

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 111/183 (61%), Gaps = 4/183 (2%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-  277
            A+W  L++R+Y+K E+Y + W   DL++  +A + +GGPIA+IRDD K++ L  +  ++ 
Sbjct  7    ADWTELHDRFYKKQEIYSLSWNQSDLSKFMIAGAQYGGPIAMIRDDRKVLLLQKQQPIKP  66

Query  278  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  457
             + ++ SAG  I +  W    G++VG+ WT+ + L+ +T+DG+V  Y +  +     SLG
Sbjct  67   TIYMYTSAGKLIEQIQWDK--GKIVGLGWTEQEQLVVVTEDGSVRLYTLHGQ-FSQFSLG  123

Query  458  KDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQY  637
            K+     ++DC  W  G+V +   +Q+  + +F  P P  LAD  L++ P S T++ PQ+
Sbjct  124  KEAKDDGIIDCQIWGGGLVAMTSKYQLISVTNFLEPQPKPLADIRLDEPPHSWTIVPPQF  183

Query  638  TMS  646
            T+S
Sbjct  184  TLS  186



>emb|CEP18375.1| hypothetical protein [Parasitella parasitica]
Length=820

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 108/183 (59%), Gaps = 4/183 (2%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-  277
            ++W  L++R+YRK E+Y + W   DL++  +A + +GGPIA+IRDD K++ L  +  ++ 
Sbjct  7    SDWTELHDRFYRKQEIYSLTWNQTDLSKFMIAGAQYGGPIAMIRDDKKVLLLQKQQPIKP  66

Query  278  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  457
             + ++ SAG  I +  W    GR+VG+ WTD + L+ +T DG+V  Y +        SLG
Sbjct  67   TIYMYTSAGKLIEQIQWDK--GRIVGLGWTDQEQLVVVTDDGSVRLYALDGN-YTQFSLG  123

Query  458  KDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQY  637
            KD  +  ++DC  W  G++ +   +Q+  +  F  P P  +A+  L++   S TV+ PQ+
Sbjct  124  KDAKSDGIIDCQIWGGGLIAMTGKYQLISLTKFDEPQPRMMAELKLDEPFHSWTVVPPQF  183

Query  638  TMS  646
            T+S
Sbjct  184  TLS  186



>dbj|GAN01171.1| vacuolar protein sorting vps16 protein [Mucor ambiguus]
Length=820

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 109/183 (60%), Gaps = 4/183 (2%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-  277
            ++W  L++R+YRK E+Y + W   DL++  ++ + +GGPIA+IRDD K++ L  +  ++ 
Sbjct  7    SDWTELHDRFYRKQEIYTLSWNQTDLSKFMISGAQYGGPIAMIRDDKKVLLLQKQQPIKP  66

Query  278  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  457
             + ++ SAG  + +  W    GR+V + WTD + L+ +T DG+V  Y +     +  SLG
Sbjct  67   TIYMYTSAGKLMEQIQWDK--GRIVALGWTDQEQLVVVTDDGSVRLYTLHGHYTQ-FSLG  123

Query  458  KDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQY  637
            KD     ++DC  W  G+V +   +Q+  + +F+ P P  +A+  L++   S TV+ PQ+
Sbjct  124  KDAKNDGIIDCQIWGGGLVAMTGKYQLISLTNFEEPQPKMMAELRLDEPLHSWTVVPPQF  183

Query  638  TMS  646
            T+S
Sbjct  184  TLS  186



>ref|XP_004340672.1| vacuolar protein sorting 16, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18630.1| vacuolar protein sorting 16, putative [Acanthamoeba castellanii 
str. Neff]
Length=861

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 107/181 (59%), Gaps = 4/181 (2%)
 Frame = +2

Query  107  WQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-KL  283
            W+ L +R YRK ELY + W+ VDL+++ V  +P GG +AV RD+ KIV L    +L+ + 
Sbjct  35   WKPLGDRNYRKRELYDLNWE-VDLSKHVVTGAPCGGALAVARDERKIVLLANTESLKSQT  93

Query  284  RIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKD  463
             I+ S+GV I    W +  GR+V + WT D+ L+CI + G V  Y+++ E + + S+G +
Sbjct  94   HIYTSSGVLIKSFAWDSQKGRVVRLGWTADEKLVCIFESGAVMIYNVQGENVSAWSVGPE  153

Query  464  CFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTM  643
            C    + D +FW  G V +++A ++F + +  +P    L D  LE  P++  VI P  ++
Sbjct  154  C--GEIQDALFWGTGFVVLSKALRLFAVMNLADPKIRPLPDARLESAPVTWCVIGPDVSL  211

Query  644  S  646
            S
Sbjct  212  S  212



>ref|NP_001043804.2| Os01g0666800 [Oryza sativa Japonica Group]
 dbj|BAF05718.2| Os01g0666800 [Oryza sativa Japonica Group]
Length=310

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 116/223 (52%), Gaps = 35/223 (16%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELYQ-MQWK---------------------------HVDL  178
            S+VSVAAEW LL +R+YR+  +Y  + W                             +DL
Sbjct  3    SSVSVAAEWDLLSDRFYRRITVYSPLPWSPPSAAAASSSSTSGGGGGGGGSGGVLGRLDL  62

Query  179  TRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGM  358
            + + VA +PFGGPIA +RDD+KIVQL++E + R+L +++S+G  IA + W     RL  +
Sbjct  63   STHIVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLYSSSGHPIASSPWPPQLPRLHSL  122

Query  359  SWTDDQTLICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEA  529
            +++    L+ +  DG++ R+   D++  P  +        +  V D  FW  GV  + E 
Sbjct  123  AFSSSLNLVALLSDGSLLRFRLPDLKPNPSPTPVPLLPTSSGGVADAAFWGGGVAVLTED  182

Query  530  FQVFCIPDFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMS  646
             +V    D    +P+P + ADP  G ++  L M V+EPQ+ MS
Sbjct  183  NRVVVTTDIDAADPHPREFADPCVGQDEQVLCMAVVEPQFVMS  225



>ref|XP_006682562.1| hypothetical protein BATDEDRAFT_14644 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76689.1| hypothetical protein BATDEDRAFT_14644 [Batrachochytrium dendrobatidis 
JAM81]
Length=749

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 111/193 (58%), Gaps = 3/193 (2%)
 Frame = +2

Query  74   LRMSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQ  253
            + ++  S   +W  L +++YRK ELYQM W  VDL +  VA +PFGGPIA++R+D K+V 
Sbjct  1    MSLAYTSPCGDWNPLADKFYRKYELYQMIWNKVDLAKMTVAAAPFGGPIAMMRNDRKMVA  60

Query  254  LYAESALRKLRIFNSAGVQIA--ETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  427
            + A S+   + I+ S+G  +   +    +   R++ M WT  + L+C+ + G++  YD++
Sbjct  61   VAALSSKPVMHIYTSSGKLLTQFQASLNHRANRIIVMGWTLKERLVCVMEYGSLRLYDLQ  120

Query  428  AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFP  607
             + ++ ++LG++   + V+D   W N  V +    ++  + +   P PI LA+PGL   P
Sbjct  121  GDFVQ-ITLGEEAKENGVLDAHVWENSAVILTTNLKLILVANLDEPRPILLANPGLVQPP  179

Query  608  LSMTVIEPQYTMS  646
             S + I   Y++S
Sbjct  180  HSWSFISATYSLS  192



>dbj|BAJ97322.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=899

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/234 (34%), Positives = 126/234 (54%), Gaps = 34/234 (15%)
 Frame = +2

Query  35   ARIIQSGAPSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQ-MQWK---------------  166
            AR     AP+S     S++SVAAEW LL +R+YR+  +Y  + W                
Sbjct  15   ARARSGRAPTSPRPMSSSISVAAEWDLLSDRFYRRVTIYSPLPWSSPATTTASSSGGGSS  74

Query  167  ---HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNP  337
                +DL+ + VA +PFGGPIA +RDD+KIVQL++E + R+L +F+S+G  +A + W   
Sbjct  75   GVGRLDLSTHIVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSGHPLASSPWTPH  134

Query  338  GGRLVGMSWTDDQTLICITQDGTVYRYDI-------RAEPLESLSLGKDCFTHSVVDCVF  496
              RL  ++++    L+ +  DG++ R+ +        + P+  L       +  V D VF
Sbjct  135  LPRLHSLAFSSSLNLLALLSDGSLLRFRLPDLNPITSSSPVPLLPPA----SGGVADAVF  190

Query  497  WHNGVVCINEAFQVFCIPDFK--NPNPIKLADPGL--EDFPLSMTVIEPQYTMS  646
            W  GV  + E  +V    D +  +P+P +LADPG+  ++  L M V+EPQ+ MS
Sbjct  191  WGGGVAILTEDNRVVVTTDIEVDDPHPRELADPGVAEDEQVLCMAVVEPQFVMS  244



>emb|CDM83584.1| unnamed protein product [Triticum aestivum]
Length=398

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 119/214 (56%), Gaps = 26/214 (12%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELYQ-MQWK------------------HVDLTRNKVACSP  205
            S+VSVAAEW LL +R+YR+  +Y  + W                    +DL+ + VA +P
Sbjct  3    SSVSVAAEWDLLSDRFYRRITIYSPLPWSSPATTTASSSGGGSSGVSRLDLSTHIVAAAP  62

Query  206  FGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLI  385
            FGGPIA +RDD+KIVQL++E + R+L +F+S+G  +A + W     RL  ++++    L+
Sbjct  63   FGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSGHPLASSPWTPHLPRLHSLAFSSSLNLL  122

Query  386  CITQDGTVYRYDI-RAEPLESLSLGK--DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDF  556
             +  DG++ R+ +    P+ S S        +  V D VFW  GV  + E  +V    D 
Sbjct  123  ALLSDGSLLRFRLPDLNPITSSSPVPLLPPASGGVADAVFWGGGVAILTEDNRVVVTTDI  182

Query  557  K--NPNPIKLADPGL--EDFPLSMTVIEPQYTMS  646
            +  +P+P +LADPG+  ++  L M V+EPQ  MS
Sbjct  183  EVDDPHPRELADPGVAEDEQVLCMAVVEPQLVMS  216



>ref|XP_010232114.1| PREDICTED: protein VACUOLELESS1 [Brachypodium distachyon]
Length=877

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 118/214 (55%), Gaps = 26/214 (12%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELYQ-MQWK------------------HVDLTRNKVACSP  205
            S+VSVAAEW LL +R+YR+  +Y  + W                    +DL+ + VA +P
Sbjct  3    SSVSVAAEWDLLSDRFYRRITIYSPLPWSSPATTTASSSGGGTGGVGRLDLSNHIVAAAP  62

Query  206  FGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLI  385
            FGGPIA +RDD+KIVQL++E + R+L +F+S+G  +A + W     RL  ++++    L+
Sbjct  63   FGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSGHPLASSPWTPHLPRLHSLAFSSSLNLL  122

Query  386  CITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDF  556
             +  DG++ R+   D+   P  S        +  V D VFW  GV  + E  +V    D 
Sbjct  123  ALLSDGSLLRFRLPDLNPMPSSSPVPLLPPASGGVADAVFWGGGVAILTEDNRVVVTTDI  182

Query  557  K--NPNPIKLADP--GLEDFPLSMTVIEPQYTMS  646
            +  +P+P +LADP  G ++  L M V+EPQ+ MS
Sbjct  183  EVDDPHPRELADPCVGEDEQVLCMAVVEPQFVMS  216



>gb|EEE55144.1| hypothetical protein OsJ_02938 [Oryza sativa Japonica Group]
Length=988

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 116/223 (52%), Gaps = 35/223 (16%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELYQ-MQWK---------------------------HVDL  178
            S+VSVAAEW LL +R+YR+  +Y  + W                             +DL
Sbjct  3    SSVSVAAEWDLLSDRFYRRITVYSPLPWSPPSAAAASSSSTSGGGGGGGGSGGVLGRLDL  62

Query  179  TRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGM  358
            + + VA +PFGGPIA +RDD+KIVQL++E + R+L +++S+G  IA + W     RL  +
Sbjct  63   STHIVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLYSSSGHPIASSPWPPQLPRLHSL  122

Query  359  SWTDDQTLICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEA  529
            +++    L+ +  DG++ R+   D++  P  +        +  V D  FW  GV  + E 
Sbjct  123  AFSSSLNLVALLSDGSLLRFRLPDLKPNPSPTPVPLLPTSSGGVADAAFWGGGVAVLTED  182

Query  530  FQVFCIPDFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMS  646
             +V    D    +P+P + ADP  G ++  L M V+EPQ+ MS
Sbjct  183  NRVVVTTDIDAADPHPREFADPCVGQDEQVLCMAVVEPQFVMS  225



>dbj|BAB90498.1| vacuolar protein sorting-associated protein VPS16-like [Oryza 
sativa Japonica Group]
Length=892

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 114/221 (52%), Gaps = 35/221 (16%)
 Frame = +2

Query  89   VSVAAEWQLLYNRYYRKPELYQ-MQWK---------------------------HVDLTR  184
            VSVAAEW LL +R+YR+  +Y  + W                             +DL+ 
Sbjct  53   VSVAAEWDLLSDRFYRRITVYSPLPWSPPSAAAASSSSTSGGGGGGGGSGGVLGRLDLST  112

Query  185  NKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSW  364
            + VA +PFGGPIA +RDD+KIVQL++E + R+L +++S+G  IA + W     RL  +++
Sbjct  113  HIVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLYSSSGHPIASSPWPPQLPRLHSLAF  172

Query  365  TDDQTLICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQ  535
            +    L+ +  DG++ R+   D++  P  +        +  V D  FW  GV  + E  +
Sbjct  173  SSSLNLVALLSDGSLLRFRLPDLKPNPSPTPVPLLPTSSGGVADAAFWGGGVAVLTEDNR  232

Query  536  VFCIPDFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMS  646
            V    D    +P+P + ADP  G ++  L M V+EPQ+ MS
Sbjct  233  VVVTTDIDAADPHPREFADPCVGQDEQVLCMAVVEPQFVMS  273



>emb|CDH59927.1| vacuolar protein sorting vps16 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=785

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 90/153 (59%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  VACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWT  367
            +A S FGGPIA+IRDD K++ L  +  ++  + ++ SAG  I +  W+   GR++ + WT
Sbjct  2    IAGSQFGGPIAMIRDDKKVLLLQKQQPIKPTVYMYTSAGKLIEQIQWEK--GRIIALGWT  59

Query  368  DDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCI  547
              + L+ +T+DG V  Y +     +  SLGK+     ++DC  W  G+V +   +++  +
Sbjct  60   KHEELVIVTEDGFVRLYPLHGSYTQ-FSLGKEAKEQGILDCQIWSTGLVAMTNKYKLIAV  118

Query  548  PDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
             DF  P P  +AD GL+D P S TVI PQYT+S
Sbjct  119  TDFYEPRPKLMADTGLDDKPHSWTVIPPQYTLS  151



>ref|XP_004969467.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Setaria italica]
Length=874

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 116/215 (54%), Gaps = 27/215 (13%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELYQ-MQWK-------------------HVDLTRNKVACS  202
            S+VSVAAEW LL +R+YR+  LY  + W                     +DL+ + VA +
Sbjct  3    SSVSVAAEWDLLSDRFYRRLTLYSPLPWSAPAPTSTSSSSGVGGPVIGRLDLSTHIVAAA  62

Query  203  PFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTL  382
            PFGGPIA +RDD+KIVQL++E + R+L +F+S+G  IA   W     RL  ++++   +L
Sbjct  63   PFGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSGHPIASAPWPPMLPRLHSLAFSSSLSL  122

Query  383  ICITQDGTVYRYDIRAEPLESLSLGKDCF---THSVVDCVFWHNGVVCINEAFQVFCIPD  553
            + +  DG++ R+ +        S         +  V D VFW  GV  + E  +V    D
Sbjct  123  LGLISDGSLLRFRLPDLQPSPSSSPMPLLPPASGGVADAVFWGGGVAILTEDNRVVVATD  182

Query  554  FK--NPNPIKLADPGL--EDFPLSMTVIEPQYTMS  646
             +  +P+P  LADPG+  E+  L M V+EPQ+ MS
Sbjct  183  IEADDPHPRDLADPGVGDEEHVLCMAVVEPQFVMS  217



>emb|CCJ28605.1| unnamed protein product [Pneumocystis jirovecii]
Length=825

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 98/179 (55%), Gaps = 6/179 (3%)
 Frame = +2

Query  110  QLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYA--ESALRKL  283
            QL   ++Y+K EL  M WK V+L+    A + +GG IA++RDD +++  Y   ++    +
Sbjct  10   QLSKEKFYQKIELSIMLWKGVELSGYISAGALYGGAIALVRDD-RVIHKYLGPDNTKSNI  68

Query  284  RIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKD  463
            RI+NS G  I E  W    G++ G+ W+D + LI +T+DG V  Y+I+ E     SLGK+
Sbjct  69   RIYNSYGAFIREIHW--DIGKIRGLGWSDSERLIVVTEDGIVRNYNIQGE-FTQFSLGKE  125

Query  464  CFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  640
               H V++C FW  G V + E      +  +  P P  L  P  ED   S T+I PQ++
Sbjct  126  INEHLVINCQFWGTGFVALLENNTFIAVNSYDEPRPRVLCSPEFEDIIHSWTIIAPQFS  184



>gb|EEC71233.1| hypothetical protein OsI_03188 [Oryza sativa Indica Group]
Length=227

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 103/202 (51%), Gaps = 33/202 (16%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELYQ-MQWK---------------------------HVDL  178
            S+VSVAAEW LL +R+YR+  +Y  + W                             +DL
Sbjct  3    SSVSVAAEWDLLSDRFYRRITVYSPLPWSPPSAAAASSSSTSGGGGGGGGSGGVLGRLDL  62

Query  179  TRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGM  358
            + + VA +PFGGPIA +RDD+KIVQL++E + R+L +++S+G  IA + W     RL  +
Sbjct  63   STHIVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLYSSSGHPIASSPWPPQLPRLHSL  122

Query  359  SWTDDQTLICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEA  529
            +++    L+ +  DG++ R+   D++  P  +        +  V D  FW  GV  + E 
Sbjct  123  AFSSSLNLVALLSDGSLLRFRLPDLKPNPSPTPVPLLPTSSGGVADAAFWGGGVAVLTED  182

Query  530  FQVFCIPDFK--NPNPIKLADP  589
             +V    D    +P+P + ADP
Sbjct  183  NRVVVTTDIDAADPHPREFADP  204



>ref|XP_646623.2| hypothetical protein DDB_G0270754 [Dictyostelium discoideum AX4]
 sp|Q55C58.2|VPS16_DICDI RecName: Full=Vacuolar protein sorting-associated protein 16 
homolog [Dictyostelium discoideum]
 gb|EAL72727.2| hypothetical protein DDB_G0270754 [Dictyostelium discoideum AX4]
Length=832

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 107/190 (56%), Gaps = 8/190 (4%)
 Frame = +2

Query  95   VAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  274
            +AA+W+++ N  Y K E+Y M W  VDL +     SPF GPIAV+RD +K V++ +++  
Sbjct  2    IAAQWKIIGNSTYIKKEIYSMSW-DVDLKQQVSVGSPFAGPIAVMRDSSKFVEMNSQNMK  60

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              L+IF ++G  I++ +W +    +V M W + + L+ + Q+ TV  +++  E +   SL
Sbjct  61   PYLKIFTASGDLISQMIW-DSSKNIVAMDWIEKERLVIVLQNATVLIFNVFCEQMTQFSL  119

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIP---DFKNPNPIKLADPGLEDFPLSM---  616
            G       +++C  W +G+V +  A Q++ +P   DF   +   +  P L + P +    
Sbjct  120  GDIVREEEILECKIWSDGIVVLTSASQLYSVPSINDFFVESGRVIRLPPLPEEPKARPEW  179

Query  617  TVIEPQYTMS  646
             ++EPQ+++S
Sbjct  180  AILEPQFSLS  189



>emb|CEJ04541.1| Putative Vacuolar protein sorting vps16 [Rhizopus microsporus]
Length=608

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 91/153 (59%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  VACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWT  367
            +A + +GGPIA+IRDD K++ L  +  ++  + ++ SAG  I +  W    G++VG+ WT
Sbjct  2    IAGAQYGGPIAMIRDDRKVLLLQKQQPIKPTIYMYTSAGKLIEQIQWDK--GKIVGLGWT  59

Query  368  DDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCI  547
            + + L+ +T+DG+V  Y +  +     SLGK+     ++DC  W  G+V +   +Q+  +
Sbjct  60   EQEQLVVVTEDGSVRLYTLHGQ-FSQFSLGKEAKDDGIIDCQIWGGGLVAMTSKYQLISV  118

Query  548  PDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
             +F  P P  LAD  L++ P S T++ PQ+T+S
Sbjct  119  TNFLEPQPKPLADIRLDEPPHSWTIVPPQFTLS  151



>ref|XP_002598771.1| hypothetical protein BRAFLDRAFT_212848 [Branchiostoma floridae]
 gb|EEN54783.1| hypothetical protein BRAFLDRAFT_212848 [Branchiostoma floridae]
Length=761

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 107/183 (58%), Gaps = 10/183 (5%)
 Frame = +2

Query  95   VAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  274
            V  +W  L   +YRK E+Y M W+ +DL +  VA +P+GGPIA+IRD+ K+V++  + ++
Sbjct  4    VTGDWNPLGQVFYRKQEIYSMGWRDIDLDKFVVAAAPYGGPIALIRDETKLVRV--QGSI  61

Query  275  RK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  451
            R  + I+ S+G +I+   W +  G ++ + W+  + L+C+ +DG+V  YDI  +   + S
Sbjct  62   RPVIYIYTSSGREISSIRWNS--GHVIHLGWSCSEELLCVQEDGSVLVYDIFGQFKRTFS  119

Query  452  LGKDCFTHSVVDCVFWHN----GVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSM  616
            +G +     V DC  +++    G+  +  ++++F + +   P   ++AD PGL+  P S 
Sbjct  120  MGTEAKEMKVRDCRIFNSHQGTGLAVMTSSYRIFMVNNVDEPRIRRMADVPGLDAPPSSW  179

Query  617  TVI  625
             VI
Sbjct  180  VVI  182



>ref|XP_007873550.1| hypothetical protein PNEG_01594 [Pneumocystis murina B123]
 gb|EMR10340.1| hypothetical protein PNEG_01594 [Pneumocystis murina B123]
Length=815

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 94/179 (53%), Gaps = 6/179 (3%)
 Frame = +2

Query  110  QLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKL--  283
            QL  N++Y+K E  +M WK + L+   VA +  GG IA+++DD K++  Y      KL  
Sbjct  2    QLFKNKFYQKIEFSKMLWKDIQLSEYMVAGAKCGGAIALVKDD-KVIHKYLGPTNTKLSI  60

Query  284  RIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKD  463
            RI+NS G  I+E  W+    R  G+ WTD + LI +T++G V  Y+++ E     SLGK+
Sbjct  61   RIYNSYGSFISEINWELEKIR--GIGWTDSEKLIIVTENGVVRNYNMQGE-FTQFSLGKE  117

Query  464  CFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  640
               H VV+C FW  G V +        +  +  P P  L  P  ED   S  +I P ++
Sbjct  118  ANEHLVVNCQFWGTGFVALLGNNTFISVNQYSEPRPKLLCSPKFEDVIHSWAIIAPHFS  176



>emb|CEI87038.1| hypothetical protein RMCBS344292_01458 [Rhizopus microsporus]
Length=733

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 91/153 (59%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  VACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWT  367
            +A + +GGPIA+IRDD K++ L  +  ++  + ++ SAG  I +  W    G++VG+ WT
Sbjct  2    IAGAQYGGPIAMIRDDRKVLLLQKQQPIKPTIYMYTSAGKLIEQIQWDR--GKIVGLGWT  59

Query  368  DDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCI  547
            + + L+ +T+DG+V  Y +  +     SLGK+     ++DC  W  G+V +   +Q+  +
Sbjct  60   EQEQLVVVTEDGSVRLYTLHGQ-FSQFSLGKEAKDDGIIDCQIWGGGLVAMTSKYQLISV  118

Query  548  PDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
             +F  P P  LAD  L++ P S T++ PQ+T+S
Sbjct  119  TNFLEPQPKPLADIRLDEPPHSWTIVPPQFTLS  151



>ref|XP_003287306.1| hypothetical protein DICPUDRAFT_32286 [Dictyostelium purpureum]
 gb|EGC36173.1| hypothetical protein DICPUDRAFT_32286 [Dictyostelium purpureum]
Length=831

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 105/191 (55%), Gaps = 9/191 (5%)
 Frame = +2

Query  95   VAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  274
            +AA W+ + N  Y K E+Y M+W  VDL +     +PF GPIAV+RD  K V++ +++  
Sbjct  2    IAAHWKNIGNSTYIKKEIYSMEW-DVDLKQQVAVAAPFAGPIAVMRDSTKFVEVNSQNMK  60

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              L+I+ +AG  +++ +W +   ++V M W + + L+ + QD TV  Y+I  E     +L
Sbjct  61   PYLKIYTAAGTLMSQMIW-DSSKKIVAMDWIEKERLVLVLQDATVLIYNIFCELKTQFTL  119

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIP---DFKNPNPIKLADPGL-EDFPLSM--  616
            G       +++C  W +G+V +  A +++ +P   DF   N   +  P + E+F      
Sbjct  120  GDVVRQEEILECKIWSDGIVVLTSAAKLYSVPSINDFFEENGKVIRLPQIPEEFGEKRPE  179

Query  617  -TVIEPQYTMS  646
              ++EPQ++++
Sbjct  180  WAILEPQFSLT  190



>gb|EPB85961.1| hypothetical protein HMPREF1544_07293 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=760

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 89/153 (58%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  VACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWT  367
            ++ +P+GGPIA+IRDD K++ L  +  ++  + ++ SAG  I +  W    GR+V + WT
Sbjct  2    ISGAPYGGPIAMIRDDKKVLLLQKQQPIKPTIYMYTSAGKLIEQIQWDK--GRIVALGWT  59

Query  368  DDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCI  547
            D + L+ +T DG+V  Y +        SLGKD     ++DC  W  G+V +   +Q+  +
Sbjct  60   DQEQLVVVTDDGSVRLYTLHGH-YTQFSLGKDAKNDGIIDCQIWGGGLVAMTGKYQLISL  118

Query  548  PDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
             +F+ P P  +A+  L++   S TV+ PQ+T+S
Sbjct  119  TNFEEPQPKMMAELKLDEPLHSWTVVPPQFTLS  151



>gb|AFW83494.1| hypothetical protein ZEAMMB73_114694 [Zea mays]
Length=726

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 117/216 (54%), Gaps = 28/216 (13%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELYQ-MQWK--------------------HVDLTRNKVAC  199
            S+VS+AAEW LL +R+YR+  LY  + W                      +DL+ + VA 
Sbjct  3    SSVSIAAEWDLLSDRFYRRLTLYSPLPWSTPAAAGATSSSSGVSGAVIGRLDLSTHIVAA  62

Query  200  SPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQT  379
            +PFGGPIA +RDD+KIVQL++E + R++ +F+S+G  IA   W     RL  + ++   +
Sbjct  63   APFGGPIAAVRDDSKIVQLHSEPSRRRVLLFSSSGHPIASAPWPPLLPRLHSLGFSSSLS  122

Query  380  LICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIP  550
            L+ +  DG++ R+   D++  P  S        +  V D +FW  GV  + E  +V    
Sbjct  123  LLALLSDGSLLRFRLPDLQPSPCSSPVPLLPPASGGVADALFWGGGVAILTEDNRVVVAT  182

Query  551  DFK--NPNPIKLADPGL--EDFPLSMTVIEPQYTMS  646
            D +  +P+P  LADPG+  E+  L M V+E Q+ MS
Sbjct  183  DIEVDDPHPRHLADPGIGDEEHVLCMAVVEAQFVMS  218



>ref|XP_008656726.1| PREDICTED: protein VACUOLELESS1 [Zea mays]
Length=877

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 117/216 (54%), Gaps = 28/216 (13%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELYQ-MQWK--------------------HVDLTRNKVAC  199
            S+VS+AAEW LL +R+YR+  LY  + W                      +DL+ + VA 
Sbjct  3    SSVSIAAEWDLLSDRFYRRLTLYSPLPWSTPAAAGATSSSSGVSGAVIGRLDLSTHIVAA  62

Query  200  SPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQT  379
            +PFGGPIA +RDD+KIVQL++E + R++ +F+S+G  IA   W     RL  + ++   +
Sbjct  63   APFGGPIAAVRDDSKIVQLHSEPSRRRVLLFSSSGHPIASAPWPPLLPRLHSLGFSSSLS  122

Query  380  LICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIP  550
            L+ +  DG++ R+   D++  P  S        +  V D +FW  GV  + E  +V    
Sbjct  123  LLALLSDGSLLRFRLPDLQPSPCSSPVPLLPPASGGVADALFWGGGVAILTEDNRVVVAT  182

Query  551  DFK--NPNPIKLADPGL--EDFPLSMTVIEPQYTMS  646
            D +  +P+P  LADPG+  E+  L M V+E Q+ MS
Sbjct  183  DIEVDDPHPRHLADPGIGDEEHVLCMAVVEAQFVMS  218



>ref|XP_005104108.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Aplysia californica]
Length=789

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 104/181 (57%), Gaps = 9/181 (5%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W  L   YYRK ELY M+W   VDL ++ VA S +GGPIA+++DD+K  ++   +   
Sbjct  4    ADWNPLGEVYYRKCELYTMEWSGLVDLAKHTVAASSYGGPIALMKDDSKTARV-TTTIKP  62

Query  278  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  457
             + ++N+AG  +++  W +  G +V M W+  + L+C+ +DG V  YD+     ++ S+G
Sbjct  63   VISVYNAAGKLLSQMRWNS--GTVVTMGWSATEELLCVQEDGVVLVYDMFLTFKKTFSMG  120

Query  458  KDCFTHSVVD----CVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTV  622
            ++     ++D      F   G+  +  +F++F I +  +P  ++LA+ PGL + P   T+
Sbjct  121  QEAKDVKILDAKIFASFQGTGIAVMTTSFRIFLISNVDSPRIVRLAEVPGLNEAPNCWTI  180

Query  623  I  625
            +
Sbjct  181  V  181



>ref|XP_006646183.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog, 
partial [Oryza brachyantha]
Length=825

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 95/166 (57%), Gaps = 7/166 (4%)
 Frame = +2

Query  170  VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRL  349
            +DL+ + VA +PFGGPIA +RDD+KIVQL++E + R+L +F+S+G  IA + W     RL
Sbjct  1    LDLSTHVVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSGHPIASSPWPPQLPRL  60

Query  350  VGMSWTDDQTLICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCI  520
              ++++    L+ +  DG++ R+   D++  P           +  V D  FW  GVV +
Sbjct  61   HSLAFSSSLNLVALLSDGSLLRFRLPDLKPNPSSIPVPLLPPSSGGVADAAFWGGGVVVL  120

Query  521  NEAFQVFCIPDFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMS  646
             E  +V    D    +P+P +L DP  G ++  L M V+EPQ+ MS
Sbjct  121  TEDNRVVVTTDIDAADPHPRELPDPSVGPDEQVLCMAVVEPQFVMS  166



>ref|XP_002591465.1| hypothetical protein BRAFLDRAFT_105238 [Branchiostoma floridae]
 gb|EEN47476.1| hypothetical protein BRAFLDRAFT_105238 [Branchiostoma floridae]
Length=795

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 105/184 (57%), Gaps = 14/184 (8%)
 Frame = +2

Query  95   VAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  274
            V  +W  L   +YRK E+Y M W+ +DL +  VA +P+GGPIA+IRD+ K+V++  + ++
Sbjct  4    VTGDWNPLGQVFYRKQEIYSMGWRDIDLDKFVVAAAPYGGPIALIRDETKLVRV--QGSI  61

Query  275  RK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  451
            R  + I+ S+G +I+   W +  G ++ + W+  + L+C+ +DG+V  YDI  +   + S
Sbjct  62   RPVIYIYTSSGREISSIRWNS--GHVIHLGWSCSEELLCVQEDGSVLVYDIFGQFKRTFS  119

Query  452  LGKDCFTHSVVDCVFWHN----GVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  619
            +G +     V DC  +++    G+  +  ++++F + +   P   ++A     D P + T
Sbjct  120  MGTEAKEMKVRDCRIFNSHQGTGLAVMTSSYRIFMVNNVDEPRIRRMA-----DVPGTGT  174

Query  620  VIEP  631
            V+ P
Sbjct  175  VLAP  178



>ref|XP_002621281.1| vacuolar protein sorting vps16 [Blastomyces dermatitidis SLH14081]
 gb|EEQ74098.1| vacuolar protein sorting vps16 [Blastomyces dermatitidis SLH14081]
 gb|EEQ89941.1| vacuolar protein sorting vps16 [Blastomyces dermatitidis ER-3]
 gb|EGE80984.1| vacuolar sorting-associated protein [Blastomyces dermatitidis 
ATCC 18188]
Length=830

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 104/192 (54%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A+W+ + +R+YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDRFYRKVRVYDAVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  257  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  430
            Y  AE+A   + I++ +G +I+   W++  G + G+ W DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISRINWEH--GSIRGLGWLDDERLLVVTQDGTVRCYYGLH  117

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
                  SLG     H V  C FW +G V +    Q+  +  +  P P  LA P   D   
Sbjct  118  ADFTPFSLGTVAEEHGVKSCRFWSDGFVALLNNNQLIAVSSYDEPRPKLLASPPEGDVS-  176

Query  611  SMTVIEPQYTMS  646
            S ++I P YT+S
Sbjct  177  SWSLIPPNYTLS  188



>gb|EQL37787.1| hypothetical protein BDFG_00836 [Blastomyces dermatitidis ATCC 
26199]
Length=830

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 104/192 (54%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A+W+ + +R+YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDRFYRKVRVYDAVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  257  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  430
            Y  AE+A   + I++ +G +I+   W++  G + G+ W DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISRINWEH--GSIRGLGWLDDERLLVVTQDGTVRCYYGLH  117

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
                  SLG     H V  C FW +G V +    Q+  +  +  P P  LA P   D   
Sbjct  118  ADFTPFSLGTVVEEHGVKSCRFWSDGFVALLNNNQLIAVSSYDEPRPKLLASPPEGDVS-  176

Query  611  SMTVIEPQYTMS  646
            S ++I P YT+S
Sbjct  177  SWSLIPPNYTLS  188



>gb|KFM68340.1| hypothetical protein X975_12661, partial [Stegodyphus mimosarum]
Length=827

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 103/185 (56%), Gaps = 15/185 (8%)
 Frame = +2

Query  101  AEWQLL-YNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKI--VQLYAES  268
            A+W  L  N YYRK ELY MQW   V+L+   VA +PFGGPIA+ +D  K+  VQ   +S
Sbjct  6    ADWTPLGKNVYYRKTELYSMQWVDQVNLSEFIVAAAPFGGPIALTQDRKKLQKVQFANKS  65

Query  269  ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESL  448
                + IF+++G  ++   W +  G LV M W+  + LIC+ +DG V  YDI      + 
Sbjct  66   ---NIYIFSASGQPLSTIKWNS--GPLVHMGWSSSEDLICVLEDGNVLLYDIYGNLQMTT  120

Query  449  SLGKDCFTHSVVDC-VF----WHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
            S+G+D     V++C +F    ++ GV  +  AF +F + + K+P   KL   PGL+  P 
Sbjct  121  SMGQDVKDTGVLECRIFNSPKFYTGVAVLTGAFNIFLVNNIKDPRIRKLPSVPGLDAPPS  180

Query  611  SMTVI  625
            S  V+
Sbjct  181  SWAVV  185



>ref|XP_002734080.2| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Saccoglossus kowalevskii]
Length=850

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 99/168 (59%), Gaps = 9/168 (5%)
 Frame = +2

Query  137  KPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIA  316
            K ELY M WK +DL+  KVA +P+GGPIA+IRDD+K ++  +   +  + I++++G  I+
Sbjct  283  KIELYSMGWKDIDLSMFKVAAAPYGGPIALIRDDSKSMRTTSTKPM--IYIYSASGRHIS  340

Query  317  ETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVVDCVF  496
            +  W +  G ++ + W+ ++ L+C+  DG+V  YDI      + S+G++     V+DC  
Sbjct  341  DIRWNS--GHVIHLGWSSNEDLLCVQDDGSVLVYDIFGVFKRTFSMGQEAKDMKVLDCRI  398

Query  497  WHN----GVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTVI  625
            + +    G+  +  +F++F + + + P   K+A+ PGL   P S  VI
Sbjct  399  FRSHSGTGLAILTNSFKLFVVNNIEEPRIRKMAEVPGLSCPPSSWAVI  446



>ref|XP_781126.3| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Strongylocentrotus purpuratus]
Length=756

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 99/176 (56%), Gaps = 13/176 (7%)
 Frame = +2

Query  95   VAAEWQLLYNRYYRKPELYQMQ--WKHV-DLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  265
            V  +W  L + +YRK ELY M   W+ V DL + KVA +PFGGPIA++RD  KI Q+   
Sbjct  4    VTGDWNPLGDVFYRKVELYAMDRLWQEVADLRKFKVAVAPFGGPIALMRDSNKITQVRGS  63

Query  266  SALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLES  445
            S +  + IF++AG +I+   W +  G ++ + W+  + L+CI  DGTV  Y+I  +   +
Sbjct  64   SHI-VIFIFSAAGKEISRINWDS--GNVIHIGWSLSEDLLCIQDDGTVLVYNIFGKYQRN  120

Query  446  LSLGKDCFTHSVVDCVFWHN------GVVCINEAFQVFCIPDFKNPNPIKLAD-PG  592
             ++G++     V++   +HN      GV  +   ++++ + D  NP   K+ + PG
Sbjct  121  FNMGQESRESKVIESKVFHNTSYGGTGVAVLTGTYRIYVVNDVHNPASRKMMEVPG  176



>gb|KEQ63929.1| vacuolar protein sorting-associated protein 16 [Aureobasidium 
melanogenum CBS 110374]
Length=822

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 94/184 (51%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W+ + +R+YRK +LY   +   ++L  + +  +P  G IAV RDD+K+    +  A R
Sbjct  6    ADWERVGDRFYRKTQLYTSVFDPELELENHVLVGAPLAGAIAVYRDDSKLYAYRSTQAAR  65

Query  278  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + ++  +G  I    W    G + G  W++D+ LI +T DGTV  Y+  +      SL
Sbjct  66   PSIDLYTCSGKLIHRINWDK--GAIQGCGWSEDERLIVVTNDGTVRIYNALSSDFIPFSL  123

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G     H VV C FW +G V +    Q+ C+  +  P P  LA P  E   LS  VI P 
Sbjct  124  GHGADEHGVVSCRFWSSGFVALLGNNQLVCVSRYDEPRPTLLATPP-EGEILSWAVIPPA  182

Query  635  YTMS  646
            +T+S
Sbjct  183  FTLS  186



>emb|CBJ31010.1| conserved unknown protein [Ectocarpus siliculosus]
Length=243

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 106/208 (51%), Gaps = 26/208 (13%)
 Frame = +2

Query  95   VAAEWQLLYNRYYRKPELYQMQW-----KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            +A +W  L +  YRK  LY + W     +H+D  R  VA + +GG +A++RD+ K++++ 
Sbjct  2    LADDWTTLRDVQYRKIHLYDLDWAEDEDRHLD--RCLVAVAKYGGAVAMVRDETKLLKMS  59

Query  260  A-ESALRKLRIFNSAGVQIAETVW----KNPG-----GRLVGMSWTDDQTLICITQDGTV  409
            A +S +  LR+ N AG  I+ET+     + PG     GRL+ M WTD + L+ + + G V
Sbjct  60   AKDSIVPTLRVCNCAGGTISETILDKAVQAPGTASERGRLLTMGWTDGEMLVMVRERGGV  119

Query  410  YRYDIRAEPLESLSLGKDCFTHS-----VVDCVFWHNGVVCINEAFQVFCIPDFKNPNPI  574
               DI  E  ++L L  D    S     V  C  W +GVV +  + +V  +    +  P 
Sbjct  120  EVRDIMGELSKTLELVDDSSRRSSEPDRVAACEVWGDGVVALMGSGKVKAVSGIHSSEPR  179

Query  575  KL---ADPGLEDFPLS-MTVIEPQYTMS  646
                 A  G    PL+ M V+EPQ+T S
Sbjct  180  HFSMAAGLGANAAPLTAMAVLEPQFTAS  207



>gb|EJU02203.1| vacuolar protein sorting-associated protein 16 [Dacryopinax sp. 
DJM-731 SS1]
Length=840

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 93/175 (53%), Gaps = 5/175 (3%)
 Frame = +2

Query  128  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRK--LRIFNSA  301
            +YRK ELY MQWK  DL+  KV  + +GGP+A+IRD+ K++ L       K  +++++S+
Sbjct  20   FYRKQELYSMQWKVQDLSDFKVVGARYGGPLAIIRDEHKVIALGGAQRFTKPQIQVYSSS  79

Query  302  GVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSV  481
            G  I+   W    G+++ M W  D+ L+ ++++G    YD++ E  E  SLG +     V
Sbjct  80   GGLISTLSWDQ--GKIICMGWAYDERLVVLSEEGLYRVYDLQGE-YEQFSLGAEALEEGV  136

Query  482  VDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
            V+      G+V +  +     +  ++      LA  GL   P   T++ P+ T+S
Sbjct  137  VEAQVHETGLVALTGSLNFLEVRSWEGGKAQTLASSGLSTPPHCWTIMPPELTVS  191



>gb|ELU17286.1| hypothetical protein CAPTEDRAFT_168734 [Capitella teleta]
Length=819

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 101/172 (59%), Gaps = 9/172 (5%)
 Frame = +2

Query  128  YYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAG  304
            + RK ELY MQW   VDL++  +A +P+GGPIA++RDD+K+ Q    +    + +FN+ G
Sbjct  4    FSRKHELYSMQWADKVDLSKFIIAAAPYGGPIALMRDDSKL-QKSQITTKPIIYVFNAVG  62

Query  305  VQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVV  484
             +I+   W +  GR++ ++W++ + L+CI  DG+V  YDI      + SLG++     +V
Sbjct  63   AEISAIRWNS--GRVLKLAWSNCEDLLCIQNDGSVLVYDIFGSFKRTFSLGQEAKDVKIV  120

Query  485  DCVFWHN----GVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTVI  625
            +C  + +    G+  +  +++ F I + ++P   +LA+ PGL   P   T+I
Sbjct  121  ECQVFSSSQGTGIAVLTSSYRFFVINNVEDPRIRRLAEVPGLNKPPSCWTMI  172



>ref|XP_001259325.1| vacuolar protein sorting vps16, putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW17428.1| vacuolar protein sorting vps16, putative [Neosartorya fischeri 
NRRL 181]
Length=754

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ L + +YRK  LY   + + VDL    VA +P+GG IA+ RD++K    
Sbjct  1    MAPSNPLANWERLGDSFYRKVSLYDAIFNEDVDLDNYIVAGAPYGGAIALHRDESKPYMF  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
              A +A   + I++ +G  I    W++  G + G+ W++ + L+ IT+DGTV RY     
Sbjct  61   RDAHTARSSIDIYSCSGKHINRINWEH--GTIRGLGWSEKEELLVITEDGTVRRYFGLYG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
               S SLG     + V  C FW+NG V +    Q+  + ++  P P KL  P  E    S
Sbjct  119  DFTSFSLGNGAEEYGVRACKFWNNGFVALLSNNQLIAVSNYDEPRP-KLLAPCPEGEVSS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPPYTLS  188



>gb|KEY77885.1| vacuolar protein sorting vps16 [Aspergillus fumigatus var. RP-2014]
Length=752

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ L + +YRK  LY   + + VDL    VA +P+GG IA+ RD++K    
Sbjct  1    MAPSNPLANWERLGDSFYRKVSLYDAIFDEDVDLDNYIVAGAPYGGAIALHRDESKPYMF  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
              A +A   + I++ +G  I    W++  G + G+ W++ + L+ IT+DGTV RY     
Sbjct  61   RDAHTARSSIDIYSCSGKHINRINWEH--GTIRGLGWSEKEELLVITEDGTVRRYFGLYG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
               S SLG     + V  C FW+NG V +    Q+  + ++  P P KL  P  E    S
Sbjct  119  DFTSFSLGNGAEEYGVRACKFWNNGFVALLSNNQLIAVSNYDEPRP-KLLAPCPEGEISS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPPYTLS  188



>ref|XP_753294.1| vacuolar protein sorting vps16 [Aspergillus fumigatus Af293]
 gb|EAL91256.1| vacuolar protein sorting vps16, putative [Aspergillus fumigatus 
Af293]
 gb|EDP52096.1| vacuolar protein sorting vps16, putative [Aspergillus fumigatus 
A1163]
Length=828

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ L + +YRK  LY   + + VDL    VA +P+GG IA+ RD++K    
Sbjct  1    MAPSNPLANWERLGDSFYRKVSLYDAIFDEDVDLDNYIVAGAPYGGAIALHRDESKPYMF  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
              A +A   + I++ +G  I    W++  G + G+ W++ + L+ IT+DGTV RY     
Sbjct  61   RDAHTARSSIDIYSCSGKHINRINWEH--GTIRGLGWSEKEELLVITEDGTVRRYFGLYG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
               S SLG     + V  C FW+NG V +    Q+  + ++  P P KL  P  E    S
Sbjct  119  DFTSFSLGNGAEEYGVRACKFWNNGFVALLSNNQLIAVSNYDEPRP-KLLAPCPEGEISS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPPYTLS  188



>ref|XP_002456108.1| hypothetical protein SORBIDRAFT_03g030590 [Sorghum bicolor]
 gb|EES01228.1| hypothetical protein SORBIDRAFT_03g030590 [Sorghum bicolor]
Length=825

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 113/216 (52%), Gaps = 28/216 (13%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELYQ-MQWK--------------------HVDLTRNKVAC  199
            S+VS+AAEW LL +R+YR+  LY  + W                      +DL+ + VA 
Sbjct  86   SSVSIAAEWDLLSDRFYRRLTLYSPLPWSAPAAAGATSSSSGVGGAVIGRLDLSTHIVAA  145

Query  200  SPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQT  379
            +PFGGPIA +RDD+KIVQL++E + R+L +F+S+   IA   W     RL  ++++   +
Sbjct  146  APFGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSAHPIASAPWPPLLPRLHSLAFSSSLS  205

Query  380  LICITQDGTVYRYDIRAEPLESLSLGKDCF---THSVVDCVFWHNGVVCINEAFQVFCIP  550
            L+ +  DG++ R+ +        S         +  V D  FW  GV  + E  +V    
Sbjct  206  LLALLSDGSLLRFRLPDLQPSPSSSPVPLLPPDSGGVADAQFWGGGVAILTEDNRVVVAT  265

Query  551  DFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMS  646
            D +  +P+P  LADP  G E+  L M V+EPQ+ MS
Sbjct  266  DIEADDPHPRDLADPDIGDEEHVLCMAVVEPQFVMS  301



>gb|EER38773.1| vacuolar sorting protein [Histoplasma capsulatum H143]
Length=694

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 104/192 (54%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A+W+ + +++YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDQFYRKVRIYDAVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  257  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  430
            Y  AE+A   + I++ +G +I++  W++  G + G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISQINWEH--GSIRGLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
                  SLG     H V  C FW +G V +    Q   +  +  P P KL     E    
Sbjct  118  ADFVPFSLGTVAEEHGVKSCRFWSDGFVALLNNNQFIAVSRYDEPRP-KLLASTPEGEIS  176

Query  611  SMTVIEPQYTMS  646
            S ++I P YT+S
Sbjct  177  SWSLIPPNYTLS  188



>gb|EEH09936.1| vacuolar sorting-associated protein [Histoplasma capsulatum G186AR]
Length=830

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 104/192 (54%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A+W+ + +++YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDQFYRKVRIYDAVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  257  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  430
            Y  AE+A   + I++ +G +I++  W++  G + G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISQINWEH--GSIRGLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
                  SLG     H V  C FW +G V +    Q   +  +  P P KL     E    
Sbjct  118  ADFVPFSLGTVAEEHGVKSCRFWSDGFVALLNNNQFIAVSRYDEPRP-KLLASTPEGEIS  176

Query  611  SMTVIEPQYTMS  646
            S ++I P YT+S
Sbjct  177  SWSLIPPNYTLS  188



>gb|EGC44404.1| vacuolar sorting-associated protein [Histoplasma capsulatum H88]
Length=830

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 104/192 (54%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A+W+ + +++YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDQFYRKVRIYDAVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  257  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  430
            Y  AE+A   + I++ +G +I++  W++  G + G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISQINWEH--GSIRGLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
                  SLG     H V  C FW +G V +    Q   +  +  P P KL     E    
Sbjct  118  ADFVPFSLGTVAEEHGVKSCRFWSDGFVALLNNNQFIAVSRYDEPRP-KLLASTPEGEIS  176

Query  611  SMTVIEPQYTMS  646
            S ++I P YT+S
Sbjct  177  SWSLIPPNYTLS  188



>emb|CDS07252.1| hypothetical protein LRAMOSA01201 [Absidia idahoensis var. thermophila]
Length=773

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 81/142 (57%), Gaps = 4/142 (3%)
 Frame = +2

Query  224  VIRDDAKIVQLYAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQD  400
            +IRDD K++ L  +  ++  + ++ SAG  I +  W+   GR++ + WT  + L+ +T+D
Sbjct  1    MIRDDKKVLLLQKQQPIKPTVYMYTSAGKLIEQIQWEK--GRIIALGWTKQEELVIVTED  58

Query  401  GTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKL  580
            G V  Y +     +  SLGK+     ++DC  W  G+V +   +++  + DF  P P  +
Sbjct  59   GFVRLYPLHGSYTQ-FSLGKEAKEQGILDCQIWSTGLVAMTNNYKLIAVTDFYEPRPKLM  117

Query  581  ADPGLEDFPLSMTVIEPQYTMS  646
            AD GL+D P S TVI PQYT+S
Sbjct  118  ADTGLDDKPHSWTVIPPQYTLS  139



>gb|KEQ75501.1| vacuolar protein sorting-associated protein 16 [Aureobasidium 
pullulans var. namibiae CBS 147.97]
Length=822

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 94/184 (51%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W+ + +R+YRK +LY   +   ++L  + +  +P  G IA+ RDD+K+    +  A R
Sbjct  6    ADWERVGDRFYRKTQLYTSVFDPELELENHVLVGAPLAGAIALYRDDSKLYAYRSTQAAR  65

Query  278  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + ++  +G  I    W    G + G +W++D+ LI +T DGTV  Y   +      SL
Sbjct  66   PSIDLYTCSGKLIHRINWDK--GAIQGCAWSEDERLIVVTNDGTVRIYHGLSGDFIPFSL  123

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G     H VV C FW +G V +    Q+ C+  +  P P  LA P   +  LS  VI P 
Sbjct  124  GHGADEHGVVSCRFWSSGFVALLGNNQLVCVSRYDEPRPTLLATPPQGEI-LSWAVIPPA  182

Query  635  YTMS  646
            +T+S
Sbjct  183  FTLS  186



>emb|CCL98206.1| predicted protein [Fibroporia radiculosa]
Length=895

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 101/188 (54%), Gaps = 9/188 (5%)
 Frame = +2

Query  101  AEWQLLYNR--YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES--  268
            A WQ + +   +Y++ +LY +  K   L    +A   +GGPIA++RD  K++ L   +  
Sbjct  7    ATWQAMQDGTVFYKRHQLYSIPGKFPPLNDFVIAGCRYGGPIALMRDTTKVIALGTAAPS  66

Query  269  -ALRKLRIFNSAG-VQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE  442
             +  ++ +F+SAG V +  +VW +  G++V   WT D+ L+ + ++G    YD++ E  +
Sbjct  67   FSKAQIHVFSSAGDVMLVFSVWDH--GKIVRFGWTADERLVVLNEEGVYRLYDLQGE-YQ  123

Query  443  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  622
              SLG D     ++D     NG+V +  +  +  I ++    P+ LA+PGL   P S  V
Sbjct  124  QYSLGSDAGELGIIDARIHENGIVALTGSLTLLEIKEWNGGKPLTLANPGLSQPPHSWAV  183

Query  623  IEPQYTMS  646
            I P +T+S
Sbjct  184  IPPDFTIS  191



>gb|KIW64485.1| hypothetical protein PV04_09414 [Capronia semiimmersa]
Length=830

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 102/191 (53%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ + +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  K+ + 
Sbjct  1    MTASNPRAGWEKVGDQFYRKVPLYEAVFDQDLELENYLVAGAPYGGALALWRDTTKVARY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNISWER--GVIKGLGWSDDEKLLVVTEDGTVHCYFGLHS  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +  SLG     + VV C FW +G V +     +  +  F  P P +LA P  E    S
Sbjct  119  DFQPFSLGHGSEEYGVVSCRFWSHGFVALLSNNSLIAVSSFDEPRPRQLA-PTPEGQVHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>gb|KIL59455.1| hypothetical protein M378DRAFT_85025 [Amanita muscaria Koide 
BX008]
Length=844

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 101/186 (54%), Gaps = 7/186 (4%)
 Frame = +2

Query  101  AEWQLLY--NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE--S  268
            + WQ +   N +YR+ +LY +  K  +L+  ++A   +GGP+A++RD +K++ L     S
Sbjct  7    SSWQAMQDGNVFYRRQQLYSIPGKLPNLSHYRIAGCRYGGPLALMRDSSKMIALGTTPLS  66

Query  269  ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESL  448
               +++I +SAG  I    W    G+++   WT D+ L+ + ++GT   YD++ E  +  
Sbjct  67   MKPQIQIISSAGEGIMSFSWDQ--GKIIRFGWTFDEKLVVLNEEGTYRLYDLQGE-YQQY  123

Query  449  SLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIE  628
            SLG +     V+D     NG+V +  A ++  + +++    + LA+PGL   P +  VI 
Sbjct  124  SLGSEAAEMGVIDARIHENGLVALTGALKLLEVKEWRGERALHLANPGLSQPPHAWAVIP  183

Query  629  PQYTMS  646
            P  T+S
Sbjct  184  PDSTIS  189



>ref|XP_001542324.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN05892.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=755

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 104/192 (54%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A+W+ + +++YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDQFYRKVRIYDDVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  257  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  430
            Y  AE+A   + I++ +G +I++  W++  G + G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISQINWEH--GSIRGLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
                  SLG     H V  C FW +G V +    Q   +  +  P P KL     E    
Sbjct  118  ADFVPFSLGTVAEEHGVKSCRFWSDGFVALLNNNQFIAVSRYDEPRP-KLLASTPEGEIS  176

Query  611  SMTVIEPQYTMS  646
            S ++I P YT+S
Sbjct  177  SWSLIPPNYTLS  188



>ref|XP_002428971.1| vacuolar protein sorting, putative [Pediculus humanus corporis]
 gb|EEB16233.1| vacuolar protein sorting, putative [Pediculus humanus corporis]
Length=821

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 103/190 (54%), Gaps = 18/190 (9%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNR-YYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQ  253
            MS++ +  +W  L N  Y+RK E+YQM+W H +D+    V+ +P+GGPIA++RD  K+V+
Sbjct  1    MSSL-ITGDWVSLENDVYFRKFEVYQMEWSHDIDIDNIVVSAAPYGGPIAIMRDRKKLVK  59

Query  254  LYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
            +   +    ++IF+S G  I+  VW +  G L+ + W+ D+ L+C+  DGTV  YD+   
Sbjct  60   VQV-TGKPLIQIFSSPGNIISSIVWNS--GALIQIGWSSDEELLCLKDDGTVLVYDMFGN  116

Query  434  PLESLSLGKDCFTHSVVDC----VFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLED  601
                 S+G++     +++      F   G+  +   F+VF I      N +K  DP ++ 
Sbjct  117  RQGLFSMGEEISVTKIIEAKIFPSFSGTGIAVLTSKFRVFLI------NSVK--DPKVKQ  168

Query  602  FPLSMTVIEP  631
            FP      EP
Sbjct  169  FPQIPNSSEP  178



>ref|XP_002953465.1| hypothetical protein VOLCADRAFT_105988 [Volvox carteri f. nagariensis]
 gb|EFJ45438.1| hypothetical protein VOLCADRAFT_105988 [Volvox carteri f. nagariensis]
Length=995

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 94/202 (47%), Gaps = 28/202 (14%)
 Frame = +2

Query  68   NNLRMSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKI  247
              LR   V    EW+++ + ++ +  LY M W   +L   ++AC+P+GGPIA IRD+ + 
Sbjct  2    GQLRTQAV---GEWEMMGDCFFSREMLYDMSWGDFELQDKRLACAPYGGPIAAIRDERRA  58

Query  248  VQL-YAESALRK-------LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDG  403
            V + +  SA+         LR F +AG  +   VW+  GGRLV  +WTD+Q L  +   G
Sbjct  59   VLVTHGSSAVAAGGGLKPVLRTFTAAGASLGACVWE--GGRLVDWAWTDEQQLAVVDAKG  116

Query  404  TVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQ---------------V  538
             V  +   AE +   S G       V     + +GVV + E  Q               +
Sbjct  117  KVTLFSPFAEKIREFSFGAAVERDGVAAAKVYGSGVVVVTEPRQAAAAGDATSAVESCEI  176

Query  539  FCIPDFKNPNPIKLADPGLEDF  604
            + + + ++P P +L  P  + +
Sbjct  177  WVVQNLRDPKPTRLKSPSKDSY  198



>gb|KFG43269.1| Vps16, N-terminal region protein [Toxoplasma gondii FOU]
Length=258

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 104/195 (53%), Gaps = 10/195 (5%)
 Frame = +2

Query  56   APSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQWKH----VDLTRNKVACSPFGGPIA  223
            +P+++    +  + +++WQ L + +YRK +++ M+WKH     DL    VA +P+GGP+A
Sbjct  18   SPAADFSFSAGANGSSDWQCLDSVWYRKLDVFDMEWKHERQLFDLF--VVAAAPYGGPVA  75

Query  224  VIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDG  403
             +R++ K+ Q   ++   +L+IF++ G  +A++ W     RLV MSW +D+ L+C+ QDG
Sbjct  76   CVRNE-KVFQPAKKNIKPELQIFSARGRLLAKSPWTY--SRLVTMSWNNDEVLVCVFQDG  132

Query  404  TVYRYDIRAEPLESLSLGKDC-FTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKL  580
             V  +  + E L   SL +       +V       G+V +  A   +    F     I L
Sbjct  133  VVRTFSPQCEKLHFFSLDERIKVEGGLVQAAVGGCGIVALTAALNFYYNDAFDRSQTIVL  192

Query  581  ADPGLEDFPLSMTVI  625
             D GL   PLS+ ++
Sbjct  193  PDTGLRGPPLSLCIL  207



>gb|KIW86230.1| hypothetical protein Z517_01625 [Fonsecaea pedrosoi CBS 271.37]
Length=830

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 103/191 (54%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+T +  A W+++ +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KI + 
Sbjct  1    MTTNNPRAGWEIVGDQFYRKVPLYESVFDQDLELENYLVAGAPYGGALALWRDTTKIARY  60

Query  257  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                +++  + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSIKPTIDIYSSSGKLISNINWEK--GVIKGLGWSDDEKLLVVTEDGTVHCYFGLHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +  SLG       VV C FW +G V +     +  +  F+ P P  LA    E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNSLVAVSSFEEPRPRLLAQ-APEGEVHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>gb|KFG44033.1| Vps16, N-terminal region protein, partial [Toxoplasma gondii 
p89]
Length=333

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 104/195 (53%), Gaps = 10/195 (5%)
 Frame = +2

Query  56   APSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQWKH----VDLTRNKVACSPFGGPIA  223
            +P+++    +  + +++WQ L + +YRK +++ M+WKH     DL    VA +P+GGP+A
Sbjct  18   SPAADFSFSAGANGSSDWQCLDSVWYRKLDVFDMEWKHERQLFDLF--VVAAAPYGGPVA  75

Query  224  VIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDG  403
             +R++ K+ Q   ++   +L+IF++ G  +A++ W     RLV MSW +D+ L+C+ QDG
Sbjct  76   CVRNE-KVFQPAKKNIKPELQIFSARGRLLAKSPWTY--SRLVTMSWNNDEVLVCVFQDG  132

Query  404  TVYRYDIRAEPLESLSLGKDC-FTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKL  580
             V  +  + E L   SL +       +V       G+V +  A   +    F     I L
Sbjct  133  VVRTFSPQCEKLHFFSLDERIKVEGGLVQAAVGGCGIVALTAALNFYYNDAFDRSQTIVL  192

Query  581  ADPGLEDFPLSMTVI  625
             D GL   PLS+ ++
Sbjct  193  PDTGLRGPPLSLCIL  207



>gb|KFG58811.1| Vps16, N-terminal region protein, partial [Toxoplasma gondii 
RUB]
Length=333

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 104/195 (53%), Gaps = 10/195 (5%)
 Frame = +2

Query  56   APSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQWKH----VDLTRNKVACSPFGGPIA  223
            +P+++    +  + +++WQ L + +YRK +++ M+WKH     DL    VA +P+GGP+A
Sbjct  18   SPAADFSFSAGANGSSDWQCLDSVWYRKLDVFDMEWKHERQLFDLF--VVAAAPYGGPVA  75

Query  224  VIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDG  403
             +R++ K+ Q   ++   +L+IF++ G  +A++ W     RLV MSW +D+ L+C+ QDG
Sbjct  76   CVRNE-KVFQPAKKNIKPELQIFSARGRLLAKSPWTY--SRLVTMSWNNDEVLVCVFQDG  132

Query  404  TVYRYDIRAEPLESLSLGKDC-FTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKL  580
             V  +  + E L   SL +       +V       G+V +  A   +    F     I L
Sbjct  133  VVRTFSPQCEKLHFFSLDERIKVEGGLVQAAVGGCGIVALTAALNFYYNDAFDRSQTIVL  192

Query  581  ADPGLEDFPLSMTVI  625
             D GL   PLS+ ++
Sbjct  193  PDTGLRGPPLSLCIL  207



>ref|XP_007869321.1| vacuolar assembling/sorting protein VPS16 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ52133.1| vacuolar assembling/sorting protein VPS16 [Gloeophyllum trabeum 
ATCC 11539]
Length=846

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 98/187 (52%), Gaps = 8/187 (4%)
 Frame = +2

Query  101  AEWQLLY--NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES--  268
            A WQ +   N +YR+ ++Y +  K  +L   KVA   +GGP+A++RD+ K+V L   +  
Sbjct  7    ASWQAMQDANVFYRRQQIYSIPGKLPNLDDYKVAACRYGGPLALMRDNDKLVALGRATPV  66

Query  269  -ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLES  445
             A  ++++F+ AG  +    W+    R+V   WT D+ L+ + ++G    YD++ E  E 
Sbjct  67   FAKAQIQVFSPAGEGLLIFSWEQ--ARIVRFGWTGDERLVVLNEEGVYRIYDLQGE-YEQ  123

Query  446  LSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVI  625
             SLG +     V D     NG+V +  +     +  +    P+ LA+PGL   P S T+I
Sbjct  124  YSLGSEVAEIGVEDAKIHDNGLVALTNSLTFLEVRGWSGGKPVTLANPGLSQPPSSWTII  183

Query  626  EPQYTMS  646
             P+ T+S
Sbjct  184  PPELTIS  190



>ref|XP_004367009.1| hypothetical protein DFA_07142 [Dictyostelium fasciculatum]
 gb|EGG20026.1| hypothetical protein DFA_07142 [Dictyostelium fasciculatum]
Length=835

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 101/189 (53%), Gaps = 10/189 (5%)
 Frame = +2

Query  89   VSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES  268
            + V + W  +   Y  K E+Y M W  VDL +N V  +P GGPIAV RD  KIV+   ++
Sbjct  1    MEVTSSWISIGEWYVSKKEIYTMSWD-VDLQKNIVIAAPNGGPIAVTRDRTKIVEANIQT  59

Query  269  ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESL  448
            +   + ++ ++G  +++ ++    G ++ M W +++ L+ +T +GT+  Y+I  E L S 
Sbjct  60   SKPLIFLYTASGQPVSQLIYD---GNIIAMDWIENERLVTVTSNGTISVYNIFGETL-SQ  115

Query  449  SLGKDCFTHS-VVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDF----PLS  613
            +   D   H  ++DC   ++G+V +   F  + I  FK+  P K+AD   E+     P +
Sbjct  116  NNYYDLIDHEDIIDCRISNSGIVVLTNQFNFYHIELFKSERPTKMADQYKEELDREGPSA  175

Query  614  MTVIEPQYT  640
              V+E  Y+
Sbjct  176  WAVVESVYS  184



>gb|KFX91659.1| hypothetical protein V490_05796 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=880

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 98/195 (50%), Gaps = 5/195 (3%)
 Frame = +2

Query  68   NNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAK  244
            N +  S ++  A+W+ L  RYYRK +LY   + + ++L  + VA +P+GG IA+ RD+ K
Sbjct  53   NEVDASRMNPTADWERLGERYYRKVQLYTEVFDQDLELENHIVAGAPYGGAIALYRDETK  112

Query  245  IVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYD  421
            +       A +  + +++ AG  I    W    G + G+ W++D+ L+ ITQDGTV  Y 
Sbjct  113  LHTFRGSQASKSSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVITQDGTVRCYY  170

Query  422  IRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLED  601
                     SLG       VV C F+  G V +     +  +  ++ P P  LA P  + 
Sbjct  171  NLQGDFSQFSLGHGAEEFGVVACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DG  229

Query  602  FPLSMTVIEPQYTMS  646
               S T++ P YT+S
Sbjct  230  VVHSWTLVPPAYTLS  244



>gb|KIO15844.1| hypothetical protein M407DRAFT_235273 [Tulasnella calospora MUT 
4182]
Length=511

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 90/174 (52%), Gaps = 4/174 (2%)
 Frame = +2

Query  128  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAG  304
            +YRK E+Y MQWK   L+   V+ + +GGPIA++RD  KIV        +  +++F+S+G
Sbjct  19   FYRKQEVYTMQWKVKTLSDYIVSGAKYGGPIAMMRDPHKIVAFGTNQFSKPTVQVFSSSG  78

Query  305  VQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVV  484
              +    W    G +V M WT ++ L+ I  +G    Y ++ +  +  SLG +     V+
Sbjct  79   ELLQTIPWDQ--GTIVSMGWTYEEQLVIINDEGMYRLYTLQGD-YQQFSLGPEAAEMGVI  135

Query  485  DCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
            D   +  G+V +     +F +  +    P+ LA PG  + P   ++IEP  T+S
Sbjct  136  DAKIYEQGLVALTSNVTLFEVKGWTGSKPLTLAHPGFSEPPPCWSLIEPDQTLS  189



>ref|XP_002678979.1| predicted protein [Naegleria gruberi]
 gb|EFC46235.1| predicted protein [Naegleria gruberi]
Length=846

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 108/200 (54%), Gaps = 14/200 (7%)
 Frame = +2

Query  89   VSVAAEW-QLLYNR-----YYRKPELYQMQW--KHVDLTRNKVACSPFGGPIAVIRDDAK  244
            +SV+AEW QL   +     YYRK E+Y M+W   +++L+   +A + FGGPIA+ RD  K
Sbjct  1    MSVSAEWVQLGKGKKGVPVYYRKKEIYTMEWGDDNINLSECLIAAANFGGPIALTRDPKK  60

Query  245  IVQLYAESALRKLRIFNSAGVQIAETVWKNPGGR-LVGMSWTDDQTLICITQDGTVYRYD  421
            +++     + + + +F+S+G +I++  W     + L+ M WT +++LIC+T +  V+ +D
Sbjct  61   LLRFRGTDSKQYVHVFSSSGKRISKFEWNTQLNKSLLYMGWTQEESLICVTDEAHVFIFD  120

Query  422  IRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLA--DPGL  595
            I  + L+     ++  +  ++    W  G+  +   F V+ I D +  +  +LA  D  L
Sbjct  121  IFGKQLQQFPFPEEVKSAGILKVKHWETGIAILTRDFNVWVISDLEFIDCQQLASLDVPL  180

Query  596  E---DFPLSMTVIEPQYTMS  646
            E   +  + M +++P    S
Sbjct  181  EFNDEKEIGMCILQPNIATS  200



>gb|KFY40837.1| hypothetical protein V495_05238 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY58989.1| hypothetical protein V497_04533 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=821

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 94/184 (51%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W+ L  RYYRK +LY   + + ++L  + VA +P+GG IA+ RD+AK+       A +
Sbjct  5    ADWERLGERYYRKVQLYTEVFDQDLELENHIVAGAPYGGAIALYRDEAKLHTFRGSQASK  64

Query  278  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + +++ AG  I    W    G + G+ W++D+ L+ ITQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVITQDGTVRCYYNLQGDFSQFSL  122

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G       VV C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVVACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  635  YTMS  646
            YT+S
Sbjct  182  YTLS  185



>gb|KFY04377.1| hypothetical protein O988_00818 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=821

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 94/184 (51%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W+ L  RYYRK +LY   + + ++L  + VA +P+GG IA+ RD+AK+       A +
Sbjct  5    ADWERLGERYYRKVQLYTEVFDQDLELENHIVAGAPYGGAIALYRDEAKLHTFRGSQASK  64

Query  278  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + +++ AG  I    W    G + G+ W++D+ L+ ITQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVITQDGTVRCYYNLQGDFSQFSL  122

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G       VV C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVVACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  635  YTMS  646
            YT+S
Sbjct  182  YTLS  185



>ref|XP_001641101.1| predicted protein [Nematostella vectensis]
 gb|EDO49038.1| predicted protein [Nematostella vectensis]
Length=770

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 97/186 (52%), Gaps = 14/186 (8%)
 Frame = +2

Query  95   VAAEWQLLYNRYYRKPELYQMQWK--HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES  268
            V A+W  L + +YRK ELY M W    VDL++   A SPFGGPIA++R+  +I       
Sbjct  4    VTADWTPLGDVFYRKQELYSMTWNLNDVDLSKFGKAASPFGGPIALVRETTQI------Q  57

Query  269  ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESL  448
                + IF+SAG ++++  +   GGRL+ ++WT  + L+CI  DG+V  YDI      + 
Sbjct  58   VKPLIYIFSSAGKELSKISFD--GGRLIHIAWTASEELMCIAVDGSVSLYDIHGTFFRTF  115

Query  449  SLGKDCFTHSVVDCVFWHN----GVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  616
            ++G +     V++C  + +    G+  +  ++      +  +    + ADP   + P S 
Sbjct  116  TMGHEAQMSQVIECRVFRSSAGTGLAILTGSYHFIVTTNIDDVRCKQFADPPGLNAPPSS  175

Query  617  TVIEPQ  634
             ++ PQ
Sbjct  176  WLVLPQ  181



>gb|KEQ96076.1| hypothetical protein AUEXF2481DRAFT_64917 [Aureobasidium subglaciale 
EXF-2481]
Length=822

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 92/184 (50%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESAL  274
            A+W+ + +R+YRK +LY   +   ++L  + +  +P  G IA+ RD+ K+     A+++ 
Sbjct  6    ADWERVGDRFYRKTQLYTSIFDPELELENHMLVGAPLSGAIAIYRDETKLYAYRNAQTSR  65

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + I+  +G  I    W    G + G  W++D+ LI +T DGTV  Y   +      SL
Sbjct  66   PSIDIYTCSGKPIHRINWDK--GAIQGCGWSEDERLIVVTNDGTVRIYHDLSGDFIPFSL  123

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G     H VV C FW +G V +     + C+  +  P P  LA P   D  LS  VI P 
Sbjct  124  GHGAEEHGVVSCRFWSSGFVALLGNKHLVCVSRYDEPRPTLLATPPEGDI-LSWAVIPPA  182

Query  635  YTMS  646
            +T+S
Sbjct  183  FTLS  186



>ref|XP_009153640.1| hypothetical protein HMPREF1120_01377 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY53179.1| hypothetical protein HMPREF1120_01377 [Exophiala dermatitidis 
NIH/UT8656]
Length=830

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ + +++Y+K +LY+  +   ++L    VA +P+GG +A+ RD  K+ + 
Sbjct  1    MTNHNPRAGWEKIGDQFYQKVQLYESVFDPDLELENYLVAGAPYGGALALWRDSTKVARY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +S    + I++SAG  I+   W+   G + G+ W+DD+ L+ IT+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSAGKLISNIHWEK--GPIKGLGWSDDERLLVITEDGTVHCYFGLHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +  SLG       VV C FW +G V +     +  +  F  P P  LA P  E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNALVAVSSFDEPRPRLLAQPP-EGEVHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>ref|XP_007850547.1| vacuolar protein sorting vps16 [Moniliophthora roreri MCA 2997]
 gb|ESK90169.1| vacuolar protein sorting vps16 [Moniliophthora roreri MCA 2997]
Length=846

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 99/187 (53%), Gaps = 8/187 (4%)
 Frame = +2

Query  101  AEWQLLYNR--YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES--  268
            A WQ + +   +YRK +LY +  K  DL    VA   +GGP+A++RD+ K+V L   +  
Sbjct  7    ASWQAMQDGSVFYRKQQLYSLSGKLPDLGDYIVAGCRYGGPLALMRDNTKLVALGRSTPS  66

Query  269  -ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLES  445
             A  +L++++SAG  +    W    G+++   WT ++ L+ + ++G    YD++ +  + 
Sbjct  67   FAKSQLQVYSSAGEGLLLFSWDQ--GKIIRFGWTYNERLVVLNEEGVYRIYDLQGD-YQQ  123

Query  446  LSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVI  625
             SLG D     VVD     NG+V +    Q+  +  ++   P+ LA+PGL + P +  +I
Sbjct  124  YSLGGDAAEMGVVDARIHENGLVALTGHLQLLEVKGWEGGRPMTLANPGLSEPPGAWAII  183

Query  626  EPQYTMS  646
             P   +S
Sbjct  184  PPDLNIS  190



>dbj|GAD99952.1| vacuolar protein sorting vps16 [Byssochlamys spectabilis No. 
5]
Length=829

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 99/184 (54%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESAL  274
            A+W+ + + +YRK  +Y   + + ++L    VA +P GG IA+ RD +K+ +   A++A 
Sbjct  8    ADWERVGDSFYRKVRVYDAVFDEDLELENYIVAGAPHGGAIALYRDQSKLYRYRDAQTAK  67

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + I++ +G  I++  W+   G + G+ W+DD+ L+ +T+DGTV RY          SL
Sbjct  68   SSIDIYSCSGKLISKINWEY--GSIRGLGWSDDEDLLVVTEDGTVRRYFGLHGDFSPFSL  125

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G     + V +C FW +G V +    Q+  +  +  P P KL     E   LS ++I P 
Sbjct  126  GNGAEEYGVRECRFWSSGFVALLSNNQLVAVSQYNEPRP-KLLATCPEGEVLSWSLIAPA  184

Query  635  YTMS  646
            YT+S
Sbjct  185  YTLS  188



>ref|XP_007728315.1| hypothetical protein A1O1_09269 [Capronia coronata CBS 617.96]
 gb|EXJ78867.1| hypothetical protein A1O1_09269 [Capronia coronata CBS 617.96]
Length=830

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 102/191 (53%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+T +  A W+ + +++Y+K +LY+  +   ++L    VA +P+GG +A+ RD AKI + 
Sbjct  1    MTTNNPRAGWEKVGDQFYQKVQLYESIFDPDLELENYLVAGAPYGGALALWRDAAKIARY  60

Query  257  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                A +  + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQATKPTIDIYSSSGKLISNINWEK--GPVRGLGWSDDERLLVVTEDGTVHCYFGLHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +  SLG       V  C FW +G+V +     +  +  F  P P  LA P  E    S
Sbjct  119  DFQPFSLGHGAEEFGVKSCQFWSHGLVALLSNNALVAVSSFDEPRPRLLAQPP-EGEVHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>ref|XP_008730333.1| hypothetical protein G647_07799 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI21452.1| hypothetical protein G647_07799 [Cladophialophora carrionii CBS 
160.54]
Length=830

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ + +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KI + 
Sbjct  1    MTASNPRAGWEKVGDQFYRKVPLYESVFDQDLELGNYLVAGAPYGGALALWRDTTKIARY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNINWER--GVIKGLGWSDDEKLLVVTEDGTVHCYFGLHS  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +  SLG       VV C FW +G V +     +  +  F  P P  LA P  E    S
Sbjct  119  DFQPFSLGHGSEEFGVVSCRFWSHGFVALLSNNSLIAVSSFDEPRPRLLA-PTPEGQVHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>ref|XP_007270430.1| vacuolar protein sorting-associated protein 16 [Fomitiporia mediterranea 
MF3/22]
 gb|EJC99299.1| vacuolar protein sorting-associated protein 16 [Fomitiporia mediterranea 
MF3/22]
Length=847

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 97/193 (50%), Gaps = 7/193 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLY--NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQ  253
            M+     A WQ +   N +YR+ +LY +Q K  ++    +A   FGGPIA++RD  K++ 
Sbjct  1    MAVEHPTATWQPMQDGNVFYRRLQLYNIQDKLPNVDDFIIAGCRFGGPIAMMRDSTKMIA  60

Query  254  LYAESALRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  427
            L       K  +R+++SAG  +    W    G++V   W+ D+ L+ + ++G    YD++
Sbjct  61   LGRSIPFAKNEVRVYSSAGEGLLVFTWDQ--GKIVKFGWSYDERLVILNEEGVYRIYDLQ  118

Query  428  AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFP  607
             E  +  SLG +     VVD      G+V +  A  +  +  F    P+ L  PGL + P
Sbjct  119  GE-YQQYSLGSEASETGVVDARIHGGGIVALTGALALLDVKGFTGAKPLALTSPGLTEPP  177

Query  608  LSMTVIEPQYTMS  646
             + T+I P  T+S
Sbjct  178  HTWTIIPPDLTIS  190



>ref|XP_007351763.1| vacuolar protein sorting-associated protein 16 [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD40200.1| vacuolar protein sorting-associated protein 16 [Auricularia delicata 
TFB-10046 SS5]
Length=843

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 97/177 (55%), Gaps = 7/177 (4%)
 Frame = +2

Query  128  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY----AESALRKLRIFN  295
            +YRK  +YQMQW   DL+   VA + +GGP+A++RD  K+V +     + +A + ++IF+
Sbjct  19   FYRKLSVYQMQWPIRDLSDYIVAGARYGGPLALMRDPTKMVAMTRMGSSSNAKQPIQIFS  78

Query  296  SAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTH  475
            S+G  I+   W    GR++ + WT D+ L+ + ++G    YD++ + ++  SLG +    
Sbjct  79   SSGDLISTVSWDQ--GRIIRIGWTLDERLVALNEEGIYRLYDLQGDYVQH-SLGPEAGET  135

Query  476  SVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
             V+D   + NG+V +   + +  +  +       LA  GL + P S ++I P   +S
Sbjct  136  GVIDARIYENGLVAMTGLYGLLEVKGWAGGKSSSLASTGLTEPPHSWSIIAPDVLIS  192



>gb|KFH03810.1| Vps16, N-terminal region protein [Toxoplasma gondii VAND]
Length=479

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 104/195 (53%), Gaps = 10/195 (5%)
 Frame = +2

Query  56   APSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQWKH----VDLTRNKVACSPFGGPIA  223
            +P+++    +  + +++WQ L + +YRK +++ M+WKH     DL    VA +P+GGP+A
Sbjct  18   SPAADFSFSAGANGSSDWQCLDSVWYRKLDVFDMEWKHERQLFDLF--VVAAAPYGGPVA  75

Query  224  VIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDG  403
             +R++ K+ Q   ++   +L+IF++ G  +A++ W     RLV MSW +D+ L+C+ QDG
Sbjct  76   CVRNE-KVFQPAKKNIKPELQIFSARGRLLAKSPWTY--SRLVTMSWNNDEVLVCVFQDG  132

Query  404  TVYRYDIRAEPLESLSLGKDC-FTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKL  580
             V  +  + E L   SL +       +V       G+V +  A   +    F     I L
Sbjct  133  VVRTFSPQCEKLHFFSLDERIKVEGGLVQAAVGGCGIVALTAALNFYYNDAFDRSQTIVL  192

Query  581  ADPGLEDFPLSMTVI  625
             D GL   PLS+ ++
Sbjct  193  PDTGLRGPPLSLCIL  207



>ref|XP_011420366.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Crassostrea gigas]
Length=828

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 99/181 (55%), Gaps = 9/181 (5%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W  L   YY+K E+Y M W   VD+++ +V+ +P+GGPIA+++D++K  ++   S   
Sbjct  4    ADWNPLGEIYYKKCEVYSMGWSDIVDISKFEVSAAPYGGPIALLKDESKTARVQV-STKP  62

Query  278  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  457
             + +F +AG QI++  W +  G +  M W+  + L+ +  DG V  YD+     ++  +G
Sbjct  63   IITVFTAAGKQISQMRWNS--GSIHKMGWSHTEDLLFVQDDGVVLVYDMFLTFKKTFGMG  120

Query  458  KDCFTHSVVDCVFWHN----GVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTV  622
            ++     V+DC  + +    G+  +   ++VF I    +P   +LA+ PGL   P S  V
Sbjct  121  QEAKDVKVIDCKIFSSYQGTGIAVLTSTYRVFIINSVDDPRIRRLAEVPGLSSAPSSWAV  180

Query  623  I  625
            I
Sbjct  181  I  181



>ref|XP_003009824.1| vacuolar protein sorting-associated protein [Verticillium alfalfae 
VaMs.102]
 gb|EEY24086.1| vacuolar protein sorting-associated protein [Verticillium alfalfae 
VaMs.102]
Length=441

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 97/182 (53%), Gaps = 6/182 (3%)
 Frame = +2

Query  107  WQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE-SALRK  280
            W+ + ++++RK +LY   + + +DL  + VA +P GG +A+ RDD KI    A+ SA   
Sbjct  10   WESVGDKWFRKTQLYTEVFDQDLDLDNHIVAGAPNGGALAIYRDDTKIQAYRAQKSAKPS  69

Query  281  LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGK  460
            + I++ AG ++    W    G + G+ W++D++L+ +T DGTV  YD++ E     SLG 
Sbjct  70   IDIYSYAGKKLRSIAWDK--GSIKGIGWSEDESLLIVTADGTVRVYDLQGE-FTQFSLGN  126

Query  461  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  640
                + V  C F+ +G+V +     +  +  +  P P  LA P  E       ++ P +T
Sbjct  127  GADNYGVTSCRFYDHGMVALLTNNALISVTSYSEPRPKLLASPP-EGEIHGWAIMTPAHT  185

Query  641  MS  646
            +S
Sbjct  186  LS  187



>gb|KIW38854.1| hypothetical protein PV06_08684 [Exophiala oligosperma]
Length=830

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 103/191 (54%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+T +  + W+ + +++Y+K +LY+  + + ++L    VA +P+GG +A+ RD +KI + 
Sbjct  1    MTTTNPRSGWEKIGDQFYQKIQLYESIFDQDLELENYLVAGAPYGGALALWRDSSKIARY  60

Query  257  -YAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +S    + I++++G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKSTIDIYSTSGKLISNINWEK--GPIKGLGWSDDEKLLVVTEDGTVHCYFGLYG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +   LG     + VV C FW +G V +     +  +  F  P P  LA P   +   S
Sbjct  119  DFQPFLLGHGAEEYGVVSCRFWSHGFVALLSNNTLVAVSSFDEPRPRLLAQPPEGEIS-S  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>gb|ETO77515.1| hypothetical protein F444_07304 [Phytophthora parasitica P1976]
Length=1860

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 11/197 (6%)
 Frame = +2

Query  89    VSVAAEWQLLYNRYYRKPELYQMQWKH---VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
             +S+  EW  L    Y+K  +Y M W      DL     AC+P+GGP+A++RD  K+V++ 
Sbjct  989   ISMETEWHTLGKVQYQKWAVYGMTWASEGVTDLRDFVAACAPYGGPVALLRDPKKLVKVS  1048

Query  260   AESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  427
             ++S L R+L +FN+ G ++    W   ++    LVGM+WTD+  L+C+   GT   + + 
Sbjct  1049  SDSPLARQLLLFNACGRKLGSVDWTPFEDKKETLVGMTWTDELRLLCVFASGTCVAFSMS  1108

Query  428   AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLADPGLED  601
              +     SL        V     W  G+V + E   +  + D  +  P    L D GL D
Sbjct  1109  GDEETRFSLLPPGAKDKVATFEAWGGGLVALTEKMALVQVLDVDSVRPKVSLLPDCGLSD  1168

Query  602   F--PLSMTVIEPQYTMS  646
                P  M ++EP++  S
Sbjct  1169  SNPPTCMALLEPKFLKS  1185



>gb|ETM48446.1| hypothetical protein L914_07020 [Phytophthora parasitica]
Length=1860

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 11/197 (6%)
 Frame = +2

Query  89    VSVAAEWQLLYNRYYRKPELYQMQWKH---VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
             +S+  EW  L    Y+K  +Y M W      DL     AC+P+GGP+A++RD  K+V++ 
Sbjct  989   ISMETEWHTLGKVQYQKWAVYGMTWASEGVTDLRDFVAACAPYGGPVALLRDPKKLVKVS  1048

Query  260   AESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  427
             ++S L R+L +FN+ G ++    W   ++    LVGM+WTD+  L+C+   GT   + + 
Sbjct  1049  SDSPLARQLLLFNACGRKLGSVDWTPFEDKKETLVGMTWTDELRLLCVFASGTCVAFSMS  1108

Query  428   AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLADPGLED  601
              +     SL        V     W  G+V + E   +  + D  +  P    L D GL D
Sbjct  1109  GDEETRFSLLPPGAKDKVATFEAWGGGLVALTEKMALVQVLDVDSVRPKVSLLPDCGLSD  1168

Query  602   F--PLSMTVIEPQYTMS  646
                P  M ++EP++  S
Sbjct  1169  SNPPTCMALLEPKFLKS  1185



>gb|ETL42068.1| hypothetical protein L916_07062 [Phytophthora parasitica]
Length=1860

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 11/197 (6%)
 Frame = +2

Query  89    VSVAAEWQLLYNRYYRKPELYQMQWKH---VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
             +S+  EW  L    Y+K  +Y M W      DL     AC+P+GGP+A++RD  K+V++ 
Sbjct  989   ISMETEWHTLGKVQYQKWAVYGMTWASEGVTDLRDFVAACAPYGGPVALLRDPKKLVKVS  1048

Query  260   AESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  427
             ++S L R+L +FN+ G ++    W   ++    LVGM+WTD+  L+C+   GT   + + 
Sbjct  1049  SDSPLARQLLLFNACGRKLGSVDWTPFEDKKETLVGMTWTDELRLLCVFASGTCVAFSMS  1108

Query  428   AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLADPGLED  601
              +     SL        V     W  G+V + E   +  + D  +  P    L D GL D
Sbjct  1109  GDEETRFSLLPPGAKDKVATFEAWGGGLVALTEKMALVQVLDVDSVRPKVSLLPDCGLSD  1168

Query  602   F--PLSMTVIEPQYTMS  646
                P  M ++EP++  S
Sbjct  1169  SNPPTCMALLEPKFLKS  1185



>gb|ETK88680.1| hypothetical protein L915_07109 [Phytophthora parasitica]
Length=1860

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 11/197 (6%)
 Frame = +2

Query  89    VSVAAEWQLLYNRYYRKPELYQMQWKH---VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
             +S+  EW  L    Y+K  +Y M W      DL     AC+P+GGP+A++RD  K+V++ 
Sbjct  989   ISMETEWHTLGKVQYQKWAVYGMTWASEGVTDLRDFVAACAPYGGPVALLRDPKKLVKVS  1048

Query  260   AESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  427
             ++S L R+L +FN+ G ++    W   ++    LVGM+WTD+  L+C+   GT   + + 
Sbjct  1049  SDSPLARQLLLFNACGRKLGSVDWTPFEDKKETLVGMTWTDELRLLCVFASGTCVAFSMS  1108

Query  428   AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLADPGLED  601
              +     SL        V     W  G+V + E   +  + D  +  P    L D GL D
Sbjct  1109  GDEETRFSLLPPGAKDKVATFEAWGGGLVALTEKMALVQVLDVDSVRPKVSLLPDCGLSD  1168

Query  602   F--PLSMTVIEPQYTMS  646
                P  M ++EP++  S
Sbjct  1169  SNPPTCMALLEPKFLKS  1185



>gb|ETL95226.1| hypothetical protein L917_06946 [Phytophthora parasitica]
Length=1860

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 11/197 (6%)
 Frame = +2

Query  89    VSVAAEWQLLYNRYYRKPELYQMQWKH---VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
             +S+  EW  L    Y+K  +Y M W      DL     AC+P+GGP+A++RD  K+V++ 
Sbjct  989   ISMETEWHTLGKVQYQKWAVYGMTWASEGVTDLRDFVAACAPYGGPVALLRDPKKLVKVS  1048

Query  260   AESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  427
             ++S L R+L +FN+ G ++    W   ++    LVGM+WTD+  L+C+   GT   + + 
Sbjct  1049  SDSPLARQLLLFNACGRKLGSVDWTPFEDKKETLVGMTWTDELRLLCVFASGTCVAFSMS  1108

Query  428   AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLADPGLED  601
              +     SL        V     W  G+V + E   +  + D  +  P    L D GL D
Sbjct  1109  GDEETRFSLLPPGAKDKVATFEAWGGGLVALTEKMALVQVLDVDSVRPKVSLLPDCGLSD  1168

Query  602   F--PLSMTVIEPQYTMS  646
                P  M ++EP++  S
Sbjct  1169  SNPPTCMALLEPKFLKS  1185



>gb|ETP18545.1| hypothetical protein F441_07251 [Phytophthora parasitica CJ01A1]
Length=1860

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 11/197 (6%)
 Frame = +2

Query  89    VSVAAEWQLLYNRYYRKPELYQMQWKH---VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
             +S+  EW  L    Y+K  +Y M W      DL     AC+P+GGP+A++RD  K+V++ 
Sbjct  989   ISMETEWHTLGKVQYQKWAVYGMTWASEGVTDLRDFVAACAPYGGPVALLRDPKKLVKVS  1048

Query  260   AESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  427
             ++S L R+L +FN+ G ++    W   ++    LVGM+WTD+  L+C+   GT   + + 
Sbjct  1049  SDSPLARQLLLFNACGRKLGSVDWTPFEDKKETLVGMTWTDELRLLCVFASGTCVAFSMS  1108

Query  428   AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLADPGLED  601
              +     SL        V     W  G+V + E   +  + D  +  P    L D GL D
Sbjct  1109  GDEETRFSLLPPGAKDKVATFEAWGGGLVALTEKMALVQVLDVDSVRPKVSLLPDCGLSD  1168

Query  602   F--PLSMTVIEPQYTMS  646
                P  M ++EP++  S
Sbjct  1169  SNPPTCMALLEPKFLKS  1185



>ref|XP_664515.1| hypothetical protein AN6911.2 [Aspergillus nidulans FGSC A4]
 gb|EAA57594.1| hypothetical protein AN6911.2 [Aspergillus nidulans FGSC A4]
Length=774

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 101/192 (53%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ L + +YRK  LY   + + V+L    VA +P+GG IA+ RD++K ++ 
Sbjct  1    MAPSNPLANWERLGSSFYRKVPLYHSVFGEDVELENYIVAGAPYGGAIALYRDESKPLRF  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
              A++    + I++ +G  I    W++  G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTGKSNIDIYSRSGKLINRLNWEH--GTIRGLGWSDQEELLVITEDGTVRRYFGLYG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
               S SLG     + V  C FW++G V +    Q+  +  +  P P  LA  P  E    
Sbjct  119  DFTSFSLGNGAEEYGVRACRFWNSGFVALLANNQLIAVSSYNEPRPRLLAQCP--EGEVA  176

Query  611  SMTVIEPQYTMS  646
            S ++I P YT+S
Sbjct  177  SWSLIPPAYTLS  188



>tpe|CBF71716.1| TPA: vacuolar protein sorting vps16, putative (AFU_orthologue; 
AFUA_5G13600) [Aspergillus nidulans FGSC A4]
Length=829

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 101/192 (53%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ L + +YRK  LY   + + V+L    VA +P+GG IA+ RD++K ++ 
Sbjct  1    MAPSNPLANWERLGSSFYRKVPLYHSVFGEDVELENYIVAGAPYGGAIALYRDESKPLRF  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
              A++    + I++ +G  I    W++  G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTGKSNIDIYSRSGKLINRLNWEH--GTIRGLGWSDQEELLVITEDGTVRRYFGLYG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
               S SLG     + V  C FW++G V +    Q+  +  +  P P  LA  P  E    
Sbjct  119  DFTSFSLGNGAEEYGVRACRFWNSGFVALLANNQLIAVSSYNEPRPRLLAQCP--EGEVA  176

Query  611  SMTVIEPQYTMS  646
            S ++I P YT+S
Sbjct  177  SWSLIPPAYTLS  188



>gb|ETI48788.1| hypothetical protein F443_07235 [Phytophthora parasitica P1569]
Length=1895

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 11/197 (6%)
 Frame = +2

Query  89    VSVAAEWQLLYNRYYRKPELYQMQWKH---VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
             +S+  EW  L    Y+K  +Y M W      DL     AC+P+GGP+A++RD  K+V++ 
Sbjct  1024  ISMETEWHTLGKVQYQKWAVYGMTWASEGVTDLRDFVAACAPYGGPVALLRDPKKLVKVS  1083

Query  260   AESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  427
             ++S L R+L +FN+ G ++    W   ++    LVGM+WTD+  L+C+   GT   + + 
Sbjct  1084  SDSPLARQLLLFNACGRKLGSVDWTPFEDKKETLVGMTWTDELRLLCVFASGTCVAFSMS  1143

Query  428   AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLADPGLED  601
              +     SL        V     W  G+V + E   +  + D  +  P    L D GL D
Sbjct  1144  GDEETRFSLLPPGAKDKVATFEAWGGGLVALTEKMALVQVLDVDSVRPKVSLLPDCGLSD  1203

Query  602   F--PLSMTVIEPQYTMS  646
                P  M ++EP++  S
Sbjct  1204  SNPPTCMALLEPKFLKS  1220



>ref|XP_002837491.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81682.1| unnamed protein product [Tuber melanosporum]
Length=832

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 98/197 (50%), Gaps = 12/197 (6%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            MS  S  A W+ + ++YYR  +LY   W    DL+   V  +P+GG +A+ +D+ +I Q 
Sbjct  1    MSHTSATAGWERVEDKYYRTIQLYSALWDPDFDLSDYIVVGAPYGGALALYKDETRI-QA  59

Query  257  YAESALRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIR  427
            Y  S   K  + I+++AG  I    W    G + G+ W++D+ L+ +T+DG V   YD++
Sbjct  60   YRSSQQSKSSIDIYSAAGRLIRRISWDK--GSIKGLGWSEDEKLLVVTEDGVVRCYYDLQ  117

Query  428  AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADP----GL  595
             +     SLG       V +C F+  G V +    Q   +  +  P P  LADP      
Sbjct  118  GD-FTQFSLGNGAEEAGVKECRFYSTGFVALLRNNQFISVSRYDEPRPRLLADPVPFIPA  176

Query  596  EDFPLSMTVIEPQYTMS  646
             +   S T++ P YT+S
Sbjct  177  TEIIHSWTILPPSYTLS  193



>gb|ETP46453.1| hypothetical protein F442_07305 [Phytophthora parasitica P10297]
Length=1895

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 11/197 (6%)
 Frame = +2

Query  89    VSVAAEWQLLYNRYYRKPELYQMQWKH---VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
             +S+  EW  L    Y+K  +Y M W      DL     AC+P+GGP+A++RD  K+V++ 
Sbjct  1024  ISMETEWHTLGKVQYQKWAVYGMTWASEGVTDLRDFVAACAPYGGPVALLRDPKKLVKVS  1083

Query  260   AESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  427
             ++S L R+L +FN+ G ++    W   ++    LVGM+WTD+  L+C+   GT   + + 
Sbjct  1084  SDSPLARQLLLFNACGRKLGSVDWTPFEDKKETLVGMTWTDELRLLCVFASGTCVAFSMS  1143

Query  428   AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLADPGLED  601
              +     SL        V     W  G+V + E   +  + D  +  P    L D GL D
Sbjct  1144  GDEETRFSLLPPGAKDKVATFEAWGGGLVALTEKMALVQVLDVDSVRPKVSLLPDCGLSD  1203

Query  602   F--PLSMTVIEPQYTMS  646
                P  M ++EP++  S
Sbjct  1204  SNPPTCMALLEPKFLKS  1220



>ref|XP_007733017.1| hypothetical protein A1O3_04699 [Capronia epimyces CBS 606.96]
 gb|EXJ84032.1| hypothetical protein A1O3_04699 [Capronia epimyces CBS 606.96]
Length=830

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 102/191 (53%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ + +++Y+K +LY+  +   ++L    VA +P+GG +A+ RD AKI + 
Sbjct  1    MTNHNPRAGWEKIGDQFYQKIQLYESIFDPDLELENYLVAGAPYGGALALWRDPAKIARY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +SA   + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSAKPTIDIYSSSGKLISNINWEK--GPIKGLGWSDDEKLLVVTEDGTVHCYFGLHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +  SLG       V  C FW +G+V +     +  +  F  P P  LA P   +   S
Sbjct  119  DFQPFSLGHGAEEFGVKSCRFWSHGLVALLSNNALIAVSSFDEPRPRLLAQPPDGEVH-S  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>ref|XP_011420359.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Crassostrea gigas]
 gb|EKC23509.1| Vacuolar protein sorting-associated protein 16-like protein [Crassostrea 
gigas]
Length=828

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 99/181 (55%), Gaps = 9/181 (5%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W  L   YY+K E+Y M W   +D+++ +V+ +P+GGPIA+++D++K  ++   S   
Sbjct  4    ADWNPLGEIYYKKCEVYSMGWSDTIDISKFEVSAAPYGGPIALLKDESKTARVQV-STKP  62

Query  278  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  457
             + +F +AG QI++  W +  G +  M W+  + L+ +  DG V  YD+     ++  +G
Sbjct  63   IITVFTAAGKQISQMRWNS--GSIHKMGWSHTEDLLFVQDDGVVLVYDMFLTFKKTFGMG  120

Query  458  KDCFTHSVVDCVFWHN----GVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTV  622
            ++     V+DC  + +    G+  +   ++VF I    +P   +LA+ PGL   P S  V
Sbjct  121  QEAKDVKVIDCKIFSSYQGTGIAVLTSTYRVFIINSVDDPRIRRLAEVPGLSSAPSSWAV  180

Query  623  I  625
            I
Sbjct  181  I  181



>gb|KIY03984.1| hypothetical protein Z520_00676 [Fonsecaea multimorphosa CBS 
102226]
Length=830

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 101/191 (53%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M++ +  A W+++ +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KI + 
Sbjct  1    MTSNNPRAGWEIVGDQFYRKVPLYESIFDQDLELENYLVAGAPYGGALALWRDTTKIARY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNINWEK--GVIKGLGWSDDEKLLVVTEDGTVHCYFELHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +  SLG       VV C FW +G V +     +  +  F  P P  LA    E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNSLVAVSSFDEPRPRLLAQ-APEGEVHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>ref|XP_008712782.1| hypothetical protein HMPREF1541_09888 [Cyphellophora europaea 
CBS 101466]
 gb|ETN45012.1| hypothetical protein HMPREF1541_09888 [Cyphellophora europaea 
CBS 101466]
Length=831

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 100/191 (52%), Gaps = 4/191 (2%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M++ +  A W+ + N++YRK  LY+  +   ++L    VA +P+ G +A+ R+++KI + 
Sbjct  1    MTSTNPRAGWERIDNQFYRKIRLYEQVFDPDLELENYLVAGAPYSGALALWRNESKISRY  60

Query  257  -YAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++S+G  I+   W    G + G+ W+DD+ L+ IT+DGTV  Y    E
Sbjct  61   RVGGSAKPTIDIYSSSGKLISNISWDK--GSIRGLGWSDDEQLLVITEDGTVRCYFGLHE  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
                 SLG +   H V  C FW +G V +     +  +  F+ P+ ++      +    +
Sbjct  119  DFTPFSLGLEAEEHGVASCRFWSHGFVALLSNNTLVAVSSFREPHSVQQLAAVPDGKVYA  178

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  179  WSLIPPAYTLS  189



>ref|XP_008887993.1| vacuolar protein sorting 16, putative [Hammondia hammondi]
 gb|KEP61375.1| vacuolar protein sorting 16, putative [Hammondia hammondi]
Length=920

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 106/199 (53%), Gaps = 10/199 (5%)
 Frame = +2

Query  44   IQSGAPSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQWKH----VDLTRNKVACSPFG  211
            + S +P+++    +  + +++WQ L + +YRK +++ M+WKH     DL    VA +P+G
Sbjct  14   LASLSPATDFSFSAGANGSSDWQCLDSVWYRKLDVFDMEWKHERQLFDLF--VVAAAPYG  71

Query  212  GPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICI  391
            GP+A +R++ K+ Q   ++   +L+IF++ G  +A++ W     RLV MSW +D+ L+C+
Sbjct  72   GPVACVRNE-KVFQPARKNIKPELQIFSARGRLLAKSPWTY--SRLVSMSWNNDEVLVCV  128

Query  392  TQDGTVYRYDIRAEPLESLSLGKDCFTH-SVVDCVFWHNGVVCINEAFQVFCIPDFKNPN  568
             QDG V  +  + E L   SL +       +V       G+V +  A   +    F    
Sbjct  129  FQDGVVRTFSPQCEKLHFFSLDERIKGEGGLVQAAVGGCGIVALTAALNFYYNDAFDRSQ  188

Query  569  PIKLADPGLEDFPLSMTVI  625
             I L D GL   PLS+ ++
Sbjct  189  AIVLPDTGLRGPPLSLCIL  207



>gb|KEQ80575.1| vacuolar protein sorting-associated protein 16 [Aureobasidium 
pullulans EXF-150]
Length=822

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 92/184 (50%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W+ + +R+YRK +LY   +   ++L  + +  +P  G IA+ RD+ K+    + +A R
Sbjct  6    ADWERVGDRFYRKTQLYTSVFDPELELENHVLVGAPLSGAIAIYRDENKLYAYRSSNAAR  65

Query  278  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + I+  +G  I    W    G + G  W++D+ LI +T DGTV  Y   +      SL
Sbjct  66   PSIDIYTCSGKLIHRINWDK--GSIHGCGWSEDERLIVVTNDGTVRIYHDLSGDFIPFSL  123

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G     H VV C FW +G V +    Q+  +  +  P P  LA P  E   LS  VI P 
Sbjct  124  GHGADQHGVVSCRFWSSGFVALLGNNQLVSVSRYDEPRPTLLATPP-EGEILSWAVIPPA  182

Query  635  YTMS  646
            +T+S
Sbjct  183  FTLS  186



>gb|KDQ31847.1| hypothetical protein PLEOSDRAFT_48878 [Pleurotus ostreatus PC15]
Length=846

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 99/192 (52%), Gaps = 8/192 (4%)
 Frame = +2

Query  86   TVSVAAEWQLLY--NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            T    A W  +   N +YR+ +LY    K  +L    VA   +GGP+A++RD  K++ + 
Sbjct  2    TAHPTASWSAMQDGNVFYRRQQLYSTSGKLPNLNEYIVAGCKYGGPLAMMRDTTKVISIG  61

Query  260  AES-ALRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  430
              + AL K  ++I++ AG  +    W N  G++V   WTDD+ L+ + ++G    YD++ 
Sbjct  62   GTNPALNKAQIQIYSPAGDGMLLFSWDN--GKIVRFGWTDDERLVILNEEGVYRLYDLQG  119

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
            +  +  SLG +     +VD   + +G+V I  +  +  +  ++   P+ LA+PGL   P 
Sbjct  120  D-YQQYSLGSEAGELGIVDACIYESGLVAITGSLTLLEVKGWEGARPLSLANPGLTSPPH  178

Query  611  SMTVIEPQYTMS  646
            +  VI P   +S
Sbjct  179  AWAVIPPDLNIS  190



>ref|XP_007301979.1| vacuolar assembling/sorting protein VPS16 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM89070.1| vacuolar assembling/sorting protein VPS16 [Stereum hirsutum FP-91666 
SS1]
Length=846

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 95/178 (53%), Gaps = 6/178 (3%)
 Frame = +2

Query  122  NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES---ALRKLRIF  292
            N +YR+ ++Y +  K  +L    VA   +GGPIA++RD+ K++ L   +   A  ++++F
Sbjct  16   NVFYRRQQVYSIHGKLPNLGDCIVAGCRYGGPIALMRDNTKMIALGRATPVFAKAQIQVF  75

Query  293  NSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFT  472
            + AG       W    G+++   WT D+ L+ + ++G    YD++ +     SLG D   
Sbjct  76   SPAGEGRLLFSWDQ--GKIIRFGWTGDERLVVLNEEGVYRLYDLQGD-YAQFSLGSDATE  132

Query  473  HSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
              ++D     NG+V +    Q+  +  ++   P+ LA+PG+ + P + T+I P +T+S
Sbjct  133  VGIIDAKIHENGLVAMTGTLQLLEVKGWEGAKPLTLANPGMSEPPHAWTIIPPDFTLS  190



>gb|KFY19049.1| hypothetical protein V491_04616 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=834

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 99/197 (50%), Gaps = 5/197 (3%)
 Frame = +2

Query  62   SSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDD  238
            + N +  + ++  A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+
Sbjct  5    NQNEVDATRMNPTADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYRDE  64

Query  239  AKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYR  415
            AK+       A +  + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  
Sbjct  65   AKLHTFRGSQASKSSIDVYSCAGKLIRRVNWDK--GSIKGLGWSEDEKLLVVTQDGTVRC  122

Query  416  YDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL  595
            Y          SLG       V+ C F+  G V +     +  +  ++ P P  LA P  
Sbjct  123  YYNLQGDFSQFSLGHGAEEFGVIACRFYSTGFVALLSNNHLISVARYEEPRPKLLAVPP-  181

Query  596  EDFPLSMTVIEPQYTMS  646
            +    S T++ P YT+S
Sbjct  182  DGVVHSWTLVPPAYTLS  198



>ref|XP_003655439.1| hypothetical protein THITE_2119126 [Thielavia terrestris NRRL 
8126]
 gb|AEO69103.1| hypothetical protein THITE_2119126 [Thielavia terrestris NRRL 
8126]
Length=834

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 98/192 (51%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M      A W+ L +R+YRK +LY Q+  + +DL    VA +P+GG IA+ RD+ K++  
Sbjct  1    MDVAHPTAGWEQLGDRFYRKTQLYAQVFDQDLDLDNYLVAGAPYGGAIALYRDEDKLIAF  60

Query  257  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRA  430
             A    +  + I++ AG  I    W    G + G+ W++D+ L+ +T DGTV   YD++ 
Sbjct  61   QATHPSKPSIDIYSCAGKLIRRINWDQ--GSIKGLGWSEDEKLLVVTADGTVRCYYDLQG  118

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
            E     SLG       V  C F+ +G+V + +   +  +  +  P P  LA P  E    
Sbjct  119  E-FTQFSLGNGADEAGVQSCRFYAHGLVALLKNNALVSVSSYDEPRPKLLASPP-EGQVH  176

Query  611  SMTVIEPQYTMS  646
            S  +I P YT+S
Sbjct  177  SWNIIPPAYTLS  188



>ref|XP_005846081.1| hypothetical protein CHLNCDRAFT_135924 [Chlorella variabilis]
 gb|EFN53979.1| hypothetical protein CHLNCDRAFT_135924 [Chlorella variabilis]
Length=953

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 86/173 (50%), Gaps = 12/173 (7%)
 Frame = +2

Query  104  EWQLLYNRYYRKPELYQMQWKH--------VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            EWQL+ + YY + ELY++ W           DL   +V  +P GGPIA +RDD+K+V   
Sbjct  11   EWQLVGDAYYSRRELYRLDWGGGGSGGGGSFDLAFMRVFPAPAGGPIAALRDDSKLVLYV  70

Query  260  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  439
                   +++F+ AG  +   +W   GG ++   WT  + L+ +     V+ + +R E L
Sbjct  71   GGFTKPDVQVFSGAGAPLGRVLWD--GGHVLAAGWTAGEQLLVLEAGAKVHMFSVRGERL  128

Query  440  -ESLSLGKDCFTHSVVD-CVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPG  592
               LSLG +C     V+  V + +G+  +  A  ++C+PD   P   +  DP 
Sbjct  129  PRHLSLGAECEEEGGVEAAVLFRDGLALLTPAGHLWCVPDVHEPRLQRFPDPA  181



>gb|KFY18957.1| hypothetical protein V493_08231 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=834

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 98/197 (50%), Gaps = 5/197 (3%)
 Frame = +2

Query  62   SSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDD  238
            + N    + ++  A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+
Sbjct  5    TQNEADATRMNPTADWEKLGERYYRKIQLYTEVFDQDLELENHIVTGAPYGGAIALYRDE  64

Query  239  AKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYR  415
            AK+       A +  + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  
Sbjct  65   AKLHTFRGSQASKSSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRC  122

Query  416  YDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL  595
            Y          SLG       V+ C F+  G V +     +  +  ++ P P  LA P  
Sbjct  123  YYNLQGDFSQFSLGHGAEDFGVIGCRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-  181

Query  596  EDFPLSMTVIEPQYTMS  646
            +    S T++ P YT+S
Sbjct  182  DGIVHSWTLVPPAYTLS  198



>ref|XP_002369923.1| hypothetical protein, conserved [Toxoplasma gondii ME49]
Length=895

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 105/197 (53%), Gaps = 10/197 (5%)
 Frame = +2

Query  50   SGAPSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQWKH----VDLTRNKVACSPFGGP  217
            S +P+++    +  + +++WQ L + +YRK +++ M+WKH     DL    VA +P+GGP
Sbjct  16   SLSPAADFSFSAGANGSSDWQCLDSVWYRKLDVFDMEWKHERQLFDLF--VVAAAPYGGP  73

Query  218  IAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQ  397
            +A +R++ K+ Q   ++   +L+IF++ G  +A++ W     RLV MSW +D+ L+C+ Q
Sbjct  74   VACVRNE-KVFQPAKKNIKPELQIFSARGRLLAKSPWTY--SRLVTMSWNNDEVLVCVFQ  130

Query  398  DGTVYRYDIRAEPLESLSLGKDCFTH-SVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPI  574
            DG V  +  + E L   SL +       +V       G+V +  A   +    F     I
Sbjct  131  DGVVRTFSPQCEKLHFFSLDERIKVEGGLVQAAVGGCGIVALTAALNFYYNDAFDRSQTI  190

Query  575  KLADPGLEDFPLSMTVI  625
             L D GL   PLS+ ++
Sbjct  191  VLPDTGLRGPPLSLCIL  207



>ref|XP_011318503.1| hypothetical protein FGSG_02565 [Fusarium graminearum PH-1]
 gb|ESU08018.1| hypothetical protein FGSG_02565 [Fusarium graminearum PH-1]
 gb|EYB30840.1| hypothetical protein FG05_02565 [Fusarium graminearum]
 emb|CEF74879.1| unnamed protein product [Fusarium graminearum]
Length=827

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 101/191 (53%), Gaps = 6/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYVVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DG V  YD++ E
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTADGNVRCYDLQGE  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA    E    +
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNTLITVSSYTEPRPKALAQTP-EGGINA  176

Query  614  MTVIEPQYTMS  646
             ++I P +T+S
Sbjct  177  WSIISPNHTLS  187



>dbj|GAA90716.1| vacuolar protein sorting vps16 [Aspergillus kawachii IFO 4308]
Length=829

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 99/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ L + +YRK  +Y   +   V+L    +A +P+GG IA+ RD++K  + 
Sbjct  1    MAPSNPLANWERLGDSFYRKVPIYDAIFDDDVELENYIIAGAPYGGAIALHRDESKPYRF  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
              A++A   + I++ +G  I    W+   G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTAKSSIDIYSCSGKHINRINWEY--GTIRGLGWSDKEELLVITEDGTVRRYFGLHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
               S SLG     + V  C FW +G V +    Q+  + ++  P P  LA P  E    S
Sbjct  119  DFTSFSLGNGAEDYGVRACRFWTSGFVALLSNNQLVAVSNYDEPRPRLLA-PCPEGEVSS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>ref|XP_001401136.1| vacuolar protein sorting vps16 [Aspergillus niger CBS 513.88]
 emb|CAK42074.1| unnamed protein product [Aspergillus niger]
Length=829

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 99/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ L + +YRK  +Y   +   V+L    +A +P+GG IA+ RD++K  + 
Sbjct  1    MAPSNPLANWERLGDSFYRKVPIYDAIFDDDVELENYIIAGAPYGGAIALHRDESKPYRF  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
              A++A   + I++ +G  I    W+   G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTAKSSIDIYSCSGKHINRINWEY--GTIRGLGWSDKEELLVITEDGTVRRYFGLHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
               S SLG     + V  C FW +G V +    Q+  + ++  P P  LA P  E    S
Sbjct  119  DFTSFSLGNGAEDYGVRACRFWTSGFVALLSNNQLVAVSNYDEPRPRLLA-PCPEGEVSS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>gb|EHA27921.1| hypothetical protein ASPNIDRAFT_53870 [Aspergillus niger ATCC 
1015]
Length=829

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 99/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ L + +YRK  +Y   +   V+L    +A +P+GG IA+ RD++K  + 
Sbjct  1    MAPSNPLANWERLGDSFYRKVPIYDAIFDDDVELENYIIAGAPYGGAIALHRDESKPYRF  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
              A++A   + I++ +G  I    W+   G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTAKSSIDIYSCSGKHINRINWEY--GTIRGLGWSDKEELLVITEDGTVRRYFGLHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
               S SLG     + V  C FW +G V +    Q+  + ++  P P  LA P  E    S
Sbjct  119  DFTSFSLGNGAEDYGVRACRFWTSGFVALLSNNQLVAVSNYDEPRPRLLA-PCPEGEVSS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>gb|EPR58066.1| putative vacuolar protein sorting 16 [Toxoplasma gondii GT1]
 gb|EPT31606.1| vacuolar protein sorting 16, putative [Toxoplasma gondii ME49]
Length=920

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 105/197 (53%), Gaps = 10/197 (5%)
 Frame = +2

Query  50   SGAPSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQWKH----VDLTRNKVACSPFGGP  217
            S +P+++    +  + +++WQ L + +YRK +++ M+WKH     DL    VA +P+GGP
Sbjct  16   SLSPAADFSFSAGANGSSDWQCLDSVWYRKLDVFDMEWKHERQLFDLF--VVAAAPYGGP  73

Query  218  IAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQ  397
            +A +R++ K+ Q   ++   +L+IF++ G  +A++ W     RLV MSW +D+ L+C+ Q
Sbjct  74   VACVRNE-KVFQPAKKNIKPELQIFSARGRLLAKSPWTY--SRLVTMSWNNDEVLVCVFQ  130

Query  398  DGTVYRYDIRAEPLESLSLGKDCFTH-SVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPI  574
            DG V  +  + E L   SL +       +V       G+V +  A   +    F     I
Sbjct  131  DGVVRTFSPQCEKLHFFSLDERIKVEGGLVQAAVGGCGIVALTAALNFYYNDAFDRSQTI  190

Query  575  KLADPGLEDFPLSMTVI  625
             L D GL   PLS+ ++
Sbjct  191  VLPDTGLRGPPLSLCIL  207



>gb|ESS29871.1| putative vacuolar protein sorting 16 [Toxoplasma gondii VEG]
 gb|KFG32717.1| Vps16, N-terminal region protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=920

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 105/197 (53%), Gaps = 10/197 (5%)
 Frame = +2

Query  50   SGAPSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQWKH----VDLTRNKVACSPFGGP  217
            S +P+++    +  + +++WQ L + +YRK +++ M+WKH     DL    VA +P+GGP
Sbjct  16   SLSPAADFSFSAGANGSSDWQCLDSVWYRKLDVFDMEWKHERQLFDLF--VVAAAPYGGP  73

Query  218  IAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQ  397
            +A +R++ K+ Q   ++   +L+IF++ G  +A++ W     RLV MSW +D+ L+C+ Q
Sbjct  74   VACVRNE-KVFQPAKKNIKPELQIFSARGRLLAKSPWTY--SRLVTMSWNNDEVLVCVFQ  130

Query  398  DGTVYRYDIRAEPLESLSLGKDCFTH-SVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPI  574
            DG V  +  + E L   SL +       +V       G+V +  A   +    F     I
Sbjct  131  DGVVRTFSPQCEKLHFFSLDERIKVEGGLVQAAVGGCGIVALTAALNFYYNDAFDRSQTI  190

Query  575  KLADPGLEDFPLSMTVI  625
             L D GL   PLS+ ++
Sbjct  191  VLPDTGLRGPPLSLCIL  207



>gb|EWZ38287.1| hypothetical protein FOZG_09966 [Fusarium oxysporum Fo47]
 gb|EWZ82849.1| hypothetical protein FOWG_13655 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXL57751.1| hypothetical protein FOCG_04830 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=827

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 102/192 (53%), Gaps = 8/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  611  SMTVIEPQYTMS  646
            S  +I P +T+S
Sbjct  178  S--IISPNHTLS  187



>gb|KIV93309.1| hypothetical protein PV10_04533 [Exophiala mesophila]
Length=830

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M++ +  A W+ + N++Y+K +LY+  +   ++L    VA +P+GG +A+ RD +K+ + 
Sbjct  1    MTSTNPRAGWEKIGNQFYQKVQLYESIFDPDLELGNYLVAGAPYGGALALWRDKSKVARY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DG V+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGQLISNINWEK--GAIKGLGWSDDEKLLVVTEDGIVHCYFGLHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
                 SLG     + V  C FW +G V +     +  +  F  P P KL  P  E    S
Sbjct  119  DFNPFSLGHGAEEYGVQSCRFWSHGFVALLSNNALITVSSFDEPRP-KLLAPTPEGEIHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>gb|EXM23638.1| hypothetical protein FOTG_09079 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=827

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 102/192 (53%), Gaps = 8/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  611  SMTVIEPQYTMS  646
            S  +I P +T+S
Sbjct  178  S--IISPNHTLS  187



>gb|EXK40358.1| hypothetical protein FOMG_07258 [Fusarium oxysporum f. sp. melonis 
26406]
Length=827

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 102/192 (53%), Gaps = 8/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  611  SMTVIEPQYTMS  646
            S  +I P +T+S
Sbjct  178  S--IISPNHTLS  187



>gb|EWY91619.1| hypothetical protein FOYG_08668 [Fusarium oxysporum FOSC 3-a]
Length=827

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 102/192 (53%), Gaps = 8/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  611  SMTVIEPQYTMS  646
            S  +I P +T+S
Sbjct  178  S--IISPNHTLS  187



>gb|KIW03814.1| hypothetical protein PV09_05114 [Verruconis gallopava]
Length=825

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 92/184 (50%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A W  + +R+YR+ +LY   +   ++L    +A +P+ G +A  RD+ K+         R
Sbjct  6    ANWDKVGDRFYRRVQLYTSVFDPDLELENYTIAGAPYSGALAFHRDETKLQTYRGTQTTR  65

Query  278  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + I++SAG  I   +W    G + G+ W++D+ LI +T+DGTV  Y+         SL
Sbjct  66   STIDIYSSAGKLIRRLIWDQ--GNIKGLGWSEDEKLITVTEDGTVRVYEGLQSDFVPFSL  123

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G     H V+ C F  NG V +     +  +P + +P P++LA P  +    S  +I P 
Sbjct  124  GHGAEEHGVISCRFHANGFVALLGNNHLVSVPRYNDPRPLELAVPP-DQLVTSWAIISPG  182

Query  635  YTMS  646
             ++S
Sbjct  183  DSLS  186



>gb|KFZ12341.1| hypothetical protein V502_07139 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=881

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 99/197 (50%), Gaps = 5/197 (3%)
 Frame = +2

Query  62   SSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDD  238
            + N   ++ ++  A+W+ L  RYYRK +LY   + + ++L  + VA +P+GG IA+ RD+
Sbjct  52   NQNEADVARMNPTADWEKLGERYYRKIQLYTEVFDQDLELENHIVAGAPYGGAIALYRDE  111

Query  239  AKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYR  415
             K+       A +  + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  
Sbjct  112  TKLHTFRGSQASKSSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRC  169

Query  416  YDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL  595
            Y          SLG       V+ C F+  G V +     +  +  ++ P P  LA P  
Sbjct  170  YYNLQGDFSQFSLGHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-  228

Query  596  EDFPLSMTVIEPQYTMS  646
            +    S T++ P YT+S
Sbjct  229  DGVVHSWTLVPPAYTLS  245



>gb|EWG49671.1| hypothetical protein FVEG_09136 [Fusarium verticillioides 7600]
Length=746

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 102/192 (53%), Gaps = 8/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  611  SMTVIEPQYTMS  646
            S  +I P +T+S
Sbjct  178  S--IISPNHTLS  187



>gb|ENH66099.1| Putative vacuolar protein sorting-associated protein 16 like 
protein [Fusarium oxysporum f. sp. cubense race 1]
Length=827

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 102/192 (53%), Gaps = 8/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  611  SMTVIEPQYTMS  646
            S  +I P +T+S
Sbjct  178  S--IISPNHTLS  187



>gb|EWG49670.1| hypothetical protein FVEG_09136 [Fusarium verticillioides 7600]
Length=827

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 102/192 (53%), Gaps = 8/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  611  SMTVIEPQYTMS  646
            S  +I P +T+S
Sbjct  178  S--IISPNHTLS  187



>emb|CCG84590.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=826

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 98/187 (52%), Gaps = 11/187 (6%)
 Frame = +2

Query  104  EW-QLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL-R  277
            EW +L    YY K ELY++ W  VDL+    A + +GG IAV RDD K  +   +S L  
Sbjct  8    EWDELGSETYYHKFELYKLSWPEVDLSGVIFAAASYGGAIAVTRDDEKFQKYRGQSQLSN  67

Query  278  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  457
              ++F+S G  + +  W+    R +G  WTD++ L+ ++++G V  YD+        SL 
Sbjct  68   STQVFSSVGQLLRDIRWEGVSIRSLG--WTDEERLLIVSKEGLVRYYDLLGN-FSQFSLT  124

Query  458  KDCFTHSVVDCVFWHNGVVC--INEAFQVFCIPDFKNPNPIKLADPGL--EDFPLSMTVI  625
            K+     V++C FW++G++    N AF    I +++ P P  L +  L  E    S T+ 
Sbjct  125  KNSDEGEVIECKFWNSGMIARMSNNAF--IKIDNYREPRPHVLLNTHLKPESVINSWTIT  182

Query  626  EPQYTMS  646
             P +T+S
Sbjct  183  APAFTVS  189



>gb|EMT70745.1| Putative vacuolar protein sorting-associated protein 16 like 
protein [Fusarium oxysporum f. sp. cubense race 4]
 gb|EXA45881.1| hypothetical protein FOVG_06735 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK92202.1| hypothetical protein FOQG_06098 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL72473.1| hypothetical protein FOPG_11955 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL97217.1| hypothetical protein FOIG_10867 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
Length=827

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 102/192 (53%), Gaps = 8/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  611  SMTVIEPQYTMS  646
            S  +I P +T+S
Sbjct  178  S--IISPNHTLS  187



>emb|CCT69282.1| related to vacuolar protein sorting VACUOLELESS1 [Fusarium fujikuroi 
IMI 58289]
Length=827

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 102/192 (53%), Gaps = 8/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLIVTTDGTVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  610
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  611  SMTVIEPQYTMS  646
            S  +I P +T+S
Sbjct  178  S--IISPNHTLS  187



>gb|KIW33525.1| hypothetical protein PV07_00366 [Cladophialophora immunda]
Length=830

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+++ +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KI + 
Sbjct  1    MTNNNPRAGWEIVGDQFYRKVPLYESIFDQDLELENYLVAGAPYGGALALWRDTTKIARY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNINWEK--GVIKGLGWSDDEKLLVVTEDGTVHCYFELHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +  SLG       VV C FW +G V +     +  +  F  P P  LA    E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNSLVAVSSFDEPRPRLLAQ-APEGEVHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>gb|KFY86286.1| hypothetical protein V500_07738 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=834

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 99/197 (50%), Gaps = 5/197 (3%)
 Frame = +2

Query  62   SSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDD  238
            + N   ++ ++  A+W+ L  RYYRK +LY   + + ++L  + VA +P+GG IA+ RD+
Sbjct  5    NQNEADVARMNPTADWEKLGERYYRKIQLYTEVFDQDLELENHIVAGAPYGGAIALYRDE  64

Query  239  AKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYR  415
             K+       A +  + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  
Sbjct  65   TKLHTFRGSQASKSSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRC  122

Query  416  YDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL  595
            Y          SLG       V+ C F+  G V +     +  +  ++ P P  LA P  
Sbjct  123  YYNLQGDFSQFSLGHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-  181

Query  596  EDFPLSMTVIEPQYTMS  646
            +    S T++ P YT+S
Sbjct  182  DGVVHSWTLVPPAYTLS  198



>ref|XP_002899238.1| vacuolar protein sorting-associated protein, putative [Phytophthora 
infestans T30-4]
 gb|EEY62207.1| vacuolar protein sorting-associated protein, putative [Phytophthora 
infestans T30-4]
Length=1884

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 99/203 (49%), Gaps = 11/203 (5%)
 Frame = +2

Query  71    NLRMSTVSVAAEWQLLYNRYYRKPELYQMQWKHV---DLTRNKVACSPFGGPIAVIRDDA  241
             +L  S V +  EW  L    Y+K  +Y M W      DL     AC+P+GGP+A++RD  
Sbjct  1007  HLASSLVPMETEWHTLGKVQYQKWAVYGMTWASEGVNDLRDFVAACAPYGGPVALLRDPK  1066

Query  242   KIVQLYAESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQDGTV  409
             K+V++ ++S L R+L +FN+ G ++    W   ++    LVGM+WTD+  L+C+   GT 
Sbjct  1067  KLVKVSSDSPLARQLLLFNACGQKLGTVDWTTFEDKKETLVGMTWTDELRLLCVFASGTC  1126

Query  410   YRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLA  583
               + +  +     SL        V     W  G+V + E   +  + D  +  P    L 
Sbjct  1127  VAFSMAGDEETRFSLLPPGSKDKVATFEAWGGGLVTLTEKMALVQVLDVDSVRPKVSLLP  1186

Query  584   DPGLEDF--PLSMTVIEPQYTMS  646
             D GL D   P  M ++EP++  S
Sbjct  1187  DCGLSDANPPTCMALLEPKFLKS  1209



>ref|XP_007796791.1| putative vacuolar protein sorting-associated protein [Eutypa 
lata UCREL1]
 gb|EMR64106.1| putative vacuolar protein sorting-associated protein [Eutypa 
lata UCREL1]
Length=838

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 95/184 (52%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYA-ESAL  274
            A W+ + +++YRK +LY   + + +DL    VA +P+GG IA+ RD+ KIV   A +S+ 
Sbjct  9    AGWEKVGDKFYRKTQLYTAIFDQDLDLDNYIVAGAPYGGAIAIYRDETKIVSFRASKSSK  68

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + I++ AG  +    W    G + G+ W++D+ L+ +  DGTV  Y          SL
Sbjct  69   PSIDIYSCAGKLLKSLAWDR--GSIKGLGWSEDEKLLVVGYDGTVRCYYGLQGDFTQFSL  126

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G++     V  C F+ +G+V +     +  +  +  P P  LA P  E    S T+I P 
Sbjct  127  GREAEDFGVQSCRFYDHGMVALLTNNTLISVTSYDEPRPKALASPP-EGEVHSWTIISPS  185

Query  635  YTMS  646
            +T+S
Sbjct  186  FTLS  189



>ref|XP_002848487.1| vacuolar protein sorting-associated protein [Arthroderma otae 
CBS 113480]
 gb|EEQ31174.1| vacuolar protein sorting-associated protein [Arthroderma otae 
CBS 113480]
Length=830

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 97/185 (52%), Gaps = 7/185 (4%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESA  271
            A+W+ + +++YRK  +Y   + + V+L       +P+GG IA+ RDD ++ Q Y  A+++
Sbjct  8    ADWERVGDQFYRKSRIYDAVFDEDVELENYIAVGAPYGGAIALYRDDRRL-QRYRDAQTS  66

Query  272  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  451
               + I++ +G +I    W +  G + G+ W+DD+ L+ IT+DGTV  Y   +      S
Sbjct  67   KSSIDIYSCSGHRICRINWDH--GSIRGLGWSDDEKLLAITEDGTVRCYYGLSGDFTPFS  124

Query  452  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  631
            LG     + VV C FW  G V +    Q+  +  +  P P KL     E    S ++I P
Sbjct  125  LGSAAEEYGVVACRFWSTGFVALLSNNQLVAVSHYDEPRP-KLLAQSPEGGISSWSLIPP  183

Query  632  QYTMS  646
             YT+S
Sbjct  184  NYTLS  188



>ref|XP_003855617.1| hypothetical protein MYCGRDRAFT_68201 [Zymoseptoria tritici IPO323]
 gb|EGP90593.1| hypothetical protein MYCGRDRAFT_68201 [Zymoseptoria tritici IPO323]
Length=824

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 92/186 (49%), Gaps = 9/186 (5%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W+ + +R+YR  +LY   +   ++L    V  +P+ G +A+ RD++KI  L   S  +
Sbjct  6    ADWRRIGDRFYRMVQLYTDVFDPSIELEHYTVTGAPYSGAVALRRDESKIYSLRGSSTAK  65

Query  278  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + I++ AG  I +  W     + VG  W++D+ L+ +T+DGTV  Y          S+
Sbjct  66   STIDIYSCAGKLIRQIAWDKGNIKCVG--WSEDERLLVVTEDGTVRMYADLQGDFNPFSI  123

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD--PGLEDFPLSMTVIE  628
            G     H V DC FW NG V +     V  +  +  P P  LA   PG      S TV+ 
Sbjct  124  GHGAEEHGVQDCRFWSNGFVALLGNNAVVAVTRYDEPRPQLLASAPPGQ---VTSWTVVP  180

Query  629  PQYTMS  646
            P+YT S
Sbjct  181  PEYTSS  186



>gb|EPS32356.1| hypothetical protein PDE_07316 [Penicillium oxalicum 114-2]
Length=829

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 97/191 (51%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ + + +YRK  +Y   + +  +L    V  +P+GG IA+ RD++K  QL
Sbjct  1    MAPANPLANWEKVDDSFYRKIPVYDAVFDEDTELENYIVVGAPYGGAIALYRDESKPFQL  60

Query  257  YAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                A R  + I++ +G QI    W+    R  G+ W+D + L+ +++DGTV RY     
Sbjct  61   RDSQASRSCIEIYSCSGKQITRINWEQATIR--GLGWSDKEELLVVSEDGTVRRYFGLDG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
               S SLG     + V  C FW +G+V +    Q+  +  +  P P  LA P  E    S
Sbjct  119  EFTSFSLGNGAEEYGVRACQFWSSGLVALLSNNQLIAVSKYDEPRPRALA-PCPEGEVSS  177

Query  614  MTVIEPQYTMS  646
             ++I P +T+S
Sbjct  178  WSLIPPAHTLS  188



>ref|XP_003030158.1| hypothetical protein SCHCODRAFT_69044 [Schizophyllum commune 
H4-8]
 gb|EFI95255.1| hypothetical protein SCHCODRAFT_69044 [Schizophyllum commune 
H4-8]
Length=848

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 98/185 (53%), Gaps = 8/185 (4%)
 Frame = +2

Query  107  WQLLYNR--YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL-YAESALR  277
            WQ + +   +YRK +LY +  K  +L    VA   +GGP+A++RD+ K++ L  A    +
Sbjct  9    WQAMQDGKVFYRKQQLYMIPDKLPNLADYIVAGCRYGGPLALMRDNTKMIALGRAAPTFQ  68

Query  278  K--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  451
            K  +RI++++G  +    W    GR++   WT D+ L+ + ++G    YD++ E  E  S
Sbjct  69   KAEIRIYSASGDGLLLFTWNQ--GRIIRFGWTHDERLVVLNEEGVYRIYDLQGE-YEQYS  125

Query  452  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  631
            LG +     V+D     +G+V +  +  +  +  +    P+ LA+PGL + P +  VI P
Sbjct  126  LGSEAGELGVIDAQIMESGLVALTGSLSLLEVKGWTGSRPVTLANPGLIEPPSAWAVIPP  185

Query  632  QYTMS  646
             YT S
Sbjct  186  DYTSS  190



>gb|KFY99509.1| hypothetical protein V498_00707 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=821

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 93/184 (51%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+AK+       A +
Sbjct  5    ADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYRDEAKLHTFRGSQASK  64

Query  278  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGQLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRCYYNLQGDFSQFSL  122

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G       V+ C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  635  YTMS  646
            YT+S
Sbjct  182  YTLS  185



>gb|KFY51994.1| hypothetical protein V496_08707 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=821

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 93/184 (51%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+AK+       A +
Sbjct  5    ADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYRDEAKLHTFRGSQASK  64

Query  278  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGQLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRCYYNLQGDFSQFSL  122

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G       V+ C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  635  YTMS  646
            YT+S
Sbjct  182  YTLS  185



>gb|KIW21568.1| hypothetical protein PV08_02148 [Exophiala spinifera]
Length=830

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 98/182 (54%), Gaps = 5/182 (3%)
 Frame = +2

Query  107  WQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESALRK  280
            W+ + +++Y+K +LY+  + + ++L    VA +P+GG +A+ RD +KI +    +S    
Sbjct  10   WEKIGDQFYQKIQLYESVFDRDLELENYLVAGAPYGGALALWRDSSKIARYRTGQSTKST  69

Query  281  LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGK  460
            + I++++G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y       +   LG 
Sbjct  70   IDIYSTSGKLISNINWEK--GPIKGLGWSDDEKLLVVTEDGTVHCYFGLYGDFQPFLLGH  127

Query  461  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  640
                + VV C FW +G V +     +  +  F  P P  LA P  E    S ++I P YT
Sbjct  128  GAEEYGVVSCRFWSHGFVALLSNNALIAVSSFDEPRPRLLAQPP-EGEIHSWSLIPPAYT  186

Query  641  MS  646
            +S
Sbjct  187  LS  188



>emb|CCD43976.1| similar to vacuolar protein sorting vps16 [Botrytis cinerea T4]
Length=852

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 99/196 (51%), Gaps = 9/196 (5%)
 Frame = +2

Query  68   NNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAK  244
            +N+ M+  S  AEW+ + ++YYRK +LY   + + ++L    V    +GG IA+ RD+ K
Sbjct  21   SNIEMT--SPTAEWEKVGDKYYRKTQLYTAVFDQDLELENYVVTGCSYGGAIALYRDETK  78

Query  245  IVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RY  418
            +       A +  + I++ AG  I    W      + G+ WT+D+ LI +T DGTV   Y
Sbjct  79   LQTFRGSQASKSSIDIYSCAGKLIRRINWDQSS--IKGLGWTEDEKLIVVTADGTVRCYY  136

Query  419  DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLE  598
            D++ +     SLG       V+DC F+  G V +     +  +  ++ P P  LA P   
Sbjct  137  DLQGD-FNQFSLGNGAEEFGVIDCRFYGTGFVALLSNNHLISVSRYEEPRPKLLATPPEG  195

Query  599  DFPLSMTVIEPQYTMS  646
            D   S T+I P YT+S
Sbjct  196  DVH-SWTLIPPTYTLS  210



>ref|XP_009658018.1| vacuolar protein sorting-associated protein [Verticillium dahliae 
VdLs.17]
 gb|EGY20767.1| vacuolar protein sorting-associated protein [Verticillium dahliae 
VdLs.17]
Length=826

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 97/182 (53%), Gaps = 6/182 (3%)
 Frame = +2

Query  107  WQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE-SALRK  280
            W+ + ++++RK +LY   + + +DL  + VA +P GG +A+ RDD KI    A+ SA   
Sbjct  10   WESVGDKWFRKTQLYTEVFDQDLDLDNHIVAGAPNGGALAIYRDDTKIQAHRAQKSAKPS  69

Query  281  LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGK  460
            + I++ AG ++    W    G + G+ W++D++L+ +T DGTV  YD++ E     SLG 
Sbjct  70   IDIYSYAGKKLRSIAWDK--GSIKGIGWSEDESLLIVTADGTVRVYDLQGE-FTQFSLGN  126

Query  461  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  640
                + V  C F+ +G+V +     +  +  +  P P  LA P  E       ++ P +T
Sbjct  127  GADNYGVTSCRFYDHGMVALLTNNALISVTSYSEPRPKLLASPP-EGEIHGWAIMTPAHT  185

Query  641  MS  646
            +S
Sbjct  186  LS  187



>ref|XP_007674604.1| hypothetical protein BAUCODRAFT_66530 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC97761.1| hypothetical protein BAUCODRAFT_66530 [Baudoinia compniacensis 
UAMH 10762]
Length=823

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 96/185 (52%), Gaps = 7/185 (4%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESAL  274
            A W+ + +R+YRK +LY   + + ++L    V  +P+ G +A+ RD +KI  L  A+SA 
Sbjct  6    AGWEPVGDRFYRKTQLYTSVFDQDLELENYVVTGAPYSGAVALYRDASKIFSLRGAQSAK  65

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + I++ AG  I +  W+    + VG  W++D+ L+ IT DGTV  Y          ++
Sbjct  66   SSIDIYSCAGKLIRQIPWERQTVKAVG--WSEDERLLVITNDGTVRSYADLHGDFTPFNI  123

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTVIEP  631
            G     H V  C FW NG V +    ++  +  ++ P P  LA  P  E   +S TVI P
Sbjct  124  GHGAEEHGVKGCKFWSNGFVALLGNNRLVAVTRYEEPRPQLLASTPSGE--VMSWTVIPP  181

Query  632  QYTMS  646
            +YT S
Sbjct  182  EYTSS  186



>ref|XP_005176360.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Musca domestica]
Length=841

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 94/179 (53%), Gaps = 12/179 (7%)
 Frame = +2

Query  98   AAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  274
              +W +L    YRK +LY  +W   +DL    VAC+P+GGP+AV RD  KIV +   +A 
Sbjct  7    TGDWFVLRPTTYRKFDLYPPEWPLDLDLEYMSVACAPYGGPVAVTRDPNKIVPVKG-TAK  65

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              +RIF++AG ++ +  W +  GRL+ M W+D + LIC+ +D  V+ YD+     ES  +
Sbjct  66   PVIRIFDTAGQELGKIWWNH--GRLISMGWSDTEELICVQEDALVFIYDMFGNEKESYCI  123

Query  455  GKDCFTHSVVDCVFWHN----GVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  619
            G++     ++D   + +    G+  +    +VF     K+ +        L + P S+T
Sbjct  124  GQEASETKILDAKIFQSSAGTGIAVMTTKHRVF----LKHTSSKDFRSRLLPEIPKSLT  178



>ref|XP_007839731.1| hypothetical protein PFICI_12959 [Pestalotiopsis fici W106-1]
 gb|ETS76015.1| hypothetical protein PFICI_12959 [Pestalotiopsis fici W106-1]
Length=827

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 101/192 (53%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M      A W+ + +R+YRK +LY   + + +DL    VA +P+GG IA+ RD+ K+  L
Sbjct  1    MEAAHPTAGWEKVGDRFYRKTQLYTAVFDRDLDLENYIVAGAPYGGAIALYRDETKLQTL  60

Query  257  YA-ESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRA  430
             A +S+   + I++ AG  +    W    G + G+ W++D+ L+ ++ DGTV   YD++ 
Sbjct  61   RAAKSSKPSIEIYSCAGKLLKSIAWDK--GSIKGLGWSEDEKLLVVSYDGTVRCYYDLQG  118

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
            +     SLG+      V  C F++ G+V +     +  +  +  P P +L  P  E    
Sbjct  119  D-FTQFSLGRGAEDFGVHSCKFYNTGMVALLSNNALISVASYDEPRPKQLVSPP-EGEVH  176

Query  611  SMTVIEPQYTMS  646
            + T++ P++T+S
Sbjct  177  AWTLVSPRFTLS  188



>emb|CCX31232.1| Similar to Probable vacuolar protein sorting-associated protein 
16 homolog; acc. no. Q9UT38 [Pyronema omphalodes CBS 100304]
Length=833

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 98/194 (51%), Gaps = 8/194 (4%)
 Frame = +2

Query  83   STVSVAAEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            S VS  A+W+ L +R+YRK  LY ++     DL   ++A +PF G IA+ ++D  + +  
Sbjct  3    SAVSATADWEQLEDRFYRKILLYSELFGPDYDLNDYQIAGAPFSGAIALYKNDDVLQEFR  62

Query  260  AESALRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
            + +A  K  + I++SAG  I    +    G + G+ W++D+ L+ I +DGTV  Y     
Sbjct  63   SGAAQTKPSIEIYSSAGKLIRRIAYDK--GPIRGLGWSEDEKLLVIAEDGTVRCYSDLQG  120

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPG--LEDFP  607
                 SLG       V +  FW  G V +    ++  +  +  P P  LADP   +ED  
Sbjct  121  DFTQFSLGHGVEMVRVKEVRFWSTGFVALLRTNRLVAVSRYDEPRPKYLADPSPYIEDAV  180

Query  608  L-SMTVIEPQYTMS  646
            + S  +I P YT+S
Sbjct  181  IHSWAIIPPAYTLS  194



>ref|XP_001215326.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU33909.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=810

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ L + +YRK  +Y   + + V+L    VA +P+GG +A+ RD++K  + 
Sbjct  1    MAPSNPLANWERLGDSFYRKVSIYDAVFDQDVELENYIVAGAPYGGALALHRDESKPYRF  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
              A++A   + I++ +G  I     ++  G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTARSSIDIYSCSGKHINRIQCEH--GAIRGLGWSDKEELLLITEDGTVRRYFGLHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
               S SLG     + V  C FW+ G V +    Q+  + ++  P P KL  P  E    S
Sbjct  119  DFTSFSLGNGAEEYGVRACRFWNAGFVALLSNNQLIAVSNYDEPRP-KLLAPCPEGEVSS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>ref|XP_009260076.1| hypothetical protein FPSE_08683 [Fusarium pseudograminearum CS3096]
 gb|EKJ71177.1| hypothetical protein FPSE_08683 [Fusarium pseudograminearum CS3096]
Length=827

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 101/191 (53%), Gaps = 6/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHPRADWESVGDRWFRKTQQYTAVFDQDLDLDNYVVAGAPYAGALALWRDDTKLLAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DG V  YD++ E
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTADGNVRCYDLQGE  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA     +   +
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNTLITVSSYTEPRPKALAQTPEGEIN-A  176

Query  614  MTVIEPQYTMS  646
             ++I P +T+S
Sbjct  177  WSIISPTHTLS  187



>gb|KFZ05975.1| hypothetical protein V501_07859 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=1847

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 99/200 (50%), Gaps = 5/200 (3%)
 Frame = +2

Query  53   GAPSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVI  229
            G  + N   ++ ++  A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ 
Sbjct  38   GKDNQNEADIARMNPTADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALY  97

Query  230  RDDAKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGT  406
            RD+ K+       A +  + +++ +G  I    W    G + G+ W++D+ L+ +TQDGT
Sbjct  98   RDETKLHTFRGSQASKSSIDVYSCSGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGT  155

Query  407  VYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD  586
            V  Y          SLG       VV C F+  G V +     +  +  ++ P P  LA 
Sbjct  156  VRCYYNLQGDFSQFSLGHGAEEFGVVACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAV  215

Query  587  PGLEDFPLSMTVIEPQYTMS  646
            P  +    S T++ P YT+S
Sbjct  216  P-PDGVVHSWTLVPPAYTLS  234



>ref|XP_009537636.1| hypothetical protein PHYSODRAFT_530775 [Phytophthora sojae]
 gb|EGZ06872.1| hypothetical protein PHYSODRAFT_530775 [Phytophthora sojae]
Length=1914

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 101/206 (49%), Gaps = 12/206 (6%)
 Frame = +2

Query  65    SNNLR-MSTVSVAAEWQLLYNRYYRKPELYQMQWKH---VDLTRNKVACSPFGGPIAVIR  232
             S  LR ++  ++  EW  L    Y K  +Y M W      DL     AC+P+GGP+A++R
Sbjct  1033  SRGLRHLAPTAMETEWHTLGKVQYHKWAVYGMTWAAEGVTDLRDFVAACAPYGGPVALLR  1092

Query  233   DDAKIVQLYAESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQD  400
             D  K+V++ +++ L R+L +FN+ G ++ +  W   ++    LVGM+WTD+  L+C+   
Sbjct  1093  DPKKLVKVASDAPLARQLLLFNACGRKLGQVDWAPFEDARETLVGMTWTDELRLLCVFAS  1152

Query  401   GTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPI  574
             G+   + +  +     SL        V     W  G+V + E   +  + D  +  P   
Sbjct  1153  GSCVAFSMAGDEETRFSLLPPGSKDKVATFEAWGGGLVALTEKMALVQVLDVDSVRPKVS  1212

Query  575   KLADPGLEDF--PLSMTVIEPQYTMS  646
              L D GL D   P  M V+EP++  S
Sbjct  1213  LLPDCGLSDANPPTCMAVLEPKFLKS  1238



>ref|XP_007750426.1| hypothetical protein A1O5_11664 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ63343.1| hypothetical protein A1O5_11664 [Cladophialophora psammophila 
CBS 110553]
Length=830

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ + +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KI + 
Sbjct  1    MTANNPRAGWEKVGDQFYRKVPLYESIFDQDLELENYLVAGAPYGGALALWRDTTKIARY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISTINWEK--GVIRGLGWSDDEKLLVVTEDGTVHCYFELHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +  SLG       VV C FW +G V +     +  +  F+ P P  LA    E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNSLIAVSSFEEPRPRLLAQ-APEGEVHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPVYTLS  188



>gb|KFY80059.1| hypothetical protein V499_01034 [Pseudogymnoascus pannorum VKM 
F-103]
Length=1834

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 99/200 (50%), Gaps = 5/200 (3%)
 Frame = +2

Query  53   GAPSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVI  229
            G  + N   ++ ++  A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ 
Sbjct  38   GKDNQNEADVARMNPTADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALY  97

Query  230  RDDAKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGT  406
            RD+ K+       A +  + +++ +G  I    W    G + G+ W++D+ L+ +TQDGT
Sbjct  98   RDETKLHTFRGSQASKSSIDVYSCSGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGT  155

Query  407  VYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD  586
            V  Y          SLG       VV C F+  G V +     +  +  ++ P P  LA 
Sbjct  156  VRCYYNLQGDFSQFSLGHGAEEFGVVACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAV  215

Query  587  PGLEDFPLSMTVIEPQYTMS  646
            P  +    S T++ P YT+S
Sbjct  216  P-PDGVVHSWTLVPPAYTLS  234



>emb|CCA23589.1| vacuolar protein sortingassociated protein putative [Albugo laibachii 
Nc14]
Length=890

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 85/172 (49%), Gaps = 15/172 (9%)
 Frame = +2

Query  98   AAEWQLLYNRYYRKPELY-QMQWKHV----DLTRNKVACSPFGGPIAVIRDDAKIVQLYA  262
            +AEW  L    Y+K  +Y +++W+      D+    VA   +GGP+A++RD+ KI +   
Sbjct  3    SAEWHTLGKVQYQKWSMYDELEWQQEEEVHDIRSFTVAVCLYGGPVALLRDNTKIHKASK  62

Query  263  ESALRKLRIFNSAGVQIAETVW---------KNPGGRLVGMSWTDDQTLICITQDGTVYR  415
             S  R L  F +AG ++++  W         KNP   L+ M+WTDD  L+C+ +DGT   
Sbjct  63   GSFQRTLMTFTAAGRKLSQVSWEPYETREKEKNPNS-LISMNWTDDVRLLCVFEDGTCRT  121

Query  416  YDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNP  571
            + +  E     S+        +V C  W NG+V + E FQ+  + D     P
Sbjct  122  FSVMGELEAQFSILSSSSDDKIVTCEPWINGIVALTEHFQLIQVSDIDAVRP  173



>ref|XP_001274640.1| vacuolar protein sorting vps16, putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW13214.1| vacuolar protein sorting vps16, putative [Aspergillus clavatus 
NRRL 1]
Length=829

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 95/184 (52%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESAL  274
            A W+ L + +YRK  +Y   + + VDL    VA +P+GG IA+ RD++K  +   A +A 
Sbjct  8    ANWERLGDSFYRKVTVYDAIFDEDVDLDNYIVAGAPYGGAIALHRDESKPYRFRDAHTAR  67

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + I++ +G  I    W++  G + G+ W+D + L+ IT+DGTV RY        S SL
Sbjct  68   SSIDIYSCSGKPINRINWEH--GTIRGLGWSDKEELLVITEDGTVRRYFGLYGDFTSFSL  125

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G     + V  C FW  G V +    Q+  + ++  P P KL     E    S ++I P 
Sbjct  126  GNGAEEYGVRACKFWTYGFVALLANNQLIAVSNYDEPRP-KLLARCPEGEVSSWSLIPPP  184

Query  635  YTMS  646
            YT+S
Sbjct  185  YTLS  188



>gb|KIK56666.1| hypothetical protein GYMLUDRAFT_230051 [Gymnopus luxurians FD-317 
M1]
Length=846

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 100/185 (54%), Gaps = 8/185 (4%)
 Frame = +2

Query  107  WQLLYN--RYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES---A  271
            WQ + N   +YR+ +LY +  K  DL    +A   +GGP+A++RD+ K+V +   +   A
Sbjct  9    WQAMQNGSAFYRRQQLYSILGKFPDLGDYIIAGCRYGGPLALMRDNTKLVAVGRATPAFA  68

Query  272  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  451
              ++++++SAG  +    W+    R++   WT D+ L+ + ++G    YD++ +  +  S
Sbjct  69   KSQIQVYSSAGEGLLLFSWEQ--SRIIRFGWTVDEKLVVLNEEGVYRVYDLQGD-YQQYS  125

Query  452  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  631
            LG +     V+D   + NG+V +  +  +  +  ++   P+ LA+P + D P+S T+I P
Sbjct  126  LGSEASEMGVIDARIYENGLVALIGSLALLEVKGWEGARPMTLANPNITDPPVSWTIIPP  185

Query  632  QYTMS  646
               +S
Sbjct  186  DANVS  190



>ref|XP_004523432.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Ceratitis capitata]
Length=841

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 84/153 (55%), Gaps = 8/153 (5%)
 Frame = +2

Query  98   AAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  274
              +W +L    YRK +L+   W   VDL   +V  +PFGGPIA+ RD  +IV +   S  
Sbjct  7    TGDWFILRPDTYRKLDLFTPDWPLDVDLEYMQVVAAPFGGPIAMTRDPKQIVPIKG-SVK  65

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              +RIF++AGV++ + +W +  G+L+ M W+D + LIC+  D  V+ YD+     ES S+
Sbjct  66   PMIRIFDTAGVELGKILWNH--GKLISMGWSDLEELICVQDDALVFVYDMFGNEKESYSM  123

Query  455  GKDCFTHSVVDCVFWHN----GVVCINEAFQVF  541
            G++     VVD   + +    GV  +    +VF
Sbjct  124  GQEASLTKVVDAKIFQSTSGTGVSVLTTTGRVF  156



>gb|KIW90849.1| hypothetical protein Z519_08632 [Cladophialophora bantiana CBS 
173.52]
Length=830

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 101/191 (53%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A W+ + +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KIV+ 
Sbjct  1    MTANNPRAGWEKVGDQFYRKVPLYESIFDQDLELENYLVAGAPYGGALALWRDTTKIVRY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T++GTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNINWEK--GVIRGLGWSDDEKLLVVTEEGTVHCYFELHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +  SLG       VV C FW +G V +     +  +  F+ P P  LA    E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNSLVAVSSFEEPRPRLLAQVP-EGEVHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>emb|CDX91426.1| BnaC04g07240D [Brassica napus]
Length=71

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 52/87 (60%), Gaps = 30/87 (34%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  259
            M+ VSVAAEWQLLYNRYYRKPE+YQM WKHVDL+ N                        
Sbjct  1    MAIVSVAAEWQLLYNRYYRKPEIYQMGWKHVDLSCN------------------------  36

Query  260  AESALRKLRIFNSAGVQIAETVWKNPG  340
                  KLRIFNSAGV ++ETV K+PG
Sbjct  37   ------KLRIFNSAGVLLSETVSKHPG  57



>gb|KDR24089.1| Vacuolar protein sorting-associated protein 16-like protein [Zootermopsis 
nevadensis]
Length=834

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 103/186 (55%), Gaps = 14/186 (8%)
 Frame = +2

Query  95   VAAEW-QLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES  268
            + A+W  L  + Y+RK E+Y M W++ +++    VA +P+GGP+AVIRD  K V++    
Sbjct  5    LTADWCPLGRDTYFRKFEIYSMSWQNEINMENVSVAVAPYGGPVAVIRDRKKFVKV---Q  61

Query  269  ALRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE  442
             + K  + I++++G  I+  VW +  G+++ + W+  + L+C+  DG+V  YD+      
Sbjct  62   GIGKPVISIYSASGKNISSIVWTS--GQIIQLGWSSTEDLLCVQDDGSVLIYDMFGTYQH  119

Query  443  SLSLGKDCFTHSVVDCVFWHN----GVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFP  607
            + S+G++     +++   + N    GV  +  ++++F +   K P   +LA+ P L   P
Sbjct  120  TFSMGQEAKDTKIIEAKIFANLNGTGVAVLTSSYRIFLVNSVKEPKVRRLAEVPSLNVPP  179

Query  608  LSMTVI  625
             S  +I
Sbjct  180  SSWAII  185



>gb|EYE92957.1| vacuolar protein sorting-associated protein 16 [Aspergillus ruber 
CBS 135680]
Length=829

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 97/182 (53%), Gaps = 5/182 (3%)
 Frame = +2

Query  107  WQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESALRK  280
            W+ + + +YRK  +Y   + + V+L    VA +P+GG IA+ RD++K+ +   A++    
Sbjct  10   WERVGDSFYRKVPVYDAIFDEDVELENYIVAGAPYGGAIALYRDESKLYRFQGAQTTKSS  69

Query  281  LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGK  460
            + I++ +G  I    W+   G + G+ W+D + L+ +++DGTV RY        S SLG 
Sbjct  70   IDIYSCSGKHINRINWEY--GSIRGLGWSDKEELLVVSEDGTVRRYFGLFGDFTSFSLGN  127

Query  461  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  640
                + V  C FW +G V +    Q+  + +++ P P  LA P  E    S ++I P YT
Sbjct  128  GTEEYGVRACRFWTSGFVALLSNNQLVAVSNYEEPRPRPLA-PCPEGEVSSWSLIPPAYT  186

Query  641  MS  646
            +S
Sbjct  187  LS  188



>gb|KFY11799.1| hypothetical protein V492_04262 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=821

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 92/184 (50%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+ K+       A +
Sbjct  5    ADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYRDETKLHTFRGSQASK  64

Query  278  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGKLIRRVNWDK--GSIKGLGWSEDEKLLVVTQDGTVRCYYNLQGDFSQFSL  122

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G       V+ C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  635  YTMS  646
            YT+S
Sbjct  182  YTLS  185



>gb|KFY39836.1| hypothetical protein V494_03792 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=821

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 92/184 (50%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+ K+       A +
Sbjct  5    ADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYRDETKLHTFRGSQASK  64

Query  278  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGKLIRRVNWDK--GSIKGLGWSEDEKLLVVTQDGTVRCYYNLQGDFSQFSL  122

Query  455  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  634
            G       V+ C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  635  YTMS  646
            YT+S
Sbjct  182  YTLS  185



>gb|KIW59851.1| hypothetical protein PV05_00117 [Exophiala xenobiotica]
Length=830

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M++ +  A W+ + +++Y+K +LY+  +   ++L    VA +P+GG +A+ RD +K+ + 
Sbjct  1    MTSNNPRAGWEKIGDQFYQKVQLYESVFDADLELENYFVAGAPYGGALALWRDTSKVARY  60

Query  257  -YAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DG V+ Y     
Sbjct  61   RTGQSTKSTIDIYSSSGKLISNINWEK--GLIKGLGWSDDEKLLVVTEDGVVHCYFGLHG  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
              +   LG     + VV C FW  G V +     +  +  F  P P  LA P  E    S
Sbjct  119  DFQPFLLGHGAEEYGVVSCRFWSQGFVALLGNNTLIAVSSFNEPRPRVLAQPP-EGEVHS  177

Query  614  MTVIEPQYTMS  646
             ++I P YT+S
Sbjct  178  WSLIPPAYTLS  188



>gb|KIJ36797.1| hypothetical protein M422DRAFT_179088, partial [Sphaerobolus 
stellatus SS14]
Length=643

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 96/176 (55%), Gaps = 8/176 (5%)
 Frame = +2

Query  128  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL-YAESALRK--LRIFNS  298
            +YRK  +YQMQW+++D++   VA + +GGP+A++RD  K++ L     A+ K  +R+++S
Sbjct  20   FYRKHSVYQMQWQYLDVSDYIVAGARYGGPLAMMRDTNKLIALGRGVPAISKSEIRVYSS  79

Query  299  AGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHS  478
             G    E +      +++   WT D+ L  + ++G    YD++ +  +  SLG +     
Sbjct  80   VG----EGLLLFTVRKIIRFGWTYDERLAVLNEEGVYRIYDLQGD-YQQFSLGPEAAETG  134

Query  479  VVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
            ++D     NG++ +  +  +  +  ++   P+ LA PG+ + P S  +I P  T+S
Sbjct  135  IIDARIHENGMIALTGSMSLLEVKGWEGGKPLVLASPGISEPPASWAIIPPDQTIS  190



>ref|XP_010762126.1| hypothetical protein PADG_06891 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH50812.2| hypothetical protein PADG_06891 [Paracoccidioides brasiliensis 
Pb18]
Length=830

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 101/192 (53%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A+W+ + +R+YRK  +Y   + + ++L    VA +P+GG IA+ RD+ K+ Q 
Sbjct  1    MAPTNPLADWEKVGDRFYRKIRVYDAVFDEDLELENFIVAGAPYGGSIALYRDENKL-QR  59

Query  257  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  430
            Y  AE+    + I++ +G +I+    ++   R  G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETGKSYIDIYSCSGQRISRINGEHAAIR--GLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
                  SLG     + V  C FW +G V +    Q+  +  +  P P  LA P   +   
Sbjct  118  GDFTPFSLGTTAEENGVKACRFWSDGFVALLYNNQLIAVSRYDEPRPKLLASPPAGEVS-  176

Query  611  SMTVIEPQYTMS  646
            S ++I P YT+S
Sbjct  177  SWSLIPPNYTLS  188



>ref|XP_003712813.1| vacuolar protein sorting-associated protein [Magnaporthe oryzae 
70-15]
 gb|EHA53006.1| vacuolar protein sorting-associated protein [Magnaporthe oryzae 
70-15]
 gb|ELQ35378.1| vacuolar protein sorting-associated protein [Magnaporthe oryzae 
Y34]
 gb|ELQ63175.1| vacuolar protein sorting-associated protein [Magnaporthe oryzae 
P131]
Length=829

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 96/188 (51%), Gaps = 5/188 (3%)
 Frame = +2

Query  89   VSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  265
            +S  A W+ + ++YYRK +LY   +   +DL    VA +P GG +A+  D+ K+V+  A 
Sbjct  3    LSPTAGWEQVGDKYYRKVQLYTEVFDLDLDLDNYVVAGAPDGGAVALYLDENKLVEYRAG  62

Query  266  SALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE  442
             A +  + I++ AG  I    W    G + G+ W++D+ L+ +T+DGTV  Y    E   
Sbjct  63   KARKPSIDIYSCAGKLIRSINWDK--GSIRGLGWSEDEKLLVVTKDGTVRCYYGLQEDFT  120

Query  443  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  622
              SLG     + V  C F+  G+V +     +  +  ++ P P  L  P  E    S T+
Sbjct  121  QFSLGHGAEEYGVHSCRFYETGMVALLTNNTLVTVSSYEEPRPKPLVSPP-EGEVHSWTI  179

Query  623  IEPQYTMS  646
            I P+YT+S
Sbjct  180  IAPRYTLS  187



>gb|KIJ15884.1| hypothetical protein PAXINDRAFT_168867 [Paxillus involutus ATCC 
200175]
Length=841

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 100/187 (53%), Gaps = 8/187 (4%)
 Frame = +2

Query  101  AEWQLL--YNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESA  271
            A W+ +   N +YR+ +LY +  K  DL    +A    GGPIA++RD +KI+ +  A  A
Sbjct  10   ATWEAMPDGNVFYRRLQLYSIPGKLPDLNDFVIAGCRNGGPIALMRDSSKIITVGGAGHA  69

Query  272  LRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLES  445
              K  +++++ AG  +    W    G+++   WT D+ L+ + ++G    YD++++  + 
Sbjct  70   FSKSQIQVYSPAGEGLLLLSWDQ--GKIIRFGWTADERLVVLNEEGVYRLYDLQSD-YQQ  126

Query  446  LSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVI  625
             SLG +     +VD     NG+V ++ +  +  + D++   P+ LA+PGL + P S  VI
Sbjct  127  YSLGSEAAEMGIVDARIHENGLVALSGSLSLLEVKDWEGSRPLTLANPGLSEPPHSWAVI  186

Query  626  EPQYTMS  646
             P   +S
Sbjct  187  PPDQNIS  193



>ref|XP_001832533.2| vacuolar protein sorting 16 isoform 1 [Coprinopsis cinerea okayama7#130]
 gb|EAU89282.2| vacuolar protein sorting 16 isoform 1 [Coprinopsis cinerea okayama7#130]
Length=847

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 94/178 (53%), Gaps = 6/178 (3%)
 Frame = +2

Query  122  NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIV---QLYAESALRKLRIF  292
            N +YR+ +LY +  K  DL    VA   +GGP+A++RD  K++   QL       +++++
Sbjct  16   NTFYRRQQLYSIPGKLPDLGDYIVAGCQYGGPLAIMRDTTKLLAIGQLTPAITKPQIQVY  75

Query  293  NSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFT  472
            ++AG  +    W    GR+V   WT D+ L+ + ++G    YD++ E  +  SLG D   
Sbjct  76   SAAGEGLLLLSWDQ--GRIVKFGWTLDERLVVLNEEGVYRIYDLQGEYTQH-SLGPDASE  132

Query  473  HSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
              V+D     NG+V +  +  +  +  ++   P+ LA+PG+ + P + ++I P   +S
Sbjct  133  TGVIDARIHGNGLVALTSSLSLLEVKGWEGGRPLTLANPGMTEPPHAWSIIPPDLNIS  190



>ref|XP_006606806.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Glycine 
max]
Length=472

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = +2

Query  395  QDGTVYRYDIRAEPLE-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNP  571
             D  VYRY++ A  +E +LSLGK CF  +V DC FW N +VCI +A Q+F I DF+NP+ 
Sbjct  356  HDDIVYRYNVHANLIEPNLSLGKGCFEDNVADCAFWGNSLVCITKANQLFYIVDFRNPSA  415

Query  572  IKLADPGLEDFPLSMTVIEPQYTM  643
            +KL DP +E+ P   T+I+ QYT+
Sbjct  416  MKLLDPKIEEMPHYTTMIKLQYTL  439



>gb|EEH15770.1| hypothetical protein PABG_05857 [Paracoccidioides brasiliensis 
Pb03]
Length=830

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 101/192 (53%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M+  +  A+W+ + +R+YRK  +Y   + + ++L    VA +P+GG IA+ RD+ K+ Q 
Sbjct  1    MAPTNPLADWEKVGDRFYRKIRVYDAVFDEDLELENFIVAGAPYGGSIALYRDENKL-QR  59

Query  257  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  430
            Y  AE+    + I++ +G +I+    ++   R  G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETGKSYIDIYSCSGQRISRINGEHAAIR--GLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
                  SLG     + V  C FW +G V +    Q+  +  +  P P  LA P   +   
Sbjct  118  GDFTPFSLGTAAEENGVKACRFWSDGFVALLYNNQLIAVSRYDEPRPKLLASPPAGEVS-  176

Query  611  SMTVIEPQYTMS  646
            S ++I P YT+S
Sbjct  177  SWSLIPPNYTLS  188



>gb|KEY69049.1| hypothetical protein S7711_03347 [Stachybotrys chartarum IBT 
7711]
 gb|KFA52785.1| hypothetical protein S40293_00890 [Stachybotrys chartarum IBT 
40293]
Length=827

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 99/191 (52%), Gaps = 6/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   AEW+ + N+++RK +LY   + + +DL    VA +P+ G IA+ RDD+K+   
Sbjct  1    MDTLHPRAEWESVGNKWFRKTQLYTAVFDQDLDLDSYIVAGAPYAGAIALWRDDSKLHAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                S+   + I++ AG ++    W    G + G+ WT+++TL+ +T DG V  YD++ +
Sbjct  61   QPGRSSKPSIDIYSLAGKRLQSISWDK--GPIKGLGWTEEETLVVVTADGNVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
                 SLG       V  C F++ G+V +     +  +  +  P P +LA    E    S
Sbjct  119  -FSHFSLGHGADNFGVESCRFYNQGMVALLGNNSLITVNSYAEPRPKQLASTP-EGQVHS  176

Query  614  MTVIEPQYTMS  646
              +I P YT+S
Sbjct  177  WGIIPPYYTLS  187



>emb|CEJ82684.1| Putative Vacuolar sorting protein [Torrubiella hemipterigena]
Length=827

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 103/191 (54%), Gaps = 6/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   A+W+ + ++++RK +LY   + + +DL    +A +P+GG IA+ RD+ K+   
Sbjct  1    MDTLHAKADWERVGDKWFRKTQLYTEVFDQDLDLDTYIIAGAPYGGAIALWRDETKLQAY  60

Query  257  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
             A  +L+  + I++ AG ++    W    G + G+ W+DD+TL+ +  +G V  YD++ +
Sbjct  61   QAGKSLKPTVDIYSLAGKKLLSVQWDK--GPVKGLGWSDDETLLIVAANGEVSCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
               + SLG     + V  C F ++G+V +        +  +  P P  LA P   +   +
Sbjct  119  -FSTFSLGHGADNYGVESCAFHNDGMVALLGNNTFIAVSSYIEPRPAALATPPSGEIQ-A  176

Query  614  MTVIEPQYTMS  646
             +++ P++T+S
Sbjct  177  WSIMPPEHTLS  187



>gb|KFA65450.1| hypothetical protein S40285_00515 [Stachybotrys chlorohalonata 
IBT 40285]
Length=827

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 99/191 (52%), Gaps = 6/191 (3%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M T+   AEW+ + N+++RK +LY   + + +DL    VA +P+ G IA+ RDD+K+   
Sbjct  1    MDTLHPRAEWESVGNKWFRKTQLYTAVFDQDLDLDSYIVAGAPYAGAIALWRDDSKLHAY  60

Query  257  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  433
                S+   + I++ AG ++    W    G + G+ WT+++TL+ +T DG V  YD++ +
Sbjct  61   QPGRSSKPSIDIYSLAGKRLQSISWDK--GPIKGLGWTEEETLVVVTADGNVRCYDLQGD  118

Query  434  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  613
                 SLG       V  C F++ G+V +     +  +  +  P P +LA    E    S
Sbjct  119  -FSHFSLGHGADNFGVESCRFYNQGMVALLGNNSLITVNSYAEPRPKQLASTP-EGQVHS  176

Query  614  MTVIEPQYTMS  646
              +I P YT+S
Sbjct  177  WGIIPPYYTLS  187



>gb|EFX68012.1| hypothetical protein DAPPUDRAFT_63503 [Daphnia pulex]
Length=842

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 95/187 (51%), Gaps = 10/187 (5%)
 Frame = +2

Query  95   VAAEWQ-LLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES  268
            + A+W  L    YYRK E+Y M+W   ++L   KV+ +P GGPIAV+RD+ K   +   S
Sbjct  4    LTADWNPLGREAYYRKFEIYSMEWVDQINLQELKVSVAPSGGPIAVVRDETKFTPVQT-S  62

Query  269  ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESL  448
                + IF+ +G   +   W   GG+++G+ W+  + L+CI  DG+V  YD+      S 
Sbjct  63   GKPIIFIFSPSGELKSTIKWS--GGKVIGLDWSASEELLCIQDDGSVSIYDVFGTYQNSF  120

Query  449  SLGKDCFTHSVVDCVFWH----NGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLS  613
             +G++     ++D   +      G+V +   F+ F + + K+P   +  D PG+   P  
Sbjct  121  QMGQEAKEMKIIDARKFSTTSGTGLVVLTTNFRFFVVNNIKDPRIRRFPDIPGVNIAPSC  180

Query  614  MTVIEPQ  634
             T I  +
Sbjct  181  WTAIHGE  187



>ref|XP_009052918.1| hypothetical protein LOTGIDRAFT_115951 [Lottia gigantea]
 gb|ESO96565.1| hypothetical protein LOTGIDRAFT_115951 [Lottia gigantea]
Length=827

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 97/181 (54%), Gaps = 9/181 (5%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  277
            A+W  L + YYR  ELYQM+W   +DL    +A +P+GGP+ +++D+ K  ++   +   
Sbjct  4    ADWNPLGDVYYRNVELYQMEWNGLIDLNHFMIAAAPYGGPVVLMKDEKKAGRVVT-NVKP  62

Query  278  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  457
             + ++N+AG  +++  W +  G +V + W++ + L+CI  +G +  YDI      +  +G
Sbjct  63   VISVYNAAGKLLSQHRWNS--GTVVHLGWSNTEELLCIQDNGVILVYDIALNFKRTFGMG  120

Query  458  KDCFTHSVVD----CVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTV  622
             +     ++D      F   G+  +  +F+++ + +  +P   KLA+ P L   P S T+
Sbjct  121  TEAKDVKILDWKIFSSFQGTGIAVMTTSFRIYIVNNVDDPRVRKLAEVPDLNSVPSSWTI  180

Query  623  I  625
            +
Sbjct  181  L  181



>gb|KIM91586.1| hypothetical protein PILCRDRAFT_133551 [Piloderma croceum F 1598]
Length=845

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 97/186 (52%), Gaps = 7/186 (4%)
 Frame = +2

Query  101  AEWQLLY--NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  274
            A W+ +   N +YR+ +LY    K   L    VA   +GGP+A++RD +K++ L   + +
Sbjct  11   ASWEAMQDGNVFYRRQQLYSTHGKLPKLEDYIVAGCRYGGPLALMRDTSKLIALGRSAPV  70

Query  275  RK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESL  448
             K  +++++  G  +    W +  G ++   WT D+ L+ + ++G    YD++ +  +  
Sbjct  71   VKNEIKVYSPGGEGLIWFAWDS--GNIIRFGWTMDERLVVLNEEGVYRVYDLQGD-YQQH  127

Query  449  SLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIE  628
            SLG +     VVD     NG+V +  +  +  + D++   P+ LA+PGL + P S  VI 
Sbjct  128  SLGTEAGELGVVDARIHENGLVALTGSLTLLEVKDWEGGRPLTLANPGLTEPPHSWAVIP  187

Query  629  PQYTMS  646
            P  T+S
Sbjct  188  PDMTIS  193



>ref|XP_007785089.1| hypothetical protein W97_09035 [Coniosporium apollinis CBS 100218]
 gb|EON69772.1| hypothetical protein W97_09035 [Coniosporium apollinis CBS 100218]
Length=835

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 98/186 (53%), Gaps = 9/186 (5%)
 Frame = +2

Query  101  AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESA  271
            A+W+ +  R+YRK +LY   + + ++L    VA +P+ G +A+ RD+ K V  Y  A +A
Sbjct  6    ADWEKVGTRFYRKVQLYTAVFDQDLELENYLVAGAPYSGALALHRDEEK-VHAYRGARAA  64

Query  272  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRAEPLESL  448
               + +++ AG  I    W+   G + G+ W++D+ L+ +T+DGTV   YD++ +     
Sbjct  65   KPSIDVYSCAGKLIRRINWEK--GSIKGLGWSEDEKLLVVTEDGTVRCYYDLQGD-FVPF  121

Query  449  SLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIE  628
            +LG     H V  C FW NG V +     +  +  +  P P  LA P  E    S T+I 
Sbjct  122  TLGHGAEEHGVKACRFWSNGFVALLNNNHLISVARYDEPRPKLLAIPP-EGEIHSWTLIP  180

Query  629  PQYTMS  646
            P YT+S
Sbjct  181  PAYTLS  186



>emb|CEL57340.1| Vacuolar protein sorting-associated protein 16 homolog OS=Dictyostelium 
discoideum GN=vps16 PE=3 SV=2 [Rhizoctonia solani 
AG-1 IB]
Length=734

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 91/176 (52%), Gaps = 6/176 (3%)
 Frame = +2

Query  128  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAG  304
            +Y   E+YQM W+  DLT   +A + +GGP+A++RD +K+V L   S  + ++ I++SAG
Sbjct  20   FYSTREVYQMMWQLNDLTDFIIAGARYGGPLALMRDTSKLVALGRHSVSKPQIIIYSSAG  79

Query  305  VQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVV  484
              I    W    G++V M WT D+ L+ + ++GT   +D+     +  SLG D     + 
Sbjct  80   NLINTIPWDQ--GKVVSMGWTHDERLVALNEEGTYRIHDLSGAYTQH-SLGTDAADIGIQ  136

Query  485  DCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLA--DPGLEDFPLSMTVIEPQYTMS  646
            D     +G+V +        +  +    P+ LA  DP L+  P   +++ P  T+S
Sbjct  137  DARIHEHGLVALTNQLTFLEVKAWTGTKPLALALPDPSLDGAPHGWSIVPPDATIS  192



>ref|XP_011212493.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bactrocera dorsalis]
Length=841

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 85/153 (56%), Gaps = 8/153 (5%)
 Frame = +2

Query  98   AAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  274
              +W  L    YRK +L+   W   VDL   +V  +PFGGP+A+IRD  +IV +   S  
Sbjct  7    TGDWFSLRPDTYRKLDLFTPDWPLDVDLEYMEVVGAPFGGPLAMIRDPKQIVPIKG-SVK  65

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              +RIFN+AGV++ + VW +  G+++ M W+D + LIC+  D  V+ +D+  +  ES S+
Sbjct  66   PMIRIFNTAGVELGKIVWNH--GKIIKMGWSDVEELICVQDDALVFIFDMFGKEKESYSM  123

Query  455  GKDCFTHSVVDCVFWHN----GVVCINEAFQVF  541
            G++     +VD   + +    GV  +    ++F
Sbjct  124  GQEASLTKIVDAKIFQSTSGTGVAVLTTTGRIF  156



>gb|KIO05251.1| hypothetical protein M404DRAFT_141113 [Pisolithus tinctorius 
Marx 270]
Length=841

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 96/178 (54%), Gaps = 6/178 (3%)
 Frame = +2

Query  122  NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY---AESALRKLRIF  292
            N +YR+ +LY +  K  +L    +A    GGP+A++RD +K+V +    + S+  +++++
Sbjct  19   NVFYRRLQLYSIPGKLPNLNDYVIAGCRNGGPVALMRDPSKLVAIGRAGSASSRSQIQVY  78

Query  293  NSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFT  472
            + AG  I    W    G++V   WT D+ L+ + ++GT   YD++ E L+  SLG +   
Sbjct  79   SPAGEGILLFSWDQ--GKIVRFGWTSDERLVVLNEEGTYRLYDLQGEYLQ-FSLGTEAAE  135

Query  473  HSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
              ++D     NG+V ++ +  +  + D+    P+ LA PG+ + P +  VI P   +S
Sbjct  136  IGIIDARIHENGLVALSGSLTLLEVKDWGGARPLTLASPGVTEPPHAWAVIPPDQNIS  193



>gb|KIK24542.1| hypothetical protein PISMIDRAFT_645755 [Pisolithus microcarpus 
441]
Length=841

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 93/178 (52%), Gaps = 6/178 (3%)
 Frame = +2

Query  122  NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY---AESALRKLRIF  292
            N +YR+ +LY +  K  +L    VA    GGPIA++RD +K+V +      S+  +++++
Sbjct  19   NVFYRRLQLYSIAGKIPNLNDYVVAGCRNGGPIALMRDPSKLVAIGRAGPASSRSQIQVY  78

Query  293  NSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFT  472
            + AG  I    W    GR+V   WT D+ L  + ++GT   YD++ E  +  SLG +   
Sbjct  79   SPAGEGILLFNWDQ--GRIVRFGWTYDERLAVLNEEGTYRLYDLQGE-YQQFSLGTEAAE  135

Query  473  HSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
              ++D     NG V ++ +  +  + D+    P+ LA+PGL + P +  VI P   +S
Sbjct  136  MGIIDARIHENGFVALSGSLALLEVKDWGGGRPLTLANPGLSEPPHAWAVIPPDQNIS  193



>emb|CCO31224.1| putative vacuolar protein sorting-associated protein 16 homolog 
[Rhizoctonia solani AG-1 IB]
Length=818

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 91/176 (52%), Gaps = 6/176 (3%)
 Frame = +2

Query  128  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAG  304
            +Y   E+YQM W+  DLT   +A + +GGP+A++RD +K+V L   S  + ++ I++SAG
Sbjct  20   FYSTREVYQMMWQLNDLTDFIIAGARYGGPLALMRDTSKLVALGRHSVSKPQIIIYSSAG  79

Query  305  VQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVV  484
              I    W    G++V M WT D+ L+ + ++GT   +D+     +  SLG D     + 
Sbjct  80   NLINTIPWDQ--GKVVSMGWTHDERLVALNEEGTYRIHDLSGAYTQH-SLGTDAADIGIQ  136

Query  485  DCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLA--DPGLEDFPLSMTVIEPQYTMS  646
            D     +G+V +        +  +    P+ LA  DP L+  P   +++ P  T+S
Sbjct  137  DARIHEHGLVALTNQLTFLEVKAWTGTKPLALALPDPSLDGAPHGWSIVPPDATIS  192



>ref|XP_011191448.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bactrocera cucurbitae]
Length=841

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 84/153 (55%), Gaps = 8/153 (5%)
 Frame = +2

Query  98   AAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  274
              +W  L    YRK +L+   W   VDL   +V  +PFGGP+A+IRD  +IV +   S  
Sbjct  7    TGDWFALRPDTYRKLDLFTPDWPLDVDLEYMQVVGAPFGGPLAMIRDSKQIVPIKG-SVK  65

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              +RIFN+AG+++ + VW +  G+++ M W+D + LIC+  D  V+ +D+     ES S+
Sbjct  66   PMIRIFNTAGMELGKIVWNH--GKIIKMGWSDVEELICVQDDALVFIFDMFGNEKESYSM  123

Query  455  GKDCFTHSVVDCVFWHN----GVVCINEAFQVF  541
            G++     +VD   + +    GV  +    ++F
Sbjct  124  GQEASLTKIVDAKIFQSISGTGVAVLTTTGRIF  156



>ref|XP_009550055.1| hypothetical protein HETIRDRAFT_325388 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW78052.1| hypothetical protein HETIRDRAFT_325388 [Heterobasidion irregulare 
TC 32-1]
Length=846

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 97/185 (52%), Gaps = 8/185 (4%)
 Frame = +2

Query  107  WQLLY--NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL-YAESALR  277
            WQ +   N +Y++ ++Y +  K  +L    +A   +GGP+A++RD+ K+V L     A  
Sbjct  9    WQAMQDGNIFYKRQQVYSINGKLPNLGDFFIAGCRYGGPLALMRDNTKMVALGRGAPAFS  68

Query  278  K--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  451
            K  +++F+ AG  +    W     ++V   WT D+ L  + ++GT   YD++ +  E  S
Sbjct  69   KSQIQVFSPAGDGLLLFSWDQ--SKIVKFGWTADERLAVLNEEGTYRLYDLQGD-YEQYS  125

Query  452  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  631
            LG D     ++D     +G+V +  + Q+  +  ++   P+ L +PGL   P S TVI P
Sbjct  126  LGSDAAEVGIIDAKIHESGMVAMTGSLQLLEVKGWEGVKPLTLNNPGLSQPPFSWTVIPP  185

Query  632  QYTMS  646
             +T+S
Sbjct  186  DFTIS  190



>gb|KDQ19047.1| hypothetical protein BOTBODRAFT_28535 [Botryobasidium botryosum 
FD-172 SS1]
Length=846

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 96/174 (55%), Gaps = 4/174 (2%)
 Frame = +2

Query  128  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAG  304
            +YRK E+Y MQW+  DL+   +A + +GGP A+IR+ +KIV L   +  + ++++F+S+G
Sbjct  20   FYRKVEIYSMQWQLSDLSNFIIAGARYGGPFALIRNTSKIVALDRMAFTKPQIQLFSSSG  79

Query  305  VQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVV  484
              I    W    G+++ M WT D+ L+ + ++G+   YD++ +  +  SLG +     V+
Sbjct  80   DLIQIIPWDQ--GKIIRMGWTFDEELVVLNEEGSYRIYDLQGDHRQ-YSLGSEAQEVGVI  136

Query  485  DCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  646
            D     +G+V +     +  I  ++   P+ LA+  L   P   ++I P  T+S
Sbjct  137  DARIHESGLVAMTGNLGLLEIKGWEGGKPLTLANSTLNAPPHCWSIIPPDQTIS  190



>ref|XP_001229607.1| hypothetical protein CHGG_03091 [Chaetomium globosum CBS 148.51]
 gb|EAQ91156.1| hypothetical protein CHGG_03091 [Chaetomium globosum CBS 148.51]
Length=834

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 7/192 (4%)
 Frame = +2

Query  80   MSTVSVAAEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  256
            M      A W+ L  R+YRK +LY Q+  + +DL    VA +P+GG IA+ RD+ K++  
Sbjct  1    MDVAHPTAGWEQLGERFYRKTQLYTQVFDQDLDLDNYLVAGAPYGGAIALYRDEEKLIAF  60

Query  257  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRA  430
                  +  + I++ AG  I    W    G + G+ W++D+ L+ +T DGTV   YD++ 
Sbjct  61   QPTRPSKPSIDIYSCAGKLIRRINWDQ--GSIKGLGWSEDEKLLVVTADGTVRCYYDLQG  118

Query  431  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  610
            E     SLG       V  C F+ +G+V +     +  +  +  P P  LA P       
Sbjct  119  E-FTQFSLGNGADEAGVKSCRFYAHGLVALLNNNGLISVSSYHEPRPKLLASPP-GGHVH  176

Query  611  SMTVIEPQYTMS  646
            S  +I P YT+S
Sbjct  177  SWNIIPPAYTLS  188



>ref|XP_001996143.1| GH14334 [Drosophila grimshawi]
 gb|EDV90801.1| GH14334 [Drosophila grimshawi]
Length=837

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 89/172 (52%), Gaps = 18/172 (10%)
 Frame = +2

Query  98   AAEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  274
              EW  +   YYRK EL    W + +DL   +V  SP+GGP+AVIRD  K+V +   S  
Sbjct  7    TGEWFKVRPDYYRKVELETPDWPNDLDLEYMQVVASPYGGPLAVIRDTTKLVPVRGTSR-  65

Query  275  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  454
              +RIF+++G +    +W +  G+L+ M W+D + LIC+ ++  V+ YDI  +  ES S+
Sbjct  66   PMIRIFDTSGNETGHILWNH--GKLISMGWSDTEDLICVLENAKVFVYDIFGKEKESYSI  123

Query  455  GKDCFTHSVVDCVFWHN----GVVCINEAFQVFC----------IPDFKNPN  568
            G +     +V+   + +    GV  +  + ++F           +PD  N N
Sbjct  124  GGEASVIKIVEAKVFQSAAGTGVAVMTTSGRIFLKQNSNKTERKLPDIPNSN  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625