BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024K21

Length=673
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADB03784.1|  catalase                                                409   3e-138   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          405   7e-137   Ipomoea batatas [batate]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          365   6e-121   Amborella trichopoda
gb|AIX10947.1|  putative catalase                                       361   1e-119   Gardenia jasminoides
gb|AHF21552.1|  catalase                                                360   4e-119   Hylocereus undatus [dragon fruit]
gb|ACL27272.1|  catalase                                                358   2e-118   Nicotiana benthamiana
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      358   3e-118   Nicotiana sylvestris
emb|CCP37650.1|  catalase-1                                             357   3e-118   Nicotiana tabacum [American tobacco]
gb|AAB71764.1|  catalase 1                                              357   4e-118   Nicotiana tabacum [American tobacco]
gb|AGE15298.2|  catalase 1                                              357   6e-118   Eriobotrya japonica [loquat]
gb|AGC65520.1|  catalase                                                357   6e-118   Eriobotrya japonica [loquat]
ref|NP_001291326.1|  catalase isozyme 1                                 357   7e-118   Sesamum indicum [beniseed]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 357   7e-118   Manihot esculenta [manioc]
dbj|BAC79443.1|  catalase                                               357   8e-118   Acacia ampliceps
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      356   1e-117   Solanum tuberosum [potatoes]
gb|AFU48609.1|  catalase 1                                              356   2e-117   Nicotiana benthamiana
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      353   3e-117   Nelumbo nucifera [Indian lotus]
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             353   3e-117   
ref|NP_001237556.1|  catalase-1/2                                       355   4e-117   Glycine max [soybeans]
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             353   4e-117   
gb|ABM47415.1|  catalase                                                355   5e-117   Prunus avium [gean]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      355   5e-117   Nicotiana tomentosiformis
gb|ABB51561.1|  truncated catalase 2                                    352   6e-117   Avicennia marina
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                354   6e-117   Erythranthe guttata [common monkey flower]
ref|NP_001235974.1|  catalase-3                                         354   6e-117   Glycine max [soybeans]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      354   7e-117   Nelumbo nucifera [Indian lotus]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 354   7e-117   Cucumis melo [Oriental melon]
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     351   9e-117   Eucalyptus grandis [rose gum]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             353   1e-116   Phaseolus vulgaris [French bean]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             353   1e-116   Populus trichocarpa [western balsam poplar]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 353   1e-116   
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 353   2e-116   Eucalyptus grandis [rose gum]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           353   2e-116   
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           353   2e-116   Sesamum indicum [beniseed]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          353   2e-116   Avicennia marina
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              353   2e-116   Cicer arietinum [garbanzo]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         353   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010437527.1|  PREDICTED: catalase-2                              353   2e-116   Camelina sativa [gold-of-pleasure]
gb|KJB17474.1|  hypothetical protein B456_003G002800                    352   2e-116   Gossypium raimondii
emb|CDX72514.1|  BnaC07g45360D                                          352   2e-116   
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         353   2e-116   Camelina sativa [gold-of-pleasure]
ref|NP_195235.1|  catalase 2                                            353   3e-116   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234186.1|  catalase isozyme 2                                 353   3e-116   
gb|AHF27433.1|  catalase                                                353   3e-116   Cucurbita maxima [Boston marrow]
emb|CAA64220.1|  catalase                                               353   3e-116   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96854.1|  catalase                                                353   3e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             353   3e-116   
gb|AAF61734.1|AF243519_1  catalase 4                                    352   3e-116   Helianthus annuus
gb|KEH36313.1|  catalase heme-binding enzyme                            350   3e-116   Medicago truncatula
gb|KJB17473.1|  hypothetical protein B456_003G002800                    352   3e-116   Gossypium raimondii
ref|NP_001031791.1|  catalase 2                                         352   4e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             352   4e-116   
dbj|BAH19523.1|  AT4G35090                                              352   4e-116   Arabidopsis thaliana [mouse-ear cress]
gb|ABF93811.1|  Catalase-1, putative, expressed                         348   4e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002521709.1|  catalase, putative                                 352   4e-116   Ricinus communis
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      352   4e-116   Fragaria vesca subsp. vesca
gb|AAC19397.1|  leaf catalase                                           352   4e-116   Mesembryanthemum crystallinum
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      352   5e-116   Nicotiana tomentosiformis
gb|ACJ71244.1|  catalase 2                                              348   5e-116   Vigna unguiculata
gb|KHG12976.1|  Catalase isozyme 2                                      352   5e-116   Gossypium arboreum [tree cotton]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      352   5e-116   Nicotiana sylvestris
gb|ACJ71245.1|  catalase 2                                              348   5e-116   Vigna unguiculata
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          352   5e-116   Vigna radiata var. radiata [golden gram]
dbj|BAJ33995.1|  unnamed protein product                                352   6e-116   Eutrema halophilum
gb|AAD17935.1|  catalase                                                352   6e-116   Brassica juncea [brown mustard]
gb|ADZ45555.1|  catalase                                                352   6e-116   Vigna radiata [mung bean]
gb|ACA50528.1|  putative catalase 2                                     352   6e-116   Brassica napus [oilseed rape]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               352   6e-116   Gossypium hirsutum [American cotton]
gb|ADZ45556.1|  catalase                                                352   6e-116   Vigna radiata [mung bean]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             352   6e-116   Eutrema salsugineum [saltwater cress]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          352   7e-116   Soldanella alpina
gb|AAD17933.1|  catalase                                                352   7e-116   Brassica juncea [brown mustard]
ref|XP_009138342.1|  PREDICTED: catalase-2                              352   7e-116   Brassica rapa
gb|AAF71742.1|AF248491_1  catalase                                      352   7e-116   Raphanus sativus
ref|XP_007046520.1|  Catalase 2                                         352   7e-116   Theobroma cacao [chocolate]
gb|KFK30147.1|  catalase                                                352   7e-116   Arabis alpina [alpine rockcress]
ref|XP_007018034.1|  Catalase 2                                         352   7e-116   
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              352   7e-116   Populus euphratica
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    352   8e-116   
gb|AFN81243.1|  catalase 1                                              352   8e-116   Brassica rapa subsp. pekinensis [bai cai]
gb|AHF27430.1|  catalase                                                352   8e-116   Cucurbita moschata [ayote]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             352   8e-116   Eutrema salsugineum [saltwater cress]
ref|XP_010530333.1|  PREDICTED: catalase-2                              352   8e-116   Tarenaya hassleriana [spider flower]
ref|NP_001289779.1|  catalase isozyme 1                                 352   8e-116   Nelumbo nucifera [Indian lotus]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      351   9e-116   Eucalyptus grandis [rose gum]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         351   9e-116   Tarenaya hassleriana [spider flower]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      351   1e-115   Cucumis melo [Oriental melon]
gb|ADM96039.1|  catalase                                                351   1e-115   Cucumis sativus [cucumbers]
gb|AAR84577.1|  catalase 1b                                             350   1e-115   Lotus japonicus
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               351   1e-115   Ricinus communis
gb|KJB14250.1|  hypothetical protein B456_002G115900                    351   1e-115   Gossypium raimondii
emb|CDX69111.1|  BnaC01g03420D                                          350   2e-115   
gb|AET97564.1|  catalase                                                350   2e-115   Ziziphus jujuba [Chinese jujube]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               350   2e-115   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AJE26131.1|  catalase                                                350   2e-115   Salix matsudana [tortured willow]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     350   2e-115   Eucalyptus grandis [rose gum]
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      350   2e-115   
emb|CAE82295.1|  catalase                                               350   3e-115   Homogyne alpina
gb|AAF61733.1|AF243518_1  catalase 3                                    350   3e-115   Helianthus annuus
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               350   3e-115   Cucurbita pepo
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 350   3e-115   Populus euphratica
gb|AAD17936.1|  catalase                                                350   3e-115   Brassica juncea [brown mustard]
emb|CAI43948.1|  catalase                                               350   3e-115   Populus deltoides
emb|CDP07287.1|  unnamed protein product                                350   3e-115   Coffea canephora [robusta coffee]
ref|XP_002301920.1|  catalase family protein                            350   3e-115   Populus trichocarpa [western balsam poplar]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          350   3e-115   Amborella trichopoda
gb|ADC95629.1|  catalase                                                350   3e-115   Bruguiera gymnorhiza [Burma mangrove]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       350   3e-115   Cucumis sativus [cucumbers]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             350   3e-115   Capsella rubella
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       350   3e-115   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 348   3e-115   
tpg|DAA43177.1|  TPA: catalase2                                         350   4e-115   
gb|KEH36312.1|  catalase heme-binding enzyme                            350   4e-115   Medicago truncatula
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      350   4e-115   Cucumis melo [Oriental melon]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         350   4e-115   Jatropha curcas
prf||1906388A  catalase                                                 350   4e-115
gb|KHG25152.1|  Catalase isozyme 1                                      350   4e-115   Gossypium arboreum [tree cotton]
gb|AAB62892.1|  catalase-1                                              350   4e-115   Nicotiana glutinosa
gb|AAR84578.1|  catalase 1a                                             350   4e-115   Lotus japonicus
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              350   4e-115   Brassica rapa
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 348   6e-115   
gb|AIA61608.1|  catalase                                                349   6e-115   Gynostemma pentaphyllum [jiaogulan]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               349   6e-115   Cucurbita pepo
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                349   7e-115   Erythranthe guttata [common monkey flower]
gb|ACJ76836.3|  catalase                                                349   7e-115   Dimocarpus longan [longan]
ref|NP_001237571.1|  catalase-4                                         349   8e-115   Glycine max [soybeans]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      349   8e-115   Solanum lycopersicum
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              348   8e-115   
ref|NP_001268098.1|  catalase                                           349   9e-115   Vitis vinifera
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              349   9e-115   
gb|AAO17721.1|  catalase                                                349   9e-115   Hypericum perforatum
gb|AFU90823.1|  catalase                                                347   9e-115   Populus x beijingensis
gb|AAX88799.1|  catalase                                                349   9e-115   Euphorbia characias
gb|AIZ77475.1|  catalase                                                348   1e-114   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 348   1e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001240021.1|  catalase                                           348   1e-114   Glycine max [soybeans]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 348   1e-114   Vitis vinifera
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 348   1e-114   Solanum tuberosum [potatoes]
ref|NP_001048861.1|  Os03g0131200                                       348   1e-114   
gb|ACJ11733.1|  catalase                                                348   1e-114   Gossypium hirsutum [American cotton]
tpg|DAA43178.1|  TPA: catalase2                                         349   2e-114   
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      348   2e-114   Vitis vinifera
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         348   2e-114   Tarenaya hassleriana [spider flower]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      348   2e-114   Prunus mume [ume]
gb|ACV92695.1|  catalase                                                348   2e-114   Brassica oleracea
gb|KJB57963.1|  hypothetical protein B456_009G187600                    348   2e-114   Gossypium raimondii
dbj|BAH37035.1|  catalase 1                                             348   2e-114   Pisum sativum [garden pea]
gb|AFD29285.1|  catalase                                                348   2e-114   Vicia faba [broad bean]
emb|CAD42909.1|  catalase                                               348   2e-114   Prunus persica
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             348   2e-114   Prunus persica
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         348   3e-114   Oryza brachyantha
dbj|BAA34714.1|  catalase                                               348   3e-114   Oryza sativa [red rice]
gb|EPS69543.1|  catalase                                                348   3e-114   Genlisea aurea
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 347   3e-114   Prunus mume [ume]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    347   3e-114   Arabis alpina [alpine rockcress]
gb|ABK24453.1|  unknown                                                 347   3e-114   Picea sitchensis
emb|CAD42908.1|  catalase                                               347   3e-114   Prunus persica
gb|AFU90822.1|  catalase                                                347   3e-114   Populus tomentosa [Chinese white poplar]
emb|CAA45564.1|  catalase                                               347   3e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54297.1|  peroxisomal catalase                                    347   4e-114   Phaseolus vulgaris [French bean]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             347   4e-114   Prunus persica
ref|XP_002306976.2|  catalase family protein                            347   4e-114   
gb|ACB11496.1|  catalase                                                347   4e-114   Pinus sylvestris [Scotch pine]
ref|XP_010094556.1|  Catalase isozyme 1                                 347   4e-114   Morus notabilis
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      347   4e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             347   4e-114   Phaseolus vulgaris [French bean]
gb|ABV55108.1|  catalase 2                                              347   4e-114   Musa acuminata AAA Group [Cavendish banana]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      347   5e-114   Populus euphratica
gb|ACH63223.1|  catalase                                                347   5e-114   Rheum australe [Himalayan rhubarb]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      347   5e-114   
gb|AAF19965.1|AF207906_1  catalase 1                                    347   5e-114   Zantedeschia aethiopica [arum-lily]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      347   6e-114   Elaeis guineensis
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      346   6e-114   Phoenix dactylifera
ref|XP_010692546.1|  PREDICTED: catalase                                347   6e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009106100.1|  PREDICTED: catalase-2                              347   7e-114   Brassica rapa
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      347   7e-114   Elaeis guineensis
dbj|BAJ90861.1|  predicted protein                                      347   7e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACJ22771.1|  catalase 1                                              347   7e-114   Jatropha curcas
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             346   8e-114   
gb|AHB72694.1|  catalase                                                346   8e-114   Beta vulgaris subsp. maritima [sea beet]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               346   9e-114   Gossypium hirsutum [American cotton]
gb|ABY21704.1|  catalase-1 precursor                                    346   9e-114   Panax ginseng [Asiatic ginseng]
ref|XP_003558892.1|  PREDICTED: catalase-1                              346   1e-113   Brachypodium distachyon [annual false brome]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      346   1e-113   
gb|ADU56199.1|  catalase                                                345   2e-113   Hevea brasiliensis [jebe]
emb|CDX76313.1|  BnaA08g10870D                                          345   2e-113   
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              345   2e-113   
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 345   2e-113   Phoenix dactylifera
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               345   2e-113   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      345   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAG23920.1|  catalase                                               345   2e-113   Festuca arundinacea [tall fescue]
emb|CDY17510.1|  BnaC03g65530D                                          345   2e-113   Brassica napus [oilseed rape]
gb|ACL35349.1|  catalase                                                345   2e-113   Picea glauca
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      345   3e-113   Citrus sinensis [apfelsine]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             345   3e-113   Citrus clementina [clementine]
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             342   3e-113   
gb|AAB86582.2|  catalase                                                345   3e-113   Raphanus sativus
dbj|BAA34205.1|  catalase                                               345   3e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001784759.1|  predicted protein                                  345   3e-113   
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      345   3e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      345   3e-113   Phoenix dactylifera
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             345   3e-113   Eutrema salsugineum [saltwater cress]
gb|AFR53082.1|  CAT                                                     345   4e-113   Anthurium andraeanum [flamingo-lily]
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      345   4e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010061175.1|  PREDICTED: catalase-like                           344   5e-113   Eucalyptus grandis [rose gum]
gb|AAC19398.1|  root catalase                                           344   5e-113   Mesembryanthemum crystallinum
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         344   5e-113   Setaria italica
emb|CDY52649.1|  BnaAnng11640D                                          343   6e-113   Brassica napus [oilseed rape]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      344   7e-113   
ref|XP_009103333.1|  PREDICTED: catalase-1                              344   7e-113   Brassica rapa
emb|CDY01363.1|  BnaA07g11360D                                          344   7e-113   
emb|CDP01803.1|  unnamed protein product                                344   9e-113   Coffea canephora [robusta coffee]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      343   1e-112   Phoenix dactylifera
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      343   1e-112   
emb|CDY31877.1|  BnaC07g15270D                                          343   1e-112   Brassica napus [oilseed rape]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              344   1e-112   Populus euphratica
ref|XP_009149539.1|  PREDICTED: catalase-3                              345   1e-112   Brassica rapa
gb|AAG61140.2|AF332973_1  catalase 2                                    343   1e-112   Zantedeschia aethiopica [arum-lily]
ref|NP_973873.1|  catalase 3                                            341   1e-112   Arabidopsis thaliana [mouse-ear cress]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               343   1e-112   Ricinus communis
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            343   1e-112   Pisum sativum [garden pea]
ref|XP_001752315.1|  predicted protein                                  343   2e-112   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             343   2e-112   Capsella rubella
gb|AAK67359.2|AF390210_1  catalase                                      342   2e-112   Suaeda salsa
gb|AIS20825.1|  CAT                                                     342   3e-112   Pyrus x bretschneideri [bai li]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     345   3e-112   Eucalyptus grandis [rose gum]
gb|AAM97542.1|  catalase 3                                              342   3e-112   Capsicum annuum
gb|AAD30291.2|AF139538_1  catalase 2                                    342   3e-112   Raphanus sativus
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 342   3e-112   Tarenaya hassleriana [spider flower]
emb|CDY29519.1|  BnaA06g14510D                                          342   4e-112   Brassica napus [oilseed rape]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         342   4e-112   Tarenaya hassleriana [spider flower]
gb|AAM97541.1|  catalase 2                                              342   4e-112   Capsicum annuum
gb|ACL81498.1|  catalase                                                342   4e-112   Ginkgo biloba [ginkgo]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          342   4e-112   Helianthus annuus
gb|AAD30292.1|AF139539_1  catalase 3                                    342   5e-112   Raphanus sativus
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         342   6e-112   Brassica rapa
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    342   6e-112   Arabis alpina [alpine rockcress]
emb|CDY33636.1|  BnaC08g19360D                                          342   6e-112   Brassica napus [oilseed rape]
ref|NP_001031073.1|  catalase 3                                         341   6e-112   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56915.1|  AT1G20620                                              342   6e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110221.1|  PREDICTED: catalase-3                              342   6e-112   Brassica rapa
ref|NP_564120.1|  catalase 3                                            342   7e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31878.1|  BnaC07g15280D                                          341   7e-112   Brassica napus [oilseed rape]
gb|AAM65021.1|  unknown                                                 341   7e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AEQ30070.1|  catalase                                                341   8e-112   Litchi chinensis [litchi]
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               341   9e-112   Zea mays [maize]
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 340   1e-111   Phoenix dactylifera
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 341   1e-111   Elaeis guineensis
prf||1803522A  catalase                                                 341   1e-111
gb|AIP93616.1|  CAT1                                                    341   1e-111   Bassia scoparia [burning bush]
emb|CDY01364.1|  BnaA07g11370D                                          343   1e-111   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             340   2e-111   Selaginella moellendorffii
gb|AGT16310.1|  catalase                                                340   2e-111   Saccharum hybrid cultivar R570
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               340   2e-111   Cucurbita pepo
prf||2104177A  catalase                                                 340   2e-111
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             338   3e-111   
gb|ADU56198.1|  catalase                                                340   3e-111   Musa acuminata AAA Group [Cavendish banana]
gb|AHA50082.1|  catalase                                                340   3e-111   Eleutherococcus senticosus
gb|AGI65617.1|  catalase                                                339   3e-111   Fragaria x ananassa
gb|AAF61732.1|AF243517_1  catalase 2                                    340   3e-111   Helianthus annuus
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               340   4e-111   Zea mays [maize]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       336   5e-111   Cucumis sativus [cucumbers]
gb|AAC17731.1|  catalase 1                                              339   6e-111   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            338   9e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      339   9e-111   Brachypodium distachyon [annual false brome]
gb|AAC84138.1|  catalase                                                327   1e-110   Cichorium intybus [radicchio]
gb|AFW66787.1|  catalase3                                               338   1e-110   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             338   1e-110   Citrus clementina [clementine]
ref|NP_001105310.1|  catalase isozyme 2                                 338   2e-110   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      338   2e-110   
ref|XP_010498496.1|  PREDICTED: catalase-3                              338   2e-110   Camelina sativa [gold-of-pleasure]
dbj|BAJ88747.1|  predicted protein                                      339   2e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW66788.1|  catalase3                                               338   2e-110   
gb|AAG43363.1|AF151368_1  catalase                                      337   3e-110   Hevea brasiliensis [jebe]
gb|AIU99487.1|  catalase                                                337   3e-110   Saccharum hybrid cultivar ROC22
gb|ADQ28492.1|  catalase                                                337   3e-110   Aeluropus littoralis
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 350   3e-110   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    337   4e-110   Oryza brachyantha
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          337   5e-110   
gb|AAB07026.1|  catalase 1                                              337   5e-110   
gb|AIU99488.1|  catalase                                                336   6e-110   
gb|AIU99480.1|  catalase                                                336   6e-110   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               336   7e-110   
ref|NP_001241808.1|  catalase isozyme B                                 336   7e-110   
ref|NP_001105415.1|  catalase isozyme 1                                 336   7e-110   
gb|AAC49807.1|  catalase 3                                              336   1e-109   
ref|NP_001045673.1|  Os02g0115700                                       336   1e-109   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         336   1e-109   
gb|ABN71233.2|  catalase                                                336   1e-109   
ref|XP_010477308.1|  PREDICTED: catalase-1                              336   1e-109   
gb|AIM43584.1|  catalase                                                335   1e-109   
gb|AHZ13843.1|  catalase                                                335   2e-109   
ref|NP_001058635.1|  Os06g0727200                                       335   2e-109   
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    335   2e-109   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           335   2e-109
ref|XP_010692544.1|  PREDICTED: catalase-like                           335   2e-109   
emb|CDY29518.1|  BnaA06g14520D                                          335   2e-109   
gb|AIU99486.1|  catalase                                                335   2e-109   
emb|CDY31490.1|  BnaC05g15990D                                          335   2e-109   
ref|XP_009149540.1|  PREDICTED: catalase-1                              335   2e-109   
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 335   2e-109   
gb|AIU99481.1|  catalase                                                335   2e-109   
emb|CAH61266.1|  catalase                                               335   3e-109   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               335   3e-109   
emb|CAA42720.1|  catalase-1                                             335   3e-109   
gb|AIU99479.1|  catalase                                                335   3e-109   
dbj|BAJ92414.1|  predicted protein                                      335   3e-109   
gb|ADY02963.1|  catalase                                                335   4e-109   
emb|CDY31488.1|  BnaC05g15970D                                          334   5e-109   
emb|CDP07288.1|  unnamed protein product                                334   5e-109   
gb|AFW66785.1|  catalase3 isoform 1                                     340   8e-109   
dbj|BAA34204.1|  catalase                                               333   8e-109   
gb|AII23739.1|  catalase                                                333   9e-109   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      333   1e-108   
ref|XP_001779509.1|  predicted protein                                  333   1e-108   
ref|XP_002510677.1|  catalase, putative                                 346   1e-108   
emb|CDY40645.1|  BnaA03g53180D                                          333   1e-108   
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 333   1e-108   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         333   1e-108   
emb|CAA43814.1|  catalase                                               333   1e-108   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      333   2e-108   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      333   2e-108   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 333   2e-108   
gb|AAY59707.1|  catalase                                                333   2e-108   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 334   2e-108   
gb|AAB70006.1|  catalase                                                332   2e-108   
ref|XP_001696763.1|  catalase/peroxidase                                332   2e-108   
gb|AGT16188.1|  catalase                                                332   3e-108   
gb|AGT16054.1|  catalase                                                332   3e-108   
gb|AGT16203.1|  catalase                                                332   4e-108   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    332   4e-108   
gb|AIU99483.1|  catalase                                                332   4e-108   
gb|AIU99484.1|  catalase                                                332   5e-108   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               331   7e-108   
gb|AIU99482.1|  catalase                                                331   7e-108   
gb|AAP80622.1|AF475100_1  catalase isozyme                              323   7e-108   
gb|ABK24543.1|  unknown                                                 331   8e-108   
ref|NP_001274863.1|  catalase isozyme 1                                 331   9e-108   
gb|AIU99485.1|  catalase                                                331   1e-107   
ref|NP_001234827.1|  catalase isozyme 1                                 331   1e-107   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 330   2e-107   
dbj|BAA05494.1|  catalase                                               330   2e-107   
gb|ABC01913.1|  catalase isozyme 1-like protein                         330   2e-107   
gb|AGT15888.1|  catalase                                                330   2e-107   
gb|AAR97905.1|  catalase                                                329   3e-107   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               329   3e-107   
gb|EMS51034.1|  Catalase isozyme 2                                      330   3e-107   
gb|EMT05040.1|  Catalase-1                                              330   6e-107   
emb|CAA85470.1|  catalase                                               329   6e-107   
gb|AJF34884.1|  catalase                                                328   6e-107   
gb|ABK24449.1|  unknown                                                 328   7e-107   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             328   7e-107   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               328   7e-107   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      328   8e-107   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      328   9e-107   
ref|XP_005645077.1|  catalase                                           328   1e-106   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          328   1e-106   
emb|CAA73663.1|  catalase                                               328   1e-106   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          328   2e-106
gb|ABK41476.1|  catalase                                                327   2e-106   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    327   3e-106   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          327   3e-106   
gb|ABB72796.1|  catalase isozyme 1-like protein                         327   5e-106   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         326   5e-106   
gb|AAR14052.2|  catalase                                                325   1e-105   
gb|ADN94253.1|  catalase                                                325   1e-105   
dbj|BAF91369.1|  catalase                                               325   1e-105   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     326   2e-105   
gb|AAC48918.1|  salicylic acid binding catalase                         324   3e-105   
gb|EMS61345.1|  Catalase isozyme 1                                      328   3e-105   
ref|XP_002950455.1|  catalase                                           324   4e-105   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               322   4e-104   
ref|NP_001105416.1|  catalase isozyme 3                                 322   4e-104   
gb|EMT06167.1|  Catalase isozyme 2                                      327   5e-104   
gb|AAF79625.1|AC027665_26  F5M15.5                                      334   5e-104   
gb|KDD77132.1|  catalase                                                321   7e-104   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                320   8e-104   
ref|XP_011396830.1|  Catalase isozyme 2                                 320   1e-103   
dbj|BAQ21275.1|  catalase                                               319   2e-103   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        319   4e-103   
ref|XP_002890395.1|  F5M15.5                                            331   6e-103   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   322   7e-103   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             317   1e-102   
gb|ABB88582.1|  catalase                                                317   3e-102   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          306   3e-98    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          297   6e-95    
gb|AHF27432.1|  catalase                                                297   7e-95    
gb|AHF27429.1|  catalase                                                295   4e-94    
gb|AHG98056.1|  catalase                                                288   1e-93    
gb|ADI58890.1|  catalase                                                283   2e-93    
gb|ADR01107.1|  catalase 3                                              290   3e-93    
ref|XP_005708279.1|  catalase                                           293   4e-93    
dbj|BAH20307.1|  AT1G20620                                              291   1e-92    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              288   3e-91    
emb|CBI29557.3|  unnamed protein product                                276   4e-91    
ref|XP_011022275.1|  PREDICTED: catalase-like                           286   2e-90    
ref|XP_005536240.1|  catalase                                           281   2e-88    
gb|ABR16304.1|  unknown                                                 273   2e-85    
gb|AAL38024.1|AF443179_1  catalase                                      263   5e-85    
gb|AIR77003.1|  catalase                                                265   1e-84    
gb|ACJ71242.1|  catalase 1                                              257   2e-82    
gb|AAD37788.1|AF149283_1  catalase 1                                    257   6e-80    
gb|AII80275.1|  catalase                                                249   3e-78    
gb|AEB22071.1|  catalase 2                                              242   8e-78    
gb|AEG89525.1|  catalase                                                248   2e-77    
ref|XP_005647994.1|  catalase-domain-containing protein                 251   7e-77    
gb|ACY30463.1|  catalase                                                244   7e-76    
ref|XP_005644653.1|  catalase-domain-containing protein                 250   1e-75    
emb|CAB16750.1|  catalase                                               238   2e-74    
ref|XP_005642928.1|  catalase                                           244   3e-74    
gb|ADU56189.1|  catalase 1                                              233   5e-74    
gb|AEA86312.1|  catalase isozyme                                        234   6e-74    
gb|ACJ71243.1|  catalase 2                                              234   1e-73    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    240   3e-73    
ref|XP_005712277.1|  unnamed protein product                            239   2e-72    
emb|CAB56850.1|  catalase                                               236   7e-72    
gb|KHG11966.1|  Catalase isozyme 2                                      232   2e-71    
gb|AEQ94083.1|  putative catalase                                       230   6e-71    
gb|AAN78323.1|  catalase1                                               226   7e-71    
emb|CAC37634.1|  catalase 1                                             229   1e-70    
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg             226   1e-70    
ref|WP_040574212.1|  catalase                                           235   2e-70    
gb|EJF09706.1|  catalase                                                234   2e-70    
gb|AAO12509.1|  catalase                                                224   5e-70    
gb|AFC01205.1|  catalase                                                226   6e-70    
dbj|GAE06714.1|  catalase                                               224   4e-69    
gb|ABY74514.1|  catalase                                                222   6e-69    
ref|WP_028402967.1|  catalase                                           230   9e-69    
ref|XP_006380544.1|  hypothetical protein POPTR_0007s08910g             224   1e-68    
ref|WP_034700019.1|  catalase                                           230   2e-68    
ref|WP_025606320.1|  catalase                                           229   2e-68    
ref|WP_036667842.1|  catalase                                           229   2e-68    
emb|CAP74531.1|  putative Td650 protein                                 222   3e-68    
ref|XP_004366029.2|  catalase isozyme 2                                 230   4e-68    
ref|WP_002978792.1|  catalase                                           229   4e-68    
ref|WP_036612802.1|  catalase                                           228   4e-68    
ref|WP_035405433.1|  catalase                                           228   7e-68    
ref|WP_024632816.1|  MULTISPECIES: catalase                             228   8e-68    
ref|WP_015737807.1|  catalase                                           228   8e-68    
ref|WP_018976489.1|  catalase                                           228   9e-68    
ref|WP_036662024.1|  catalase                                           227   9e-68    
ref|WP_009590324.1|  catalase                                           227   9e-68    
emb|CDP01802.1|  unnamed protein product                                226   1e-67    
ref|WP_006207005.1|  catalase                                           227   2e-67    
ref|WP_036640075.1|  catalase                                           227   2e-67    
ref|WP_017691823.1|  catalase                                           225   5e-67    
ref|WP_006263075.1|  catalase                                           225   1e-66    
ref|WP_006256937.1|  MULTISPECIES: catalase                             225   1e-66    
ref|WP_006266515.1|  catalase                                           225   1e-66    
ref|WP_038335781.1|  catalase                                           225   1e-66    
ref|WP_026975362.1|  catalase                                           224   1e-66    
ref|WP_011983963.1|  catalase                                           224   1e-66    
ref|WP_038987770.1|  catalase                                           225   1e-66    
ref|WP_019973735.1|  catalase                                           225   1e-66    
ref|WP_002617638.1|  catalase                                           225   1e-66    
emb|CDW92180.1|  putative catalase                                      218   2e-66    
ref|WP_007128851.1|  catalase                                           224   2e-66    
ref|WP_041889734.1|  catalase                                           224   2e-66    
ref|WP_037289104.1|  catalase                                           224   2e-66    
ref|WP_038700758.1|  catalase                                           224   3e-66    
ref|WP_018669668.1|  catalase                                           223   3e-66    
ref|WP_044186614.1|  catalase                                           224   3e-66    
ref|WP_017674668.1|  catalase                                           223   4e-66    
gb|KFK81701.1|  catalase family protein                                 214   4e-66    
ref|WP_006679508.1|  catalase                                           223   5e-66    
ref|WP_028404102.1|  catalase                                           223   5e-66    
ref|WP_043068684.1|  catalase                                           223   5e-66    
ref|WP_002162341.1|  catalase                                           223   6e-66    
ref|WP_026798903.1|  catalase                                           223   6e-66    
ref|WP_003470096.1|  catalase                                           223   6e-66    
ref|WP_001069182.1|  MULTISPECIES: catalase                             223   7e-66    
ref|WP_035435964.1|  catalase                                           223   7e-66    
ref|WP_008359888.1|  catalase                                           222   1e-65    
ref|WP_003211348.1|  catalase                                           222   1e-65    
ref|WP_012009409.1|  catalase                                           222   1e-65    
ref|WP_043393481.1|  catalase                                           222   1e-65    
emb|CDW92181.1|  putative catalase                                      216   1e-65    
ref|WP_034663722.1|  catalase                                           222   1e-65    
ref|WP_041109904.1|  catalase                                           222   2e-65    
ref|WP_001069151.1|  catalase                                           221   2e-65    
ref|WP_044333630.1|  catalase                                           222   2e-65    
ref|WP_034282264.1|  catalase                                           222   2e-65    
ref|WP_020060313.1|  catalase                                           221   2e-65    
ref|WP_005542848.1|  catalase                                           221   2e-65    
ref|WP_024426596.1|  catalase                                           221   2e-65    
ref|WP_024425295.1|  MULTISPECIES: catalase                             221   2e-65    
ref|WP_021261612.1|  catalase                                           221   2e-65    
ref|WP_039177466.1|  catalase                                           221   2e-65    
ref|WP_028531996.1|  catalase                                           221   2e-65    
gb|AAS40190.1|  catalase                                                220   2e-65    
ref|WP_041089594.1|  catalase                                           221   2e-65    
ref|WP_044354737.1|  catalase                                           221   2e-65    
ref|WP_031421259.1|  catalase                                           221   2e-65    
ref|WP_021255324.1|  catalase                                           221   2e-65    
ref|WP_024719958.1|  MULTISPECIES: catalase                             221   3e-65    
gb|KJF46757.1|  catalase                                                221   3e-65    
ref|WP_016088914.1|  catalase                                           221   3e-65    
ref|WP_035160169.1|  catalase                                           221   3e-65    
ref|WP_034321610.1|  catalase                                           221   3e-65    
ref|WP_039169268.1|  catalase                                           221   3e-65    



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 194/198 (98%), Positives = 196/198 (99%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHL+EKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLIEKIQNFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVKMYTREGN+DLVGNNFPVFFIRDG QFPDVIHAFKPNPKSHIQENWRILDYLSHLP
Sbjct  121  GFAVKMYTREGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLNTFAWFYDDVGIPTD
Sbjct  181  ESLNTFAWFYDDVGIPTD  198



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 193/198 (97%), Positives = 195/198 (98%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVKMYTR GN+DLVGNNFPVFFIRDG QFPDVIHAFKPNPKSHIQENWRILDYLSHLP
Sbjct  121  GFAVKMYTRGGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLNTFAWFYDDVGIPTD
Sbjct  181  ESLNTFAWFYDDVGIPTD  198



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   365 bits (936),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF TTN GAPVWN+  +LTVGSRGPILLEDYHL+EK+ +FTRER P
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLIEKLAHFTRERTP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ER+VHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQENWRILD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDPMKFPDVIHAFKPNPKSHIQENWRILDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFAWFYDDVGIPTD
Sbjct  181  ESLSTFAWFYDDVGIPTD  198



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FNTPF TTN G PVWNN  ALTVG+RGPILLEDYHLVEK+ N+TRERIP
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLVEKLANWTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPD IHA KPNPKSHIQE+WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVRDAMKFPDSIHALKPNPKSHIQESWRILDFFSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFAWFYDDVGIP D
Sbjct  181  ESLSTFAWFYDDVGIPQD  198



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   360 bits (923),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSFNT F TTN GAPVWNNT A+T+G RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNTTFWTTNSGAPVWNNTSAMTIGQRGPVLLEDYHLIEKITNFHRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ER+VHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+LD+ SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHIQEYWRVLDFCSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLNTF W +DDVGIP D
Sbjct  181  ESLNTFGWLFDDVGIPQD  198



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   357 bits (917),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   357 bits (916),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL TFA+ +DDVG+P D
Sbjct  181  ESLLTFAFLFDDVGVPQD  198



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   357 bits (916),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL TFA+ +DDVG+P D
Sbjct  181  ESLLTFAFLFDDVGVPQD  198



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   357 bits (915),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+G+P D
Sbjct  181  ESLNMFTFLFDDIGVPQD  198



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   357 bits (915),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSS NTPF TT+ GAPVWNN  ++TVG+RGPILLEDYH++EK+ NFTRERIP
Sbjct  1    MDPCKFRPSSSNNTPFWTTDAGAPVWNNNSSMTVGTRGPILLEDYHMIEKLANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WRI D+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRIFDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFAWF+DDVGIP D
Sbjct  181  ESLSTFAWFFDDVGIPQD  198



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   357 bits (915),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FNTPF TTN G PV+NN  ALT+GSRGPILLEDYHLVEKI NFTRER P
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLVEKIANFTRERTP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+LD+ S+LP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHIQEYWRVLDFCSYLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TF + +DDVG+P D
Sbjct  181  ESLHTFMFLFDDVGVPQD  198



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +2

Query  83   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  262
            DP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  263  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  442
            RVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  443  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  622
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPE  180

Query  623  SLNTFAWFYDDVGIPTD  673
            SL+ F + +DD+GIP D
Sbjct  181  SLHMFTFLFDDIGIPQD  197



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   353 bits (906),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP D
Sbjct  181  ESLHMFSFLFDDVGIPQD  198



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   353 bits (906),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++  DD+G+P D
Sbjct  181  ESLHMFSFLLDDIGVPQD  198



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP D
Sbjct  181  ESLHMFSFLFDDVGIPQD  198



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++  DD+G+P D
Sbjct  181  ESLHMFSFLLDDIGVPQD  198



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+F+TPF TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQENWRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQENWRILDFFSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFA+FYDD+GIP D
Sbjct  181  ESLHTFAFFYDDLGIPQD  198



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+ FCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>gb|ABB51561.1| truncated catalase 2 [Avicennia marina]
Length=424

 Score =   352 bits (903),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KY PSSSFNTP  TTNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FTRERIP
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHIQESWRILDFCSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL TFAWFYDDVGIP D
Sbjct  181  ESLLTFAWFYDDVGIPQD  198



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   354 bits (909),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DDVG+P D
Sbjct  181  ESLNMFTFLFDDVGVPQD  198



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   354 bits (909),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP D
Sbjct  181  ESLHMFSFLFDDVGIPQD  198



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   354 bits (909),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP D
Sbjct  181  ESLHMFSFLFDDVGIPQD  198



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   354 bits (909),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K RPSS++NTPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDLGIPQD  198



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   351 bits (900),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFAWF+DDVGIP D
Sbjct  181  ESLSTFAWFFDDVGIPQD  198



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K RPS++FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP D
Sbjct  181  ESLHMFSFLFDDVGIPQD  198



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++  DD+G+P D
Sbjct  181  ESLHMFSFLLDDIGVPQD  198



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   353 bits (906),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNNFPVFF+RD  QFPDVI AFKPNPKSHIQE WRILD+ S+ P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHIQEPWRILDFCSYHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL +FAWFYDDVGIP +
Sbjct  181  ESLLSFAWFYDDVGIPIN  198



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD IHAFKPNPKS+IQE WRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFFSHQP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFAWF+DDVGIP D
Sbjct  181  ESLSTFAWFFDDVGIPQD  198



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KY PSSSFNTP  TTNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FTRERIP
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHIQESWRILDFCSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL TFAWFYDDVGIP D
Sbjct  181  ESLLTFAWFYDDVGIPQD  198



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+ DG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPQD  198



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   352 bits (904),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL +FAWFYDDVGIP +
Sbjct  181  ESLLSFAWFYDDVGIPIN  198



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   353 bits (907),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++  DD+G+P D
Sbjct  181  ESLHMFSFLLDDIGVPQD  198



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K RPSS+++TPF TTN GAPV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLNT  ++ DDVGIPTD
Sbjct  181  ESLNTMTFWLDDVGIPTD  198



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+ DG  FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPQD  198



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   352 bits (902),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   352 bits (902),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   348 bits (894),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPAD  198



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTH+I+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDLGIPQD  198



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   352 bits (903),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVG+PTD
Sbjct  181  ESLHMFTFLFDDVGVPTD  198



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   348 bits (894),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD G+P D
Sbjct  181  ESLHMFSFLFDDWGVPQD  198



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPQD  198



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   348 bits (894),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD G+P D
Sbjct  181  ESLHMFSFLFDDWGVPQD  198



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKSYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPQD  198



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   352 bits (902),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYR SS+FNTPF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPV+NN  +L+VG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVG+P D
Sbjct  181  ESLHMFTFLFDDVGVPQD  198



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDIGVPQD  198



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++NTPFCTTN GAPVWNNT  +++G RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSIGERGPILLEDYQLIEKIATFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL +FAWFYDDVGIP +
Sbjct  181  ESLLSFAWFYDDVGIPIN  198



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   352 bits (904),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSS N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPS++F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVGIP D
Sbjct  181  ESLHMFTFLFDDVGIPQD  198



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   351 bits (901),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFAWF+DDVGIP D
Sbjct  181  ESLSTFAWFFDDVGIPQD  198



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   351 bits (901),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPQD  198



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFP+VI AFKPNPKSHIQE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPEVIRAFKPNPKSHIQEPWRFLDFCSYHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL +FAWFYDDVGIP +
Sbjct  181  ESLLSFAWFYDDVGIPIN  198



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKG FEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGLFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNNFPVFF+RD  QFPDVI AFKPNPKSHIQE WRILD+ S+ P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHIQEPWRILDFCSYHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL +FAWFYDDVGIP +
Sbjct  181  ESLLSFAWFYDDVGIPIN  198



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVG+P D
Sbjct  181  ESLHMFTFLFDDVGVPQD  198



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP + RPSS FNTPF TTN GAPVWNN  +LTVGSRGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPDV+HAFKPNPKSH+QENWRI D+LSH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHLQENWRIFDFLSHVP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+   +  DD+GIP D
Sbjct  181  ESLHMLTFLLDDLGIPQD  198



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   350 bits (898),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK+YT EGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKLYTGEGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+P+ TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   350 bits (898),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFAWF+DDVGIP D
Sbjct  181  ESLSTFAWFFDDVGIPQD  198



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K RP+S++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPASAYNSPFLTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLNT  ++ DD+GIPTD
Sbjct  181  ESLNTMTFWLDDIGIPTD  198



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K RPSS++N PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNAPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLNT  ++ DDVGIPTD
Sbjct  181  ESLNTMTFWLDDVGIPTD  198



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVH RGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHRRGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL +FAWFYDDVGIP +
Sbjct  181  ESLLSFAWFYDDVGIPIN  198



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GA VWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVGIP D
Sbjct  181  ESLHMFTFLFDDVGIPQD  198



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++H+ KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHSLKPNPKTHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVGIP D
Sbjct  181  ESLHMFTFLFDDVGIPMD  198



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF T N GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDIT+L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPAD  198



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL TFA+ +DDVG+P D
Sbjct  181  ESLLTFAFLFDDVGVPQD  198



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP D
Sbjct  181  ESLHMFSFLFDDVGIPAD  198



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+ DG  FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQESWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F +  DD+GIP D
Sbjct  181  ESLNMFTFLLDDIGIPQD  198



>prf||1906388A catalase
Length=492

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PFCTTN GAP  NN   LTVG+RG +LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPEKNNNSYLTVGARGLVLLEDYHLVEKLANFDRERVP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVG+P D
Sbjct  181  ESLHMFTFLFDDVGVPQD  198



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   350 bits (899),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   348 bits (893),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL TFA+ +DDVG+P D
Sbjct  181  ESLLTFAFLFDDVGVPQD  198



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   349 bits (896),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDIT+LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   349 bits (896),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++ L+CADFLRAPGVQTP+IVRFSTVIHER SPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLSCADFLRAPGVQTPVIVRFSTVIHERVSPETVRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE+WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQESWRFLDFCSYHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL +FAWFYDDVGIP +
Sbjct  181  ESLLSFAWFYDDVGIPIN  198



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   349 bits (895),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR PGVQTP+IVRFSTVIHERGSPE+IRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFSTVIHERGSPESIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   349 bits (895),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K  PSS+FN PF TTN GAPVWN+  ALTVG RGP+LLEDYHLVEK+ +F RER P
Sbjct  1    MDPYKPIPSSNFNAPFMTTNAGAPVWNDDNALTVGKRGPVLLEDYHLVEKLAHFARERTP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRD  +FPDV+HAFKPNPKSHIQE+WRILD+ +H+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDAIKFPDVVHAFKPNPKSHIQESWRILDFCAHIP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TF WFYDDVGIP D
Sbjct  181  ESLSTFTWFYDDVGIPQD  198



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   349 bits (895),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   349 bits (895),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+GIP D
Sbjct  181  ESLHMFSFLFDDLGIPQD  198



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   348 bits (893),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   349 bits (895),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE WR++D+LS+ P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSYHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFA+ +DDVGIP D
Sbjct  181  ESLSTFAFLFDDVGIPQD  198



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   349 bits (895),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   349 bits (895),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPV++N  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+GIP D
Sbjct  181  ESLHMFSFLFDDIGIPQD  198



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   347 bits (891),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +2

Query  83   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  262
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  263  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  442
            RVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  443  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  622
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  623  SLNTFAWFYDDVGIPTD  673
            SL+ F++ +DD+G+P D
Sbjct  181  SLHMFSFLFDDLGVPQD  197



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   349 bits (895),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFF+VTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPQD  198



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPAD  198



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIP  667
            ESL+ F++ +DDVG+P
Sbjct  181  ESLHMFSFLFDDVGVP  196



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE WR++D+LS+ P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSYHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFA+ +DDVG+P D
Sbjct  181  ESLSTFAFLFDDVGVPQD  198



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+GIP D
Sbjct  181  ESLHMFSFLFDDLGIPQD  198



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPAD  198



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+H+TCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP D
Sbjct  181  ESLHMFSFLFDDVGIPAD  198



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP D
Sbjct  181  ESLHMFSFLFDDVGIPQD  198



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHER SPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERASPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENW +LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWGVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+G+P D
Sbjct  181  ESLNMFTFLFDDIGVPQD  198



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFA+FYDD+G+P D
Sbjct  181  ESLHTFAFFYDDLGVPQD  198



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFA+FYDD+G+P D
Sbjct  181  ESLHTFAFFYDDLGVPQD  198



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPAD  198



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+LSH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPAD  198



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLT ADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNP+SHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPRSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFA+FYDD+G+P D
Sbjct  181  ESLHTFAFFYDDLGVPQD  198



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP ++RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+GIP D
Sbjct  181  ESLHMFSFLFDDLGIPQD  198



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIP  667
            ESL+ F++ +DDVG+P
Sbjct  181  ESLHMFSFLFDDVGVP  196



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   347 bits (890),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +2

Query  83   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  262
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  263  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  442
            RVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  443  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  622
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  623  SLNTFAWFYDDVGIPTD  673
            SL+ F++ +DD+G+P D
Sbjct  181  SLHMFSFLFDDLGVPQD  197



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIH RGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHARGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRA GVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIP  667
            ESL+ F + +DD+GIP
Sbjct  181  ESLHMFTFLFDDLGIP  196



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQEFWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPQD  198



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+QE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHVQEYWRVFDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TF + +DDVG+P+D
Sbjct  181  ESLHTFFFLFDDVGVPSD  198



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>gb|ABV55108.1| catalase 2 [Musa acuminata AAA Group]
Length=492

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+QE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHVQEYWRVFDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TF + +DDVG+P+D
Sbjct  181  ESLHTFFFLFDDVGVPSD  198



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+G+P D
Sbjct  181  ESLHMFSFLFDDLGVPQD  198



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ ++P+ TTN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F +  DD+G+P D
Sbjct  181  ESLHMFTFLLDDLGVPQD  198



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   347 bits (889),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP + RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIPTD
Sbjct  181  ESLHMFTFLFDDIGIPTD  198



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   347 bits (889),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP ++RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP+D
Sbjct  181  ESLHMFSFLFDDVGIPSD  198



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   346 bits (888),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGP+ LEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHLQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP+D
Sbjct  181  ESLHMFSFLFDDVGIPSD  198



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   347 bits (889),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR++D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P +
Sbjct  181  ESLHMFTFLFDDIGVPAN  198



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHIQENWR++D+ S  P
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSPHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  181  ESLNMFTFLFDDIGIPQD  198



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVG+P D
Sbjct  181  ESLHMFTFLFDDVGVPAD  198



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSFN+P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWR+LD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPAD  198



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+ PSS+ NTPF TTN GAPVWNN  ++TVG RGPILLEDYH++EK+ NF RERIP
Sbjct  1    MDPYKHCPSSAHNTPFWTTNAGAPVWNNNSSMTVGQRGPILLEDYHMLEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTH+I++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHEISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WRI D+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRIFDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFAWF+DDVGIP D
Sbjct  181  ESLSTFAWFFDDVGIPQD  198



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   346 bits (888),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +2

Query  92   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  271
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  3    QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  62

Query  272  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  451
            HARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  63   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  122

Query  452  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  631
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  123  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  182

Query  632  TFAWFYDDVGIPTD  673
             F++  DD+G+P D
Sbjct  183  MFSFLLDDIGVPQD  196



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   346 bits (888),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR++D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P +
Sbjct  181  ESLHMFTFLFDDIGVPAN  198



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   346 bits (888),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RG  LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   346 bits (888),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP ++RPSS+FN+ + TTN GAPVWNN  +LTVG+RGPILLEDY LVEKI NF RERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDLGVPQD  198



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPAD  198



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFP FF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F +  DD+G+P D
Sbjct  181  ESLHMFTFLLDDLGVPQD  198



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA++KGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQETWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPQD  198



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = +2

Query  92   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  271
            +YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  2    QYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVV  61

Query  272  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  451
            HARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  62   HARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  121

Query  452  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  631
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH PESLN
Sbjct  122  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLN  181

Query  632  TFAWFYDDVGIPTD  673
             F + +DD+GIP D
Sbjct  182  MFTFLFDDIGIPQD  195



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +2

Query  92   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  271
            ++RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  272  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  451
            HARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  125

Query  452  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  631
            K YTREGNFDLVGNNFPVFF+ DG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  126  KFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFPESLH  185

Query  632  TFAWFYDDVGIPTD  673
             F++ +DDVG+P D
Sbjct  186  MFSFLFDDVGVPQD  199



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVT+D++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVG+P D
Sbjct  181  ESLHMFTFLFDDVGVPAD  198



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  280
            PSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+PERVVHAR
Sbjct  1    PSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVPERVVHAR  60

Query  281  GATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  460
            GA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  61   GASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  461  TREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFA  640
            TREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+PESL+ F 
Sbjct  121  TREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFT  180

Query  641  WFYDDVGIPTD  673
            + +DD+GIP D
Sbjct  181  FLFDDIGIPQD  191



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TF + +DDVG+P+D
Sbjct  181  ESLHTFFFLFDDVGVPSD  198



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA+K YTREGN+DL GNNFPVFFIRDG +FPD++HA KPNPK+HIQENWR+LD+ SH P
Sbjct  121  GFAIKFYTREGNWDLAGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPAD  198



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = +2

Query  92   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  271
            +YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  2    QYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVV  61

Query  272  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  451
            HARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  62   HARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  121

Query  452  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  631
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH PESLN
Sbjct  122  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLN  181

Query  632  TFAWFYDDVGIPTD  673
             F + +DD+GIP D
Sbjct  182  MFTFLFDDIGIPQD  195



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETPRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIP  667
            ESL+ F++ +DDVG+P
Sbjct  181  ESLHMFSFLFDDVGVP  196



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPRD  198



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPRD  198



>ref|XP_006416379.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
 gb|ESQ34732.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
Length=405

 Score =   342 bits (877),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRP+SS+N+PF T N GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFT-NSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  120  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  179

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESLN F + +DD+GIP D
Sbjct  180  ESLNMFTFLFDDIGIPQD  197



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
             FA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  VFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPAD  198



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS +NTPF TTN G+PVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPE IRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPEAIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNN PVFFIRDG +FPD+IHA KPNPKSHIQE WRI+D+ SH+P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEAWRIMDFFSHVP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ES N F + +DD+GIP D
Sbjct  181  ESCNMFTFLFDDIGIPAD  198



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS++N+PF TTN GAPVWNN  ++TVGSRGPILLEDYHLVEKI  F RERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIP  667
            ESL+ F + +DD+G+P
Sbjct  181  ESLHMFTFLFDDIGVP  196



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVG+P D
Sbjct  181  ESLHMFTFLFDDVGVPAD  198



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP ++RPSS+ ++PF TTN GAPVWNN  +L+VG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+I RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+GIP D
Sbjct  181  ESLHMFSFLFDDLGIPQD  198



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++++ F TTN G PVWN+  ALT+G+RGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKYRPSSAYDSNFTTTNAGGPVWNDDVALTIGTRGPILLEDYHLIEKVAHFARERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNP+S+IQE WR+LD LSHLP
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSNIQEYWRVLDILSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ES++TF + +DDVG+PTD
Sbjct  181  ESMHTFCFLFDDVGVPTD  198



>ref|XP_009392260.1| PREDICTED: catalase isozyme A-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TF + +DDVG+P+D
Sbjct  181  ESLHTFFFLFDDVGVPSD  198



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   344 bits (883),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>gb|AAC19398.1| root catalase [Mesembryanthemum crystallinum]
Length=493

 Score =   344 bits (883),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSS+NT F TT  G PVWN+  +LTVG+RGPILLEDYHL+EKI ++ RERIP
Sbjct  1    MDPYKYRPSSSYNTSFMTTKTGQPVWNDDSSLTVGARGPILLEDYHLLEKIASWDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVT+DITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETMRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA+K YTREGNFDLVGNNFPVFF RD  +FPDV+ AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFALKFYTREGNFDLVGNNFPVFFNRDAMKFPDVVRAFKPNPKSHIQEMWRILDFCSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFAWF+DDVGIP +
Sbjct  181  ESLHTFAWFFDDVGIPIN  198



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   344 bits (883),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+ N P  +TN GAPVW+N  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP D
Sbjct  181  ESLHMFTFLFDDIGIPAD  198



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +2

Query  95   YRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVH  274
            YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIPERVVH
Sbjct  43   YRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVH  102

Query  275  ARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVK  454
            ARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPRGFAVK
Sbjct  103  ARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVK  162

Query  455  MYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNT  634
             YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHIQENWR++D+ SH PESLN 
Sbjct  163  FYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSHHPESLNM  222

Query  635  FAWFYDDVGIPTD  673
            F + +DD+GIP D
Sbjct  223  FTFLFDDIGIPQD  235



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   344 bits (882),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HL CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFP FF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F +  DD+G+P D
Sbjct  181  ESLHMFTFLLDDLGVPQD  198



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   344 bits (882),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+GIP D
Sbjct  181  ESLHMFSFLFDDLGIPQD  198



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   344 bits (882),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+GIP D
Sbjct  181  ESLHMFSFLFDDLGIPQD  198



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   344 bits (882),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIVDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+G+P D
Sbjct  181  ESLHMFTFLFDDIGVPQD  198



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSSF+T + TTN G PVWN+  ALTVG+RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTTYTTTNAGGPVWNDDQALTVGARGPILLEDYHLIEKIAHFARERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TF + +DDVG+P+D
Sbjct  181  ESLHTFFFLFDDVGVPSD  198



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+F+T + TTN G PVWN+  ALTVGSRGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFDTAYTTTNAGGPVWNDDQALTVGSRGPILLEDYHLIEKIAHFARERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THD+T+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TF + +DDVG+PTD
Sbjct  181  ESLHTFFFLFDDVGVPTD  198



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+GIP D
Sbjct  181  ESLHMFSFLFDDLGIPQD  198



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +2

Query  92   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  271
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  24   QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  83

Query  272  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  451
            HARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPRGFAV
Sbjct  84   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPRGFAV  143

Query  452  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  631
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  144  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  203

Query  632  TFAWFYDDVGIPTD  673
             F++ +DD+G+P D
Sbjct  204  MFSFLFDDIGVPQD  217



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +2

Query  71   LISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRE  250
             I+MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRE
Sbjct  49   FITMDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRE  108

Query  251  RIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIR  430
            RIPERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+R
Sbjct  109  RIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMR  168

Query  431  DPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLS  610
            D RGFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+S
Sbjct  169  DIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMS  228

Query  611  HLPESLNTFAWFYDDVGIPTD  673
            HLPESL T+ W +DDVGIP D
Sbjct  229  HLPESLLTWCWMFDDVGIPQD  249



>gb|AAG61140.2|AF332973_1 catalase 2 [Zantedeschia aethiopica]
Length=492

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSSS++  F TTN G PVWN+  ALTVGSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPCKYRPSSSYDASFTTTNAGGPVWNDDVALTVGSRGPILLEDYHLIEKVAHFARERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THD+THLT ADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTFADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKS++QE WR+LD+LSHLP
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSNVQEYWRVLDFLSHLP  180

Query  620  ESLNTFAWFYDDVGIP  667
            ESL+TF + YDDVG+P
Sbjct  181  ESLHTFCFLYDDVGVP  196



>ref|NP_973873.1| catalase 3 [Arabidopsis thaliana]
 gb|AEE29994.1| catalase 3 [Arabidopsis thaliana]
Length=427

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSS +TPF TTN G PV NN  ++TVG RGPILLEDYH++EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSNDTPFWTTNAGDPVSNNNSSMTVGPRGPILLEDYHMIEKLANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHD+T LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHDVTDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDV+HAFKPNPKSHIQE WRI D+ SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVVHAFKPNPKSHIQEYWRIFDFCSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TFAWF+DDVGIP D
Sbjct  181  ESLSTFAWFFDDVGIPQD  198



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+  + P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFYNFP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVG+P D
Sbjct  181  ESLHMFSFLFDDVGVPQD  198



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS ++TPF TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNN PVFFIRDG +FPD+IHA KPNPKSHIQE WRI+D+ SH+P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEPWRIMDFFSHVP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            E+ N F + +DD+GIP D
Sbjct  181  EACNMFTFVFDDIGIPAD  198



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LTVG RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTVGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWTWMFDDVGIPQD  198



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ N+P+ T N GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR+PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP +
Sbjct  181  ESLHMFTFLFDDIGIPAN  198



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHEHGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F +  DD+G+P D
Sbjct  181  ESLHMFTFLSDDLGVPQD  198



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = +2

Query  68   PLISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTR  247
            P  +MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF R
Sbjct  89   PPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDR  148

Query  248  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  427
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  149  ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  208

Query  428  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYL  607
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ 
Sbjct  209  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFF  268

Query  608  SHLPESLNTFAWFYDDVGIPTD  673
            SH PESL+ F++ +DDVG+P D
Sbjct  269  SHHPESLHMFSFLFDDVGVPQD  290



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ N+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDIT LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DD+GIP D
Sbjct  181  ESLHMFSFLFDDLGIPQD  198



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSS ++P+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDSPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RD R
Sbjct  61   ERVVHARGFSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA K YTREGNFDLVGNNFPVFF RDG QFPD IHA KPNP ++IQENWRILDY SH P
Sbjct  121  GFATKFYTREGNFDLVGNNFPVFFTRDGVQFPDTIHALKPNPVTNIQENWRILDYFSHFP  180

Query  620  ESLNTFAWFYDDVGIP  667
            ESL+TFA+ YDDVG+P
Sbjct  181  ESLHTFAFMYDDVGVP  196



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSSS +TP+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDTPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RD R
Sbjct  61   ERVVHARGFSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFA K YTREGNFD+VGNNFPVFF RDG QFPD IHA KPNP ++IQENWRILDY SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDGVQFPDTIHALKPNPVTNIQENWRILDYFSHFP  180

Query  620  ESLNTFAWFYDDVGIP  667
            ESL+TFA+ YDDVG+P
Sbjct  181  ESLHTFAFLYDDVGVP  196



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   342 bits (876),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  104  SSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHARG  283
            SS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI ERVVHARG
Sbjct  1    SSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIAERVVHARG  60

Query  284  ATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYT  463
            A+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK YT
Sbjct  61   ASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYT  120

Query  464  REGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFAW  643
            REGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR+LD+ SH PESL+ F +
Sbjct  121  REGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVLDFFSHHPESLHMFTF  180

Query  644  FYDDVGIPTD  673
             +DD+GIP D
Sbjct  181  LFDDIGIPQD  190



>gb|ACL81498.1| catalase [Ginkgo biloba]
Length=492

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS++N+P+CTTN GAPVWNNT +LT+G+RGP+LLEDYHL+EK+  FTRERIP
Sbjct  1    MDPYKHRPSSAYNSPYCTTNQGAPVWNNTSSLTLGNRGPVLLEDYHLIEKLSVFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR+PGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFD+VGNN PVFF RD  QFPDVI A KPNPK+HIQE WR LDYLSHLP
Sbjct  121  GFAVKFYTREGNFDIVGNNIPVFFTRDAIQFPDVIRALKPNPKTHIQEPWRYLDYLSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ES  TF +++DD GIP+D
Sbjct  181  ESCLTFLFWFDDWGIPSD  198



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDIT LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQE+WRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQEDWRIMDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F +  DD+G+P D
Sbjct  181  ESLHMFTFLLDDIGVPQD  198



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPE+IRD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPESIRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>ref|NP_001031073.1| catalase 3 [Arabidopsis thaliana]
 dbj|BAH19685.1| AT1G20620 [Arabidopsis thaliana]
 gb|AEE29997.1| catalase 3 [Arabidopsis thaliana]
Length=485

 Score =   341 bits (875),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>dbj|BAH56915.1| AT1G20620 [Arabidopsis thaliana]
Length=493

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   342 bits (876),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   341 bits (875),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   341 bits (875),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL T+ W +DDVGIP D
Sbjct  181  ESLLTWCWMFDDVGIPQD  198



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   341 bits (875),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  280
            PSS+FN PF TTN GAPVWN+  ALTVG RGP+LLEDYHLVEK+ +F R R PERVVHAR
Sbjct  3    PSSNFNAPFMTTNAGAPVWNDDNALTVGKRGPVLLEDYHLVEKLAHFARGRTPERVVHAR  62

Query  281  GATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  460
            GA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  63   GASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFY  122

Query  461  TREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFA  640
            TREGNFDLVGNNFPVFFIRD  +FPDV+HAFKPNPKSH+QE+WRILD+ SH+PESL+TF 
Sbjct  123  TREGNFDLVGNNFPVFFIRDAIKFPDVVHAFKPNPKSHVQESWRILDFCSHIPESLSTFT  182

Query  641  WFYDDVGIPTD  673
            WFYDDVGIP D
Sbjct  183  WFYDDVGIPQD  193



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   341 bits (874),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  179

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP D
Sbjct  180  ESLHMFSFLFDDVGIPAD  197



>ref|XP_008778560.1| PREDICTED: catalase isozyme 2-like [Phoenix dactylifera]
Length=482

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+F+  + TTN GAPVWN+  ALTVG RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFDPTYTTTNAGAPVWNDDQALTVGPRGPILLEDYHLIEKIAHFARERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+TF + +DDVG+P+D
Sbjct  181  ESLHTFFFLFDDVGVPSD  198



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHD++HLTCADFL APGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLHAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DDVG+P D
Sbjct  181  ESLHMFTFLFDDVGVPAD  198



>prf||1803522A catalase
Length=491

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  179

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F++ +DDVGIP D
Sbjct  180  ESLHMFSFLFDDVGIPAD  197



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  80   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  259
            MDP K+RPSS+ N+P  TTN GAPVWN+  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNSPHFTTNSGAPVWNDNSSMTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  260  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  439
            ERVVHARGA+AKGFFE THDI+HLTCADFLR+PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  440  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  619
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSHHP  180

Query  620  ESLNTFAWFYDDVGIPTD  673
            ESL+ F + +DD+GIP +
Sbjct  181  ESLHMFTFLFDDIGIPAN  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600