BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024I12

Length=699
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011102070.1|  PREDICTED: probable leucine-rich repeat rece...    277   2e-88   
ref|XP_011101928.1|  PREDICTED: probable leucine-rich repeat rece...    280   5e-85   
ref|XP_009795509.1|  PREDICTED: probable LRR receptor-like serine...    278   2e-84   Nicotiana sylvestris
ref|XP_009795508.1|  PREDICTED: probable LRR receptor-like serine...    278   5e-83   Nicotiana sylvestris
emb|CDO96888.1|  unnamed protein product                                274   1e-81   Coffea canephora [robusta coffee]
ref|XP_009600348.1|  PREDICTED: probable LRR receptor-like serine...    272   5e-81   
ref|XP_009600347.1|  PREDICTED: probable LRR receptor-like serine...    272   7e-81   Nicotiana tomentosiformis
ref|XP_010655579.1|  PREDICTED: probable leucine-rich repeat rece...    269   1e-80   Vitis vinifera
ref|XP_010655577.1|  PREDICTED: probable LRR receptor-like serine...    269   2e-80   
ref|XP_010655575.1|  PREDICTED: probable LRR receptor-like serine...    270   3e-80   Vitis vinifera
ref|XP_010655574.1|  PREDICTED: probable LRR receptor-like serine...    270   5e-80   Vitis vinifera
ref|XP_006358134.1|  PREDICTED: probable LRR receptor-like serine...    268   1e-79   
ref|XP_010316867.1|  PREDICTED: probable LRR receptor-like serine...    265   3e-78   
ref|XP_006358075.1|  PREDICTED: probable LRR receptor-like serine...    264   6e-78   
ref|XP_010655561.1|  PREDICTED: probable leucine-rich repeat rece...    261   8e-78   Vitis vinifera
ref|XP_008225419.1|  PREDICTED: probable leucine-rich repeat rece...    262   2e-77   Prunus mume [ume]
ref|XP_007214558.1|  hypothetical protein PRUPE_ppa000742mg             262   2e-77   Prunus persica
ref|XP_010655560.1|  PREDICTED: probable LRR receptor-like serine...    261   7e-77   Vitis vinifera
emb|CBI30744.3|  unnamed protein product                                260   2e-76   Vitis vinifera
ref|XP_007213704.1|  hypothetical protein PRUPE_ppa000741mg             259   2e-76   Prunus persica
ref|XP_008245181.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    259   4e-76   Prunus mume [ume]
ref|XP_010655558.1|  PREDICTED: probable LRR receptor-like serine...    258   1e-75   Vitis vinifera
ref|XP_011461827.1|  PREDICTED: probable leucine-rich repeat rece...    255   6e-75   Fragaria vesca subsp. vesca
ref|XP_006358076.1|  PREDICTED: probable LRR receptor-like serine...    252   4e-74   
emb|CBI30745.3|  unnamed protein product                                256   6e-74   Vitis vinifera
ref|XP_004233025.1|  PREDICTED: probable LRR receptor-like serine...    252   8e-74   Solanum lycopersicum
ref|XP_010316866.1|  PREDICTED: probable LRR receptor-like serine...    248   4e-72   
ref|XP_010655586.1|  PREDICTED: probable LRR receptor-like serine...    246   9e-72   Vitis vinifera
ref|XP_011461995.1|  PREDICTED: probable LRR receptor-like serine...    246   9e-72   Fragaria vesca subsp. vesca
emb|CBI30748.3|  unnamed protein product                                246   1e-71   Vitis vinifera
ref|XP_010655562.1|  PREDICTED: probable LRR receptor-like serine...    244   4e-71   
ref|XP_009600349.1|  PREDICTED: probable LRR receptor-like serine...    244   4e-71   Nicotiana tomentosiformis
ref|XP_010655563.1|  PREDICTED: probable LRR receptor-like serine...    244   4e-71   
emb|CBI30742.3|  unnamed protein product                                244   6e-71   Vitis vinifera
ref|XP_010655564.1|  PREDICTED: probable LRR receptor-like serine...    244   6e-71   
ref|XP_010655559.1|  PREDICTED: probable LRR receptor-like serine...    243   2e-70   Vitis vinifera
ref|XP_002300205.2|  hypothetical protein POPTR_0001s31610g             238   6e-69   
ref|XP_011045702.1|  PREDICTED: probable LRR receptor-like serine...    238   8e-69   Populus euphratica
ref|XP_008353675.1|  PREDICTED: probable leucine-rich repeat rece...    223   4e-67   
ref|XP_011461992.1|  PREDICTED: probable leucine-rich repeat rece...    233   5e-67   Fragaria vesca subsp. vesca
ref|XP_008245184.1|  PREDICTED: probable leucine-rich repeat rece...    231   3e-66   
ref|XP_008371519.1|  PREDICTED: probable LRR receptor-like serine...    231   4e-66   
ref|XP_009352706.1|  PREDICTED: probable leucine-rich repeat rece...    219   5e-66   
ref|XP_007025268.1|  Leucine-rich repeat transmembrane protein ki...    226   2e-65   
ref|XP_007025266.1|  Leucine-rich repeat transmembrane protein ki...    228   2e-65   
ref|XP_002522279.1|  ATP binding protein, putative                      228   3e-65   
ref|XP_007214549.1|  hypothetical protein PRUPE_ppa001005mg             226   7e-65   
ref|XP_007025267.1|  Leucine-rich repeat transmembrane protein ki...    226   1e-64   
ref|XP_008225260.1|  PREDICTED: probable leucine-rich repeat rece...    225   3e-64   
ref|XP_002528777.1|  ATP binding protein, putative                      225   4e-64   
ref|XP_011046351.1|  PREDICTED: probable LRR receptor-like serine...    224   1e-63   Populus euphratica
ref|XP_007025272.1|  Leucine-rich repeat transmembrane protein ki...    213   4e-63   
ref|XP_011463567.1|  PREDICTED: probable leucine-rich repeat rece...    208   5e-63   Fragaria vesca subsp. vesca
ref|XP_006370932.1|  putative receptor-like protein kinase RLPK1        216   3e-62   
ref|XP_010655576.1|  PREDICTED: probable LRR receptor-like serine...    219   3e-62   Vitis vinifera
ref|XP_010655582.1|  PREDICTED: probable LRR receptor-like serine...    219   3e-62   Vitis vinifera
ref|XP_010655581.1|  PREDICTED: probable LRR receptor-like serine...    219   3e-62   Vitis vinifera
ref|XP_010655580.1|  PREDICTED: probable LRR receptor-like serine...    219   4e-62   Vitis vinifera
gb|KHF97567.1|  hypothetical protein F383_37113                         204   1e-61   Gossypium arboreum [tree cotton]
gb|KJB57354.1|  hypothetical protein B456_009G159400                    216   5e-61   Gossypium raimondii
gb|KJB57365.1|  hypothetical protein B456_009G159500                    216   6e-61   Gossypium raimondii
gb|KJB57353.1|  hypothetical protein B456_009G159400                    216   9e-61   Gossypium raimondii
ref|XP_011461991.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    215   1e-60   Fragaria vesca subsp. vesca
ref|XP_006370935.1|  hypothetical protein POPTR_0019s01920g             203   3e-60   
ref|XP_011470945.1|  PREDICTED: probable leucine-rich repeat rece...    213   6e-60   Fragaria vesca subsp. vesca
ref|XP_010247771.1|  PREDICTED: probable leucine-rich repeat rece...    199   7e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008365058.1|  PREDICTED: probable LRR receptor-like serine...    194   1e-57   
ref|XP_008225417.1|  PREDICTED: probable LRR receptor-like serine...    206   2e-57   Prunus mume [ume]
ref|XP_007214698.1|  hypothetical protein PRUPE_ppa026371mg             205   4e-57   
ref|XP_011460364.1|  PREDICTED: probable LRR receptor-like serine...    205   7e-57   Fragaria vesca subsp. vesca
ref|XP_009351856.1|  PREDICTED: probable LRR receptor-like serine...    203   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_011470946.1|  PREDICTED: probable leucine-rich repeat rece...    203   2e-56   Fragaria vesca subsp. vesca
ref|XP_010248482.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_008342440.1|  PREDICTED: probable leucine-rich repeat rece...    195   4e-56   
ref|XP_011460365.1|  PREDICTED: probable LRR receptor-like serine...    202   6e-56   Fragaria vesca subsp. vesca
ref|XP_008225418.1|  PREDICTED: probable LRR receptor-like serine...    201   2e-55   
ref|XP_008377580.1|  PREDICTED: probable LRR receptor-like serine...    200   4e-55   
ref|XP_006371022.1|  hypothetical protein POPTR_0019s027402g            191   5e-55   
ref|XP_007213678.1|  hypothetical protein PRUPE_ppa000939mg             199   6e-55   
ref|XP_007214035.1|  hypothetical protein PRUPE_ppa017351mg             198   8e-55   
ref|XP_010665665.1|  PREDICTED: probable LRR receptor-like serine...    196   1e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007149525.1|  hypothetical protein PHAVU_005G077500g             186   3e-53   Phaseolus vulgaris [French bean]
ref|XP_002524514.1|  ATP binding protein, putative                      194   7e-53   Ricinus communis
ref|XP_011014230.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-52   Populus euphratica
ref|XP_011014227.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-52   Populus euphratica
ref|XP_011014229.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-52   Populus euphratica
ref|XP_011046365.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-52   Populus euphratica
ref|XP_011046364.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-52   Populus euphratica
ref|XP_011046360.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-52   Populus euphratica
ref|XP_011014228.1|  PREDICTED: probable leucine-rich repeat rece...    192   3e-52   Populus euphratica
ref|XP_011046359.1|  PREDICTED: probable leucine-rich repeat rece...    192   3e-52   Populus euphratica
ref|XP_011046362.1|  PREDICTED: probable leucine-rich repeat rece...    192   4e-52   Populus euphratica
ref|XP_010665666.1|  PREDICTED: probable LRR receptor-like serine...    191   9e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011046350.1|  PREDICTED: probable LRR receptor-like serine...    190   1e-51   Populus euphratica
ref|XP_011046381.1|  PREDICTED: probable leucine-rich repeat rece...    190   1e-51   Populus euphratica
ref|XP_011046349.1|  PREDICTED: probable LRR receptor-like serine...    190   2e-51   Populus euphratica
ref|XP_010273496.1|  PREDICTED: probable leucine-rich repeat rece...    190   2e-51   
ref|XP_010273497.1|  PREDICTED: probable leucine-rich repeat rece...    189   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010273494.1|  PREDICTED: probable leucine-rich repeat rece...    190   2e-51   Nelumbo nucifera [Indian lotus]
gb|KGN55040.1|  hypothetical protein Csa_4G624460                       188   2e-51   
ref|XP_010273493.1|  PREDICTED: probable leucine-rich repeat rece...    189   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_004146082.1|  PREDICTED: probable leucine-rich repeat rece...    189   5e-51   Cucumis sativus [cucumbers]
ref|XP_004162117.1|  PREDICTED: probable leucine-rich repeat rece...    189   5e-51   
gb|EYU38244.1|  hypothetical protein MIMGU_mgv11b008016mg               179   7e-51   Erythranthe guttata [common monkey flower]
gb|KEH19461.1|  LRR receptor-like kinase                                186   3e-50   Medicago truncatula
ref|XP_008366034.1|  PREDICTED: probable LRR receptor-like serine...    186   3e-50   
gb|KHN19486.1|  Putative leucine-rich repeat receptor-like serine...    186   6e-50   Glycine soja [wild soybean]
ref|XP_008356064.1|  PREDICTED: probable LRR receptor-like serine...    178   6e-50   
ref|XP_008463771.1|  PREDICTED: probable leucine-rich repeat rece...    184   1e-49   Cucumis melo [Oriental melon]
ref|XP_010112408.1|  putative leucine-rich repeat receptor-like s...    184   2e-49   
ref|XP_010273495.1|  PREDICTED: probable leucine-rich repeat rece...    184   3e-49   
ref|XP_010272760.1|  PREDICTED: probable leucine-rich repeat rece...    184   3e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002325753.2|  hypothetical protein POPTR_0019s01950g             183   3e-49   
ref|XP_010246510.1|  PREDICTED: probable leucine-rich repeat rece...    183   3e-49   Nelumbo nucifera [Indian lotus]
gb|KDO58609.1|  hypothetical protein CISIN_1g002566mg                   181   4e-49   Citrus sinensis [apfelsine]
ref|XP_006477830.1|  PREDICTED: probable leucine-rich repeat rece...    183   5e-49   Citrus sinensis [apfelsine]
gb|EYU38245.1|  hypothetical protein MIMGU_mgv1a023997mg                176   5e-49   Erythranthe guttata [common monkey flower]
ref|XP_006477832.1|  PREDICTED: probable leucine-rich repeat rece...    183   5e-49   Citrus sinensis [apfelsine]
ref|XP_011082789.1|  PREDICTED: probable leucine-rich repeat rece...    183   5e-49   Sesamum indicum [beniseed]
gb|KDO58608.1|  hypothetical protein CISIN_1g002566mg                   181   5e-49   Citrus sinensis [apfelsine]
ref|XP_010247772.1|  PREDICTED: probable leucine-rich repeat rece...    183   6e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006442357.1|  hypothetical protein CICLE_v10018686mg             182   6e-49   Citrus clementina [clementine]
gb|KDO58607.1|  hypothetical protein CISIN_1g002566mg                   181   7e-49   Citrus sinensis [apfelsine]
ref|XP_011010608.1|  PREDICTED: probable LRR receptor-like serine...    182   7e-49   Populus euphratica
ref|XP_006448023.1|  hypothetical protein CICLE_v10014129mg             181   8e-49   
ref|XP_010691210.1|  PREDICTED: probable leucine-rich repeat rece...    182   8e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO58604.1|  hypothetical protein CISIN_1g002566mg                   181   1e-48   Citrus sinensis [apfelsine]
emb|CDP06041.1|  unnamed protein product                                182   1e-48   Coffea canephora [robusta coffee]
ref|XP_010064485.1|  PREDICTED: probable leucine-rich repeat rece...    182   1e-48   Eucalyptus grandis [rose gum]
ref|XP_002524511.1|  ATP binding protein, putative                      182   1e-48   
gb|KCW67557.1|  hypothetical protein EUGRSUZ_F01307                     181   2e-48   Eucalyptus grandis [rose gum]
ref|XP_004305822.1|  PREDICTED: probable LRR receptor-like serine...    181   2e-48   Fragaria vesca subsp. vesca
ref|XP_011467565.1|  PREDICTED: probable LRR receptor-like serine...    181   2e-48   Fragaria vesca subsp. vesca
ref|XP_010247776.1|  PREDICTED: probable LRR receptor-like serine...    181   2e-48   
gb|KEH38575.1|  cysteine-rich RLK (receptor-like kinase) protein        181   2e-48   Medicago truncatula
ref|XP_006448020.1|  hypothetical protein CICLE_v10014129mg             181   2e-48   Citrus clementina [clementine]
ref|XP_006492254.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    181   3e-48   
ref|XP_010273487.1|  PREDICTED: probable leucine-rich repeat rece...    181   3e-48   
ref|XP_010273490.1|  PREDICTED: probable leucine-rich repeat rece...    181   3e-48   
ref|XP_010273489.1|  PREDICTED: probable leucine-rich repeat rece...    181   3e-48   
ref|XP_007021936.1|  Leucine-rich repeat transmembrane protein ki...    168   4e-48   
ref|XP_010246509.1|  PREDICTED: probable leucine-rich repeat rece...    181   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010273486.1|  PREDICTED: probable leucine-rich repeat rece...    180   4e-48   
ref|XP_010273485.1|  PREDICTED: probable leucine-rich repeat rece...    180   5e-48   
gb|KEH38573.1|  LRR receptor-like kinase                                179   7e-48   Medicago truncatula
gb|KCW75322.1|  hypothetical protein EUGRSUZ_E04068                     172   7e-48   Eucalyptus grandis [rose gum]
gb|KGN47984.1|  hypothetical protein Csa_6G421780                       178   8e-48   
emb|CDP06042.1|  unnamed protein product                                179   8e-48   Coffea canephora [robusta coffee]
ref|XP_006477833.1|  PREDICTED: probable leucine-rich repeat rece...    179   1e-47   Citrus sinensis [apfelsine]
ref|XP_007214913.1|  hypothetical protein PRUPE_ppa000698mg             179   1e-47   
ref|XP_008463778.1|  PREDICTED: probable leucine-rich repeat rece...    179   1e-47   Cucumis melo [Oriental melon]
ref|XP_008229374.1|  PREDICTED: probable LRR receptor-like serine...    179   2e-47   Prunus mume [ume]
gb|KEH38571.1|  cysteine-rich RLK (receptor-like kinase) protein        179   2e-47   Medicago truncatula
ref|XP_006477831.1|  PREDICTED: probable leucine-rich repeat rece...    179   2e-47   
ref|XP_002306015.2|  hypothetical protein POPTR_0004s14310g             178   2e-47   
ref|XP_004140247.1|  PREDICTED: probable LRR receptor-like serine...    178   2e-47   Cucumis sativus [cucumbers]
gb|KJB12990.1|  hypothetical protein B456_002G048900                    177   3e-47   Gossypium raimondii
ref|XP_007021935.1|  Leucine-rich repeat transmembrane protein ki...    178   3e-47   
ref|XP_006592942.1|  PREDICTED: probable leucine-rich repeat rece...    177   4e-47   Glycine max [soybeans]
ref|XP_007025275.1|  Receptor-like kinase in flowers 1, putative        177   4e-47   
ref|XP_010522063.1|  PREDICTED: probable LRR receptor-like serine...    177   4e-47   Tarenaya hassleriana [spider flower]
gb|KJB12989.1|  hypothetical protein B456_002G048900                    177   5e-47   Gossypium raimondii
ref|XP_007021940.1|  Leucine-rich repeat transmembrane protein ki...    177   5e-47   
ref|XP_009135396.1|  PREDICTED: probable leucine-rich repeat rece...    177   5e-47   Brassica rapa
ref|XP_009135397.1|  PREDICTED: probable leucine-rich repeat rece...    177   6e-47   Brassica rapa
ref|XP_010487294.1|  PREDICTED: probable leucine-rich repeat rece...    177   6e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009353452.1|  PREDICTED: probable LRR receptor-like serine...    177   6e-47   
ref|XP_009351815.1|  PREDICTED: probable LRR receptor-like serine...    177   7e-47   Pyrus x bretschneideri [bai li]
ref|XP_003616753.1|  Cysteine-rich receptor-like protein kinase         177   8e-47   Medicago truncatula
ref|XP_008380257.1|  PREDICTED: probable LRR receptor-like serine...    173   8e-47   
emb|CDX82466.1|  BnaA03g33550D                                          177   8e-47   
ref|XP_008449503.1|  PREDICTED: probable LRR receptor-like serine...    177   8e-47   Cucumis melo [Oriental melon]
ref|XP_010093467.1|  hypothetical protein L484_017528                   175   1e-46   
gb|KDO58605.1|  hypothetical protein CISIN_1g002566mg                   175   1e-46   Citrus sinensis [apfelsine]
gb|KEH38568.1|  LRR receptor-like kinase                                174   1e-46   Medicago truncatula
ref|XP_010657080.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-46   Vitis vinifera
ref|XP_010060750.1|  PREDICTED: probable leucine-rich repeat rece...    174   2e-46   
gb|KEH38576.1|  LRR receptor-like kinase                                176   2e-46   Medicago truncatula
ref|XP_008371728.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    176   3e-46   
ref|XP_010272741.1|  PREDICTED: probable LRR receptor-like serine...    175   3e-46   Nelumbo nucifera [Indian lotus]
gb|KEH38566.1|  LRR receptor-like kinase                                174   3e-46   Medicago truncatula
ref|XP_010272742.1|  PREDICTED: probable leucine-rich repeat rece...    175   3e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010465400.1|  PREDICTED: probable leucine-rich repeat rece...    175   4e-46   Camelina sativa [gold-of-pleasure]
gb|KCW67581.1|  hypothetical protein EUGRSUZ_F01338                     164   4e-46   Eucalyptus grandis [rose gum]
ref|XP_007149528.1|  hypothetical protein PHAVU_005G077700g             167   4e-46   Phaseolus vulgaris [French bean]
ref|XP_010060749.1|  PREDICTED: probable leucine-rich repeat rece...    175   4e-46   Eucalyptus grandis [rose gum]
ref|XP_007149537.1|  hypothetical protein PHAVU_005G078500g             175   4e-46   Phaseolus vulgaris [French bean]
ref|XP_010247775.1|  PREDICTED: probable leucine-rich repeat rece...    174   4e-46   
emb|CDP06039.1|  unnamed protein product                                174   4e-46   Coffea canephora [robusta coffee]
gb|KHN36922.1|  Putative leucine-rich repeat receptor-like serine...    174   5e-46   Glycine soja [wild soybean]
gb|ABF70100.1|  protein kinase, putative                                174   6e-46   Musa balbisiana [starchy banana]
ref|XP_004488998.1|  PREDICTED: probable leucine-rich repeat rece...    174   6e-46   Cicer arietinum [garbanzo]
gb|KDP24892.1|  hypothetical protein JCGZ_25154                         167   7e-46   Jatropha curcas
ref|XP_008380254.1|  PREDICTED: probable LRR receptor-like serine...    174   7e-46   
ref|XP_008380255.1|  PREDICTED: probable LRR receptor-like serine...    174   8e-46   
ref|XP_006574177.1|  PREDICTED: probable leucine-rich repeat rece...    174   1e-45   Glycine max [soybeans]
ref|XP_006573362.1|  PREDICTED: probable leucine-rich repeat rece...    171   1e-45   
ref|XP_006573364.1|  PREDICTED: probable leucine-rich repeat rece...    173   1e-45   Glycine max [soybeans]
ref|XP_010272732.1|  PREDICTED: probable LRR receptor-like serine...    173   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_009148012.1|  PREDICTED: probable LRR receptor-like serine...    173   1e-45   Brassica rapa
ref|XP_007142243.1|  hypothetical protein PHAVU_008G264400g             173   2e-45   Phaseolus vulgaris [French bean]
ref|XP_006573361.1|  PREDICTED: probable leucine-rich repeat rece...    173   2e-45   
emb|CDX95138.1|  BnaC05g05330D                                          173   2e-45   
gb|KHN04126.1|  Putative leucine-rich repeat receptor-like serine...    173   2e-45   Glycine soja [wild soybean]
ref|XP_007149531.1|  hypothetical protein PHAVU_005G078000g             165   2e-45   Phaseolus vulgaris [French bean]
ref|XP_007213739.1|  hypothetical protein PRUPE_ppa000808mg             173   2e-45   Prunus persica
gb|KJB33249.1|  hypothetical protein B456_006G003800                    173   2e-45   Gossypium raimondii
gb|KHN36926.1|  Putative leucine-rich repeat receptor-like serine...    162   3e-45   Glycine soja [wild soybean]
ref|XP_009406148.1|  PREDICTED: probable LRR receptor-like serine...    172   3e-45   
ref|XP_008463772.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    172   4e-45   
ref|XP_011470947.1|  PREDICTED: probable leucine-rich repeat rece...    171   4e-45   Fragaria vesca subsp. vesca
ref|NP_001237014.1|  receptor-like protein kinase 2-like precursor      172   4e-45   
ref|XP_004491065.1|  PREDICTED: probable leucine-rich repeat rece...    170   5e-45   
ref|XP_006575671.1|  PREDICTED: probable LRR receptor-like serine...    168   5e-45   
ref|XP_008225259.1|  PREDICTED: probable LRR receptor-like serine...    171   5e-45   
ref|XP_006370080.1|  hypothetical protein POPTR_0001s39360g             171   6e-45   
gb|KFK38835.1|  hypothetical protein AALP_AA3G166500                    172   6e-45   Arabis alpina [alpine rockcress]
ref|XP_009350015.1|  PREDICTED: probable LRR receptor-like serine...    171   6e-45   Pyrus x bretschneideri [bai li]
ref|XP_009135398.1|  PREDICTED: probable leucine-rich repeat rece...    171   6e-45   Brassica rapa
gb|AET00430.2|  LRR receptor-like kinase                                171   7e-45   Medicago truncatula
emb|CDX93632.1|  BnaA06g04160D                                          171   7e-45   
ref|XP_007213636.1|  hypothetical protein PRUPE_ppa001834mg             169   7e-45   
ref|XP_003617471.1|  BED finger-nbs resistance protein                  171   7e-45   
gb|KJB57374.1|  hypothetical protein B456_009G159800                    171   8e-45   Gossypium raimondii
gb|KJB57373.1|  hypothetical protein B456_009G159800                    171   9e-45   Gossypium raimondii
ref|XP_009146321.1|  PREDICTED: probable leucine-rich repeat rece...    171   9e-45   Brassica rapa
gb|KJB57375.1|  hypothetical protein B456_009G159800                    171   1e-44   Gossypium raimondii
emb|CDX97606.1|  BnaA05g24730D                                          171   1e-44   
emb|CDX75791.1|  BnaC03g38740D                                          171   1e-44   
ref|XP_007132111.1|  hypothetical protein PHAVU_011G067400g             171   1e-44   Phaseolus vulgaris [French bean]
ref|XP_009351824.1|  PREDICTED: probable LRR receptor-like serine...    171   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_010064503.1|  PREDICTED: probable leucine-rich repeat rece...    170   1e-44   
emb|CDP18745.1|  unnamed protein product                                171   1e-44   Coffea canephora [robusta coffee]
ref|XP_010502195.1|  PREDICTED: probable leucine-rich repeat rece...    171   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009351806.1|  PREDICTED: probable LRR receptor-like serine...    171   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_009351800.1|  PREDICTED: probable LRR receptor-like serine...    170   1e-44   
ref|XP_008225249.1|  PREDICTED: probable LRR receptor-like serine...    158   2e-44   Prunus mume [ume]
ref|XP_008225244.1|  PREDICTED: probable LRR receptor-like serine...    170   2e-44   Prunus mume [ume]
ref|XP_007048780.1|  Leucine-rich repeat transmembrane protein ki...    170   2e-44   
ref|XP_004162114.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    167   2e-44   
ref|XP_010475530.1|  PREDICTED: probable LRR receptor-like serine...    170   2e-44   Camelina sativa [gold-of-pleasure]
gb|KEH19464.1|  LRR receptor-like kinase                                167   3e-44   Medicago truncatula
ref|XP_010053001.1|  PREDICTED: probable LRR receptor-like serine...    170   3e-44   Eucalyptus grandis [rose gum]
emb|CDX82465.1|  BnaA03g33560D                                          170   3e-44   
ref|XP_008225246.1|  PREDICTED: probable LRR receptor-like serine...    169   3e-44   Prunus mume [ume]
ref|XP_007214198.1|  hypothetical protein PRUPE_ppa022208mg             162   3e-44   
ref|XP_004146079.1|  PREDICTED: probable leucine-rich repeat rece...    169   3e-44   
ref|XP_006407040.1|  hypothetical protein EUTSA_v10019958mg             170   3e-44   
ref|XP_011002767.1|  PREDICTED: probable leucine-rich repeat rece...    169   3e-44   Populus euphratica
gb|KJB66878.1|  hypothetical protein B456_010G162800                    168   3e-44   Gossypium raimondii
ref|XP_010457957.1|  PREDICTED: probable LRR receptor-like serine...    169   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010465401.1|  PREDICTED: probable leucine-rich repeat rece...    169   4e-44   Camelina sativa [gold-of-pleasure]
gb|KFK43084.1|  hypothetical protein AALP_AA1G077200                    158   4e-44   Arabis alpina [alpine rockcress]
ref|XP_010064499.1|  PREDICTED: probable leucine-rich repeat rece...    169   4e-44   
gb|KJB66877.1|  hypothetical protein B456_010G162800                    169   5e-44   Gossypium raimondii
gb|KJB66879.1|  hypothetical protein B456_010G162800                    169   5e-44   Gossypium raimondii
gb|KEH19463.1|  LRR receptor-like kinase                                169   5e-44   Medicago truncatula
emb|CDX82464.1|  BnaA03g33570D                                          168   7e-44   
ref|XP_010094304.1|  putative LRR receptor-like serine/threonine-...    166   7e-44   
ref|XP_003519558.1|  PREDICTED: probable LRR receptor-like serine...    168   7e-44   Glycine max [soybeans]
ref|XP_004491354.1|  PREDICTED: probable LRR receptor-like serine...    168   7e-44   Cicer arietinum [garbanzo]
ref|XP_002283596.2|  PREDICTED: probable leucine-rich repeat rece...    168   1e-43   Vitis vinifera
ref|XP_009352709.1|  PREDICTED: probable LRR receptor-like serine...    168   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_009352707.1|  PREDICTED: probable LRR receptor-like serine...    168   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_009352708.1|  PREDICTED: probable LRR receptor-like serine...    168   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_010064505.1|  PREDICTED: probable leucine-rich repeat rece...    165   1e-43   
ref|XP_010064506.1|  PREDICTED: probable leucine-rich repeat rece...    167   2e-43   
ref|XP_003596246.1|  hypothetical protein MTR_2g075070                  160   2e-43   
ref|XP_009628284.1|  PREDICTED: probable LRR receptor-like serine...    167   2e-43   Nicotiana tomentosiformis
emb|CDX98501.1|  BnaC05g38740D                                          167   2e-43   
gb|KDP20042.1|  hypothetical protein JCGZ_05811                         167   2e-43   Jatropha curcas
ref|XP_010451463.1|  PREDICTED: probable leucine-rich repeat rece...    164   2e-43   
ref|XP_002283578.2|  PREDICTED: probable leucine-rich repeat rece...    167   3e-43   Vitis vinifera
gb|KDP23040.1|  hypothetical protein JCGZ_00505                         159   3e-43   Jatropha curcas
ref|XP_009628281.1|  PREDICTED: probable LRR receptor-like serine...    167   3e-43   Nicotiana tomentosiformis
gb|KCW76051.1|  hypothetical protein EUGRSUZ_D00418                     162   3e-43   Eucalyptus grandis [rose gum]
gb|KHN11945.1|  Putative LRR receptor-like serine/threonine-prote...    166   3e-43   Glycine soja [wild soybean]
gb|AEO14875.1|  rfls6 protein                                           167   3e-43   Glycine max [soybeans]
ref|XP_006358077.1|  PREDICTED: probable LRR receptor-like serine...    166   3e-43   Solanum tuberosum [potatoes]
emb|CDY20088.1|  BnaA01g29140D                                          167   3e-43   
ref|XP_006595488.1|  PREDICTED: receptor-like protein kinase isof...    167   3e-43   
ref|NP_188102.5|  leucine-rich repeat transmembrane protein kinase      166   4e-43   
dbj|BAB02650.1|  receptor-like serine/threonine kinase                  166   4e-43   
ref|XP_009798185.1|  PREDICTED: probable LRR receptor-like serine...    166   4e-43   
ref|XP_010052142.1|  PREDICTED: probable LRR receptor-like serine...    166   4e-43   
ref|XP_009798183.1|  PREDICTED: probable LRR receptor-like serine...    166   4e-43   
ref|XP_009798184.1|  PREDICTED: probable LRR receptor-like serine...    166   4e-43   
gb|KCW89682.1|  hypothetical protein EUGRSUZ_A01951                     164   4e-43   
gb|ABF72026.1|  leucine-rich repeat-containing protein kinase fam...    166   4e-43   
ref|XP_010052141.1|  PREDICTED: probable LRR receptor-like serine...    166   5e-43   
ref|XP_010552132.1|  PREDICTED: probable leucine-rich repeat rece...    166   5e-43   
ref|XP_009359381.1|  PREDICTED: probable leucine-rich repeat rece...    166   5e-43   
ref|XP_007147980.1|  hypothetical protein PHAVU_006G170500g             166   5e-43   
ref|XP_011009652.1|  PREDICTED: probable LRR receptor-like serine...    166   7e-43   
ref|XP_010052144.1|  PREDICTED: probable LRR receptor-like serine...    166   7e-43   
gb|KCW76047.1|  hypothetical protein EUGRSUZ_D00415                     166   7e-43   
ref|XP_004489067.1|  PREDICTED: probable leucine-rich repeat rece...    166   8e-43   
ref|XP_006403470.1|  hypothetical protein EUTSA_v10010902mg             162   8e-43   
ref|XP_004488995.1|  PREDICTED: probable leucine-rich repeat rece...    165   8e-43   
gb|KHG14181.1|  hypothetical protein F383_17326                         155   1e-42   
ref|XP_009628282.1|  PREDICTED: probable LRR receptor-like serine...    165   1e-42   
ref|XP_010059621.1|  PREDICTED: probable leucine-rich repeat rece...    165   1e-42   
ref|XP_010316865.1|  PREDICTED: probable LRR receptor-like serine...    165   1e-42   
ref|XP_002892411.1|  hypothetical protein ARALYDRAFT_470791             165   1e-42   
emb|CBI20121.3|  unnamed protein product                                164   1e-42   
ref|XP_003634703.1|  PREDICTED: probable leucine-rich repeat rece...    165   1e-42   
ref|XP_011098063.1|  PREDICTED: probable LRR receptor-like serine...    165   1e-42   
emb|CDX75792.1|  BnaC03g38750D                                          165   1e-42   
gb|AAK43890.1|AF370513_1  Unknown protein                               159   2e-42   
gb|KCW89681.1|  hypothetical protein EUGRSUZ_A01951                     164   2e-42   
ref|XP_010431689.1|  PREDICTED: probable leucine-rich repeat rece...    164   2e-42   
ref|XP_011002053.1|  PREDICTED: probable LRR receptor-like serine...    164   2e-42   
ref|XP_006388057.1|  hypothetical protein POPTR_0377s00200g             159   2e-42   
ref|XP_006593319.1|  PREDICTED: receptor-like kinase isoform X1         164   2e-42   
ref|XP_006593321.1|  PREDICTED: receptor-like kinase isoform X3         164   2e-42   
ref|XP_006593320.1|  PREDICTED: receptor-like kinase isoform X2         164   2e-42   
ref|XP_011002052.1|  PREDICTED: probable LRR receptor-like serine...    164   2e-42   
ref|XP_009376743.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    164   2e-42   
ref|XP_009116594.1|  PREDICTED: probable leucine-rich repeat rece...    164   2e-42   
ref|XP_004146081.1|  PREDICTED: probable leucine-rich repeat rece...    164   2e-42   
ref|XP_009351836.1|  PREDICTED: probable LRR receptor-like serine...    164   3e-42   
ref|XP_011470949.1|  PREDICTED: probable LRR receptor-like serine...    164   3e-42   
ref|XP_010412785.1|  PREDICTED: probable LRR receptor-like serine...    156   4e-42   
gb|KJB66882.1|  hypothetical protein B456_010G162800                    163   4e-42   
gb|AES66496.2|  LRR receptor-like kinase                                163   4e-42   
ref|XP_006358136.1|  PREDICTED: probable LRR receptor-like serine...    151   4e-42   
ref|XP_006467587.1|  PREDICTED: probable LRR receptor-like serine...    160   5e-42   
ref|XP_009359378.1|  PREDICTED: probable leucine-rich repeat rece...    163   5e-42   
emb|CBI20124.3|  unnamed protein product                                163   5e-42   
gb|KHN36923.1|  Putative leucine-rich repeat receptor-like serine...    154   6e-42   
ref|XP_007025273.1|  ATP binding protein, putative isoform 1            163   6e-42   
ref|XP_008226375.1|  PREDICTED: probable leucine-rich repeat rece...    163   6e-42   
ref|XP_011470944.1|  PREDICTED: probable LRR receptor-like serine...    163   6e-42   
ref|XP_006348929.1|  PREDICTED: probable LRR receptor-like serine...    163   7e-42   
ref|XP_009359377.1|  PREDICTED: probable leucine-rich repeat rece...    162   7e-42   
ref|XP_003596231.1|  Leucine-rich repeat family protein / protein...    162   8e-42   
ref|XP_006593302.1|  PREDICTED: probable leucine-rich repeat rece...    162   8e-42   
gb|AES66482.2|  LRR receptor-like kinase                                162   8e-42   
ref|XP_010112411.1|  putative LRR receptor-like serine/threonine-...    162   9e-42   
ref|XP_004162116.1|  PREDICTED: probable leucine-rich repeat rece...    153   1e-41   
gb|KEH38584.1|  LRR receptor-like kinase                                161   1e-41   
ref|XP_003596244.1|  Receptor-like serine/threonine kinase              162   1e-41   
gb|AES66495.2|  LRR receptor-like kinase                                162   1e-41   
ref|XP_004243241.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-41   
ref|XP_011101923.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    161   1e-41   
emb|CBI20127.3|  unnamed protein product                                161   1e-41   
ref|XP_004309619.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-41   
ref|XP_009359382.1|  PREDICTED: probable leucine-rich repeat rece...    162   1e-41   
ref|XP_008356066.1|  PREDICTED: probable LRR receptor-like serine...    157   2e-41   
ref|XP_010916505.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
ref|XP_006467585.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
emb|CDY32338.1|  BnaC01g36570D                                          162   2e-41   
ref|XP_011460818.1|  PREDICTED: probable leucine-rich repeat rece...    161   2e-41   
ref|XP_009146320.1|  PREDICTED: probable leucine-rich repeat rece...    161   2e-41   
ref|XP_009334011.1|  PREDICTED: probable leucine-rich repeat rece...    161   2e-41   
ref|XP_009334010.1|  PREDICTED: probable leucine-rich repeat rece...    161   3e-41   
ref|XP_006371018.1|  hypothetical protein POPTR_0019s027002g            154   3e-41   
ref|XP_009146317.1|  PREDICTED: probable leucine-rich repeat rece...    161   3e-41   
ref|XP_010436541.1|  PREDICTED: probable leucine-rich repeat rece...    158   4e-41   
ref|XP_008792302.1|  PREDICTED: probable LRR receptor-like serine...    160   4e-41   
ref|XP_011460821.1|  PREDICTED: probable leucine-rich repeat rece...    160   4e-41   
ref|XP_009351793.1|  PREDICTED: probable LRR receptor-like serine...    160   5e-41   
ref|XP_010916533.1|  PREDICTED: probable LRR receptor-like serine...    160   5e-41   
ref|NP_172244.2|  leucine-rich repeat transmembrane protein kinase      160   6e-41   
ref|XP_006449566.1|  hypothetical protein CICLE_v10014125mg             160   6e-41   
ref|XP_009802917.1|  PREDICTED: probable LRR receptor-like serine...    160   8e-41   
ref|XP_011085313.1|  PREDICTED: probable LRR receptor-like serine...    160   8e-41   
ref|XP_011085314.1|  PREDICTED: probable LRR receptor-like serine...    160   8e-41   
ref|XP_010916525.1|  PREDICTED: probable LRR receptor-like serine...    160   8e-41   
ref|XP_009802916.1|  PREDICTED: probable LRR receptor-like serine...    160   8e-41   
ref|XP_009802915.1|  PREDICTED: probable LRR receptor-like serine...    159   9e-41   
gb|EYU28129.1|  hypothetical protein MIMGU_mgv1a025582mg                159   1e-40   
gb|KDP21156.1|  hypothetical protein JCGZ_21627                         159   1e-40   
ref|XP_007149536.1|  hypothetical protein PHAVU_005G078400g             159   1e-40   
ref|XP_008226376.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-40   
emb|CDX97610.1|  BnaA05g24690D                                          159   2e-40   
gb|KHN38301.1|  Putative LRR receptor-like serine/threonine-prote...    158   2e-40   
gb|KEH38578.1|  LRR receptor-like kinase                                157   2e-40   
ref|XP_004504262.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    158   3e-40   
ref|XP_008226401.1|  PREDICTED: probable leucine-rich repeat rece...    152   3e-40   
gb|KEH38577.1|  LRR receptor-like kinase                                158   4e-40   
ref|XP_008371517.1|  PREDICTED: probable LRR receptor-like serine...    157   4e-40   
ref|XP_010921615.1|  PREDICTED: probable LRR receptor-like serine...    157   5e-40   
ref|XP_009603857.1|  PREDICTED: probable LRR receptor-like serine...    157   5e-40   
gb|KJB66875.1|  hypothetical protein B456_010G162700                    156   5e-40   
ref|XP_009603858.1|  PREDICTED: probable LRR receptor-like serine...    157   5e-40   
ref|XP_007025270.1|  Leucine-rich repeat transmembrane protein ki...    157   5e-40   
ref|XP_003596241.1|  LRR receptor-like serine/threonine-protein k...    154   6e-40   
ref|XP_010064515.1|  PREDICTED: probable leucine-rich repeat rece...    157   6e-40   
ref|XP_010064513.1|  PREDICTED: probable leucine-rich repeat rece...    157   6e-40   
emb|CDY49084.1|  BnaC06g12340D                                          148   7e-40   
ref|XP_010418194.1|  PREDICTED: probable leucine-rich repeat rece...    157   7e-40   
gb|KHN06436.1|  Putative LRR receptor-like serine/threonine-prote...    157   8e-40   
ref|XP_010655556.1|  PREDICTED: probable LRR receptor-like serine...    157   8e-40   
gb|KJB66881.1|  hypothetical protein B456_010G162800                    156   1e-39   
gb|KJB66876.1|  hypothetical protein B456_010G162700                    156   1e-39   
ref|XP_010064502.1|  PREDICTED: probable leucine-rich repeat rece...    156   2e-39   
gb|AES66493.2|  LRR receptor-like kinase                                156   2e-39   
ref|XP_003596242.1|  Cysteine-rich receptor-like protein kinase         155   2e-39   
ref|XP_011039371.1|  PREDICTED: probable LRR receptor-like serine...    155   2e-39   
ref|XP_006594719.1|  PREDICTED: probable leucine-rich repeat rece...    155   2e-39   
ref|XP_010665667.1|  PREDICTED: probable LRR receptor-like serine...    155   2e-39   
gb|AES66492.2|  LRR receptor-like kinase                                155   4e-39   
ref|XP_006415550.1|  hypothetical protein EUTSA_v10006670mg             155   4e-39   
ref|XP_008795771.1|  PREDICTED: probable LRR receptor-like serine...    155   4e-39   
ref|XP_008795773.1|  PREDICTED: probable LRR receptor-like serine...    155   4e-39   
ref|XP_006290552.1|  hypothetical protein CARUB_v10016637mg             154   5e-39   
ref|XP_010924705.1|  PREDICTED: probable LRR receptor-like serine...    154   6e-39   
ref|XP_010924703.1|  PREDICTED: probable LRR receptor-like serine...    154   1e-38   
ref|NP_001184930.1|  leucine-rich repeat transmembrane protein ki...    153   1e-38   
gb|KFK44806.1|  hypothetical protein AALP_AA1G305200                    154   1e-38   
ref|XP_002305716.2|  hypothetical protein POPTR_0004s06180g             153   2e-38   
ref|XP_002522276.1|  kinase, putative                                   154   2e-38   
ref|XP_011009653.1|  PREDICTED: probable LRR receptor-like serine...    153   2e-38   
ref|XP_006377502.1|  hypothetical protein POPTR_0011s06500g             146   2e-38   
ref|XP_004295664.2|  PREDICTED: probable leucine-rich repeat rece...    152   3e-38   
ref|XP_002317385.1|  hypothetical protein POPTR_0011s06740g             152   4e-38   
ref|XP_011009658.1|  PREDICTED: probable LRR receptor-like serine...    152   5e-38   
ref|XP_011009661.1|  PREDICTED: probable LRR receptor-like serine...    152   5e-38   
ref|XP_011009660.1|  PREDICTED: probable LRR receptor-like serine...    152   6e-38   
ref|XP_010057164.1|  PREDICTED: probable LRR receptor-like serine...    151   8e-38   
ref|XP_010665670.1|  PREDICTED: probable LRR receptor-like serine...    151   8e-38   
emb|CAN81177.1|  hypothetical protein VITISV_011951                     150   8e-38   
ref|XP_010057167.1|  PREDICTED: probable LRR receptor-like serine...    151   8e-38   
ref|XP_010057166.1|  PREDICTED: probable LRR receptor-like serine...    151   8e-38   
ref|XP_007159497.1|  hypothetical protein PHAVU_002G242600g             151   9e-38   
ref|XP_009406149.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-37   
ref|XP_006296889.1|  hypothetical protein CARUB_v10012882mg             151   1e-37   
gb|KCW48258.1|  hypothetical protein EUGRSUZ_K01987                     150   1e-37   
ref|XP_008443626.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-37   
ref|XP_008443627.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-37   
ref|XP_006306823.1|  hypothetical protein CARUB_v10008366mg             149   1e-37   
ref|XP_009125086.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-37   
ref|XP_006377460.1|  hypothetical protein POPTR_0011s06140g             142   1e-37   
ref|XP_002882896.1|  leucine-rich repeat family protein                 150   2e-37   
ref|XP_009125083.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_009125085.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_009125082.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_010316862.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_009125084.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_010916565.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_010655573.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
gb|AET04342.2|  LRR receptor-like Serine/Threonine-kinase RFK1, p...    150   2e-37   
ref|XP_010316863.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_010655571.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_010655572.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_003629866.1|  ATP-binding/protein serine/threonine kinase        150   2e-37   
emb|CDX90208.1|  BnaA08g17760D                                          149   3e-37   
ref|XP_006467586.1|  PREDICTED: probable LRR receptor-like serine...    142   3e-37   
ref|XP_011460817.1|  PREDICTED: probable leucine-rich repeat rece...    149   3e-37   
emb|CBI30740.3|  unnamed protein product                                149   3e-37   
ref|XP_010060737.1|  PREDICTED: probable leucine-rich repeat rece...    149   4e-37   
emb|CDX99850.1|  BnaC05g22720D                                          149   4e-37   
ref|XP_006358079.1|  PREDICTED: probable LRR receptor-like serine...    149   4e-37   
gb|KCW67560.1|  hypothetical protein EUGRSUZ_F013102                    149   4e-37   
ref|XP_008775543.1|  PREDICTED: probable LRR receptor-like serine...    149   4e-37   
ref|XP_008775542.1|  PREDICTED: probable LRR receptor-like serine...    149   5e-37   
emb|CDY35279.1|  BnaC03g59440D                                          149   5e-37   
ref|XP_002305711.2|  RECEPTOR-LIKE KINASE IN FLOWERS 1 family pro...    149   6e-37   
ref|XP_010038884.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    149   7e-37   
ref|XP_002522277.1|  ATP binding protein, putative                      148   7e-37   
ref|XP_003596253.1|  Receptor protein kinase-like protein               146   8e-37   
gb|AES66504.2|  receptor-like kinase                                    145   1e-36   
ref|XP_009109645.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-36   
ref|XP_009109644.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-36   
ref|XP_010059064.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-36   
emb|CDY26316.1|  BnaA09g26670D                                          148   1e-36   
ref|XP_009115218.1|  PREDICTED: probable LRR receptor-like serine...    147   1e-36   
gb|KCW74192.1|  hypothetical protein EUGRSUZ_E02840                     147   1e-36   
gb|KJB12987.1|  hypothetical protein B456_002G048800                    147   2e-36   
gb|KJB12988.1|  hypothetical protein B456_002G048800                    147   2e-36   
ref|XP_010057162.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-36   
gb|KCW74196.1|  hypothetical protein EUGRSUZ_E02844                     147   2e-36   
ref|XP_006377524.1|  hypothetical protein POPTR_0011s06690g             139   2e-36   
dbj|BAD27712.1|  disease resistance protein Cf-2.1-like                 145   4e-36   
ref|XP_010549454.1|  PREDICTED: probable LRR receptor-like serine...    146   5e-36   
ref|XP_010549453.1|  PREDICTED: probable LRR receptor-like serine...    146   5e-36   
gb|AGW52154.1|  RKF                                                     146   5e-36   
ref|XP_010549455.1|  PREDICTED: probable LRR receptor-like serine...    146   5e-36   
ref|XP_010549447.1|  PREDICTED: probable LRR receptor-like serine...    146   5e-36   
ref|XP_011009659.1|  PREDICTED: probable LRR receptor-like serine...    146   6e-36   
ref|XP_006388681.1|  hypothetical protein POPTR_0122s00200g             139   7e-36   
ref|XP_004951379.1|  PREDICTED: probable LRR receptor-like serine...    144   9e-36   
ref|XP_006377473.1|  hypothetical protein POPTR_0011s06270g             140   9e-36   
ref|XP_010540544.1|  PREDICTED: probable LRR receptor-like serine...    145   1e-35   
gb|EEC72788.1|  hypothetical protein OsI_06468                          145   1e-35   
ref|XP_010540545.1|  PREDICTED: probable LRR receptor-like serine...    145   1e-35   
ref|XP_004951375.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
ref|XP_004951374.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
ref|XP_010487293.1|  PREDICTED: probable leucine-rich repeat rece...    144   2e-35   
ref|XP_004951373.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
emb|CDP06038.1|  unnamed protein product                                144   2e-35   
ref|XP_009788430.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
gb|EEE56614.1|  hypothetical protein OsJ_05994                          144   2e-35   
ref|XP_009604354.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
ref|XP_009788429.1|  PREDICTED: probable LRR receptor-like serine...    144   3e-35   
ref|XP_004951371.1|  PREDICTED: probable LRR receptor-like serine...    144   3e-35   
ref|XP_004951372.1|  PREDICTED: probable LRR receptor-like serine...    144   3e-35   
ref|XP_010655557.1|  PREDICTED: probable LRR receptor-like serine...    143   4e-35   
gb|KGN65595.1|  hypothetical protein Csa_1G467150                       143   5e-35   



>ref|XP_011102070.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Sesamum indicum]
Length=353

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            AQ+GHL  +E NAL+E+A ++GKKDWDF +NPC+ NSNW TP+R DMP YNN++ CNCS+
Sbjct  12   AQNGHLLEEEKNALREVAVQLGKKDWDFNLNPCDGNSNWTTPKRNDMPWYNNSVICNCSY  71

Query  323  PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVT  502
            P  +CHV+ I L+GQDL GVLPP+L KLPFLK ID++R+YLSGTIPPEWA  KL+Y+SVT
Sbjct  72   PGEVCHVEKIFLKGQDLAGVLPPSLAKLPFLKTIDLTRNYLSGTIPPEWALTKLKYMSVT  131

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
            VNRLSGP+P+YLGNITTLVY++LENN+FNG VP EL KL  L+NLILS N LTGELP EL
Sbjct  132  VNRLSGPLPEYLGNITTLVYMSLENNLFNGMVPAELGKLTKLENLILSANNLTGELPMEL  191

Query  683  NSL  691
            N+L
Sbjct  192  NNL  194


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 61/115 (53%), Gaps = 6/115 (5%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPT---LVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVN  508
            ++Q + LQ    +G +P +   L  L  L+I D++    +   PP    +K+  + +   
Sbjct  219  NLQKLELQASGFEGPIPSSISVLKNLSELRISDLNGG--ASQFPPLKDMIKMNKLMLRSC  276

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +SG IP YL  ++ L+ L+L  N   G + P L  L+ L+ + L+GN+LTG +P
Sbjct  277  NISGKIPSYLVKMSALMILDLSFNKLEGEI-PNLEALSGLEIMYLTGNFLTGPIP  330



>ref|XP_011101928.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Sesamum indicum]
Length=815

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            AQ+GHL  +E NAL+E+A ++GKKDWDF +NPC+ NSNW TP+R DMP YNN++ CNCS+
Sbjct  12   AQNGHLLEEEKNALREVAVQLGKKDWDFNLNPCDGNSNWTTPKRNDMPWYNNSVICNCSY  71

Query  323  PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVT  502
            P  +CHV+ I L+GQDL GVLPP+L KLPFLK ID++R+YLSGTIPPEWA  KL+Y+SVT
Sbjct  72   PGEVCHVEKIFLKGQDLAGVLPPSLAKLPFLKTIDLTRNYLSGTIPPEWALTKLKYMSVT  131

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
            VNRLSGP+P+YLGNITTLVY++LENN+FNG VP EL KL  L+NLILS N LTGELP EL
Sbjct  132  VNRLSGPLPEYLGNITTLVYMSLENNLFNGMVPAELGKLTKLENLILSANNLTGELPMEL  191

Query  683  NSL  691
            N+L
Sbjct  192  NNL  194



>ref|XP_009795509.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana sylvestris]
Length=757

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F A  +EAQS  LP DE++ALKEIA E+GKKDWDF+ NPC+ NSNW TP+RKDMP YNNT
Sbjct  18   FTAGNIEAQSSQLPKDEVDALKEIATELGKKDWDFKQNPCDGNSNWSTPKRKDMPLYNNT  77

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            L CNC+ P G+CHVQSI L+GQDL GVLP +L KLP+LK ID +R+YLSGTIPPEWAS K
Sbjct  78   LVCNCTSPDGLCHVQSIFLKGQDLAGVLPSSLAKLPYLKKIDFNRNYLSGTIPPEWASTK  137

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE++ V+ NRLSGPIP+Y+GN+T+L  ++LE N+FNG++P E+ KL NLQNL+LS N  T
Sbjct  138  LEFMVVSANRLSGPIPEYIGNMTSLTVMSLETNLFNGSLPVEVGKLVNLQNLVLSANNFT  197

Query  662  GELPKELNSLT  694
            GE P ELN+LT
Sbjct  198  GEWPVELNNLT  208



>ref|XP_009795508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana sylvestris]
Length=1003

 Score =   278 bits (710),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F A  +EAQS  LP DE++ALKEIA E+GKKDWDF+ NPC+ NSNW TP+RKDMP YNNT
Sbjct  18   FTAGNIEAQSSQLPKDEVDALKEIATELGKKDWDFKQNPCDGNSNWSTPKRKDMPLYNNT  77

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            L CNC+ P G+CHVQSI L+GQDL GVLP +L KLP+LK ID +R+YLSGTIPPEWAS K
Sbjct  78   LVCNCTSPDGLCHVQSIFLKGQDLAGVLPSSLAKLPYLKKIDFNRNYLSGTIPPEWASTK  137

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE++ V+ NRLSGPIP+Y+GN+T+L  ++LE N+FNG++P E+ KL NLQNL+LS N  T
Sbjct  138  LEFMVVSANRLSGPIPEYIGNMTSLTVMSLETNLFNGSLPVEVGKLVNLQNLVLSANNFT  197

Query  662  GELPKELNSLT  694
            GE P ELN+LT
Sbjct  198  GEWPVELNNLT  208



>emb|CDO96888.1| unnamed protein product [Coffea canephora]
Length=1019

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 158/206 (77%), Gaps = 15/206 (7%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F A   EAQSG LP  E++ALKEIA ++GKKDW+F +NPC+ NSNW T  R DMP YNN+
Sbjct  27   FQASCSEAQSGFLPEQEVDALKEIASQLGKKDWNFSLNPCDGNSNWNTSRRIDMPLYNNS  86

Query  302  LTCNCSFPAGICHVQSII---------------LQGQDLQGVLPPTLVKLPFLKIIDISR  436
            + CNCSFP G+CHV  I                L+GQ+LQGVLPP+L KLP+L  ID++R
Sbjct  87   VICNCSFPGGVCHVTKIFRFQSLSCYLILCHRFLKGQNLQGVLPPSLAKLPYLNTIDLTR  146

Query  437  SYLSGTIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAK  616
            +YLSGTIP EWAS +LEY+SV VNRLSGPIP YLGN+ TLVY++LENNMFNGTVP EL K
Sbjct  147  NYLSGTIPLEWASTQLEYLSVIVNRLSGPIPGYLGNLKTLVYMSLENNMFNGTVPAELGK  206

Query  617  LANLQNLILSGNYLTGELPKELNSLT  694
            L NL+NLIL+ N LTG+LPKELN+LT
Sbjct  207  LVNLENLILNANNLTGQLPKELNNLT  232



>ref|XP_009600348.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana tomentosiformis]
Length=993

 Score =   272 bits (696),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F A  +EAQSG LP DE+ ALKEIA ++GKKDWDF+ NPC+ NSNW TP+R DMP YNNT
Sbjct  18   FTAGNIEAQSGQLPKDEVEALKEIATQLGKKDWDFKQNPCDGNSNWSTPKRNDMPLYNNT  77

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            L CNC+ P G+CHVQSI L+GQDL GVLP +L KLP+LK ID +R++LSGTIPPEWAS K
Sbjct  78   LVCNCTSPDGLCHVQSIFLKGQDLAGVLPASLAKLPYLKKIDFNRNFLSGTIPPEWASTK  137

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE++ ++ NRL+GPIP+Y+GN+T+L  ++LE N+FNG+ P E+  L NLQNL+LS N  T
Sbjct  138  LEFMVISTNRLAGPIPEYIGNMTSLTVMSLETNLFNGSFPAEVGNLVNLQNLVLSANNFT  197

Query  662  GELPKELNSLT  694
            GE P ELN+LT
Sbjct  198  GEWPVELNNLT  208



>ref|XP_009600347.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana tomentosiformis]
Length=1003

 Score =   272 bits (695),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F A  +EAQSG LP DE+ ALKEIA ++GKKDWDF+ NPC+ NSNW TP+R DMP YNNT
Sbjct  18   FTAGNIEAQSGQLPKDEVEALKEIATQLGKKDWDFKQNPCDGNSNWSTPKRNDMPLYNNT  77

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            L CNC+ P G+CHVQSI L+GQDL GVLP +L KLP+LK ID +R++LSGTIPPEWAS K
Sbjct  78   LVCNCTSPDGLCHVQSIFLKGQDLAGVLPASLAKLPYLKKIDFNRNFLSGTIPPEWASTK  137

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE++ ++ NRL+GPIP+Y+GN+T+L  ++LE N+FNG+ P E+  L NLQNL+LS N  T
Sbjct  138  LEFMVISTNRLAGPIPEYIGNMTSLTVMSLETNLFNGSFPAEVGNLVNLQNLVLSANNFT  197

Query  662  GELPKELNSLT  694
            GE P ELN+LT
Sbjct  198  GEWPVELNNLT  208



>ref|XP_010655579.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Vitis vinifera]
Length=844

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            +AQ G LP DE+ AL EIA++VGKKDWDF +NPC+ N+NW TP+RK+MP YNNTLTCNCS
Sbjct  28   KAQGGRLPDDEVEALHEIAEQVGKKDWDFSLNPCDGNANWSTPKRKEMPLYNNTLTCNCS  87

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            +P G CHV  I L+GQDL GVLPP+L KLP+LK+ID +R+YLSG IP EWASM+LEY+S+
Sbjct  88   YPNGQCHVVQIFLKGQDLAGVLPPSLEKLPYLKMIDFTRNYLSGNIPHEWASMQLEYLSL  147

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            TVNRLSGPIP +LGNITTL Y++LE+N+F+GTVP +L +L NL+NLIL+ N LTGELP  
Sbjct  148  TVNRLSGPIPSFLGNITTLRYMSLESNLFSGTVPHQLWQLVNLENLILNTNNLTGELPPT  207

Query  680  LNSLT  694
            L +LT
Sbjct  208  LANLT  212


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 65/139 (47%), Gaps = 25/139 (18%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVN  508
            + +++++IL   +L G LPPTL  L  L    IS +  +G IP    S K L+ + +  +
Sbjct  187  LVNLENLILNTNNLTGELPPTLANLTKLTEFRISSNNFTGKIPNFIHSWKQLQKLEIQAS  246

Query  509  RLSGPIP------------------------KYLGNITTLVYLNLENNMFNGTVPPELAK  616
             L GPIP                          LGN+T +  L L+     G++P +LAK
Sbjct  247  GLEGPIPFSISVLKNLTELRISDLPGEGSNFPSLGNMTGMKRLMLKGCNIFGSIPKDLAK  306

Query  617  LANLQNLILSGNYLTGELP  673
            +  LQ L LS N L G +P
Sbjct  307  MTELQILDLSFNKLEGTVP  325



>ref|XP_010655577.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
Length=891

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            +AQ G LP DE+ AL EIA++VGKKDWDF +NPC+ N+NW TP+RK+MP YNNTLTCNCS
Sbjct  28   KAQGGRLPDDEVEALHEIAEQVGKKDWDFSLNPCDGNANWSTPKRKEMPLYNNTLTCNCS  87

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            +P G CHV  I L+GQDL GVLPP+L KLP+LK+ID +R+YLSG IP EWASM+LEY+S+
Sbjct  88   YPNGQCHVVQIFLKGQDLAGVLPPSLEKLPYLKMIDFTRNYLSGNIPHEWASMQLEYLSL  147

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            TVNRLSGPIP +LGNITTL Y++LE+N+F+GTVP +L +L NL+NLIL+ N LTGELP  
Sbjct  148  TVNRLSGPIPSFLGNITTLRYMSLESNLFSGTVPHQLWQLVNLENLILNTNNLTGELPPT  207

Query  680  LNSLT  694
            L +LT
Sbjct  208  LANLT  212


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 65/139 (47%), Gaps = 25/139 (18%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVN  508
            + +++++IL   +L G LPPTL  L  L    IS +  +G IP    S K L+ + +  +
Sbjct  187  LVNLENLILNTNNLTGELPPTLANLTKLTEFRISSNNFTGKIPNFIHSWKQLQKLEIQAS  246

Query  509  RLSGPIP------------------------KYLGNITTLVYLNLENNMFNGTVPPELAK  616
             L GPIP                          LGN+T +  L L+     G++P +LAK
Sbjct  247  GLEGPIPFSISVLKNLTELRISDLPGEGSNFPSLGNMTGMKRLMLKGCNIFGSIPKDLAK  306

Query  617  LANLQNLILSGNYLTGELP  673
            +  LQ L LS N L G +P
Sbjct  307  MTELQILDLSFNKLEGTVP  325



>ref|XP_010655575.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=986

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            +AQ G LP DE+ AL EIA++VGKKDWDF +NPC+ N+NW TP+RK+MP YNNTLTCNCS
Sbjct  28   KAQGGRLPDDEVEALHEIAEQVGKKDWDFSLNPCDGNANWSTPKRKEMPLYNNTLTCNCS  87

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            +P G CHV  I L+GQDL GVLPP+L KLP+LK+ID +R+YLSG IP EWASM+LEY+S+
Sbjct  88   YPNGQCHVVQIFLKGQDLAGVLPPSLEKLPYLKMIDFTRNYLSGNIPHEWASMQLEYLSL  147

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            TVNRLSGPIP +LGNITTL Y++LE+N+F+GTVP +L +L NL+NLIL+ N LTGELP  
Sbjct  148  TVNRLSGPIPSFLGNITTLRYMSLESNLFSGTVPHQLWQLVNLENLILNTNNLTGELPPT  207

Query  680  LNSLT  694
            L +LT
Sbjct  208  LANLT  212


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 65/139 (47%), Gaps = 25/139 (18%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVN  508
            + +++++IL   +L G LPPTL  L  L    IS +  +G IP    S K L+ + +  +
Sbjct  187  LVNLENLILNTNNLTGELPPTLANLTKLTEFRISSNNFTGKIPNFIHSWKQLQKLEIQAS  246

Query  509  RLSGPIP------------------------KYLGNITTLVYLNLENNMFNGTVPPELAK  616
             L GPIP                          LGN+T +  L L+     G++P +LAK
Sbjct  247  GLEGPIPFSISVLKNLTELRISDLPGEGSNFPSLGNMTGMKRLMLKGCNIFGSIPKDLAK  306

Query  617  LANLQNLILSGNYLTGELP  673
            +  LQ L LS N L G +P
Sbjct  307  MTELQILDLSFNKLEGTVP  325



>ref|XP_010655574.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
 emb|CBI30746.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score =   270 bits (689),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            +AQ G LP DE+ AL EIA++VGKKDWDF +NPC+ N+NW TP+RK+MP YNNTLTCNCS
Sbjct  28   KAQGGRLPDDEVEALHEIAEQVGKKDWDFSLNPCDGNANWSTPKRKEMPLYNNTLTCNCS  87

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            +P G CHV  I L+GQDL GVLPP+L KLP+LK+ID +R+YLSG IP EWASM+LEY+S+
Sbjct  88   YPNGQCHVVQIFLKGQDLAGVLPPSLEKLPYLKMIDFTRNYLSGNIPHEWASMQLEYLSL  147

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            TVNRLSGPIP +LGNITTL Y++LE+N+F+GTVP +L +L NL+NLIL+ N LTGELP  
Sbjct  148  TVNRLSGPIPSFLGNITTLRYMSLESNLFSGTVPHQLWQLVNLENLILNTNNLTGELPPT  207

Query  680  LNSLT  694
            L +LT
Sbjct  208  LANLT  212


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 65/139 (47%), Gaps = 25/139 (18%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVN  508
            + +++++IL   +L G LPPTL  L  L    IS +  +G IP    S K L+ + +  +
Sbjct  187  LVNLENLILNTNNLTGELPPTLANLTKLTEFRISSNNFTGKIPNFIHSWKQLQKLEIQAS  246

Query  509  RLSGPIP------------------------KYLGNITTLVYLNLENNMFNGTVPPELAK  616
             L GPIP                          LGN+T +  L L+     G++P +LAK
Sbjct  247  GLEGPIPFSISVLKNLTELRISDLPGEGSNFPSLGNMTGMKRLMLKGCNIFGSIPKDLAK  306

Query  617  LANLQNLILSGNYLTGELP  673
            +  LQ L LS N L G +P
Sbjct  307  MTELQILDLSFNKLEGTVP  325



>ref|XP_006358134.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=1028

 Score =   268 bits (686),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 158/194 (81%), Gaps = 2/194 (1%)
 Frame = +2

Query  119  SFNARFLEAQ--SGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAY  292
            SF  + +EAQ  S  LP  E NALKEIA+++GKKDWDF +NPC+ N+NW TP+   +  Y
Sbjct  22   SFAVQIIEAQGYSRLLPQQEKNALKEIAEQMGKKDWDFDLNPCDGNTNWTTPKVDKISMY  81

Query  293  NNTLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWA  472
             N +TCNCS P G CHVQSI+L+GQDL GVLPP+LVKLP+LK ID++ +YLSGTIPPEWA
Sbjct  82   VNNITCNCSTPDGFCHVQSILLKGQDLAGVLPPSLVKLPYLKTIDVALNYLSGTIPPEWA  141

Query  473  SMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGN  652
            S+KLE++SV VN+LSGPIPKYLGN+TTL Y++LENNMFNGTVP EL  + NLQ+L LS N
Sbjct  142  SIKLEFMSVMVNQLSGPIPKYLGNMTTLRYMSLENNMFNGTVPKELGNMVNLQSLTLSFN  201

Query  653  YLTGELPKELNSLT  694
             LTG+LP+E+N LT
Sbjct  202  NLTGKLPEEVNKLT  215


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIP  529
            ++L+  +L G +P  +  +P LKI+D+S + L G IP      +LE + +T NRL+GPI 
Sbjct  291  LMLRSCNLSGKIPSYIANMPQLKILDLSFNRLEGQIPDLENQDRLELLYLTSNRLTGPIQ  350

Query  530  KYLGNITTLVYLNLENNMFNGTVPP  604
             ++ +  +   ++L  N FN +  P
Sbjct  351  DWIKSRNSKYVIDLSYNNFNESSVP  375



>ref|XP_010316867.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=998

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = +2

Query  128  ARFLEAQSGH--LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
             + +EAQS    LP  E NALKEIA+++GKKDWDF +NPC  N+NW TP+   +  Y N 
Sbjct  25   VQIIEAQSYSRLLPQQEKNALKEIAEQLGKKDWDFDLNPCNGNTNWTTPKIDKISMYVNN  84

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            +TCNC+ P G CHVQSI+L+GQDL GVLPP+LVKLP+LK ID++ +YLSGTIPPEWAS+K
Sbjct  85   VTCNCATPDGFCHVQSILLKGQDLAGVLPPSLVKLPYLKTIDVALNYLSGTIPPEWASIK  144

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE++SV VN+LSGPIPKYLGN+TTL Y++LENNMFNGTVP EL  + NLQ+L LS N LT
Sbjct  145  LEFMSVMVNQLSGPIPKYLGNMTTLRYMSLENNMFNGTVPKELGNMVNLQSLTLSFNNLT  204

Query  662  GELPKELNSLT  694
            G+LPKE+N LT
Sbjct  205  GKLPKEVNKLT  215



>ref|XP_006358075.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X1 [Solanum tuberosum]
Length=1002

 Score =   264 bits (674),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F A  +EAQ+G LP DE+ AL+EIAD++GKKDWDF++NPC+ NSNW TP+RKDMP YNNT
Sbjct  18   FTAGNIEAQTGQLPKDEVKALREIADQLGKKDWDFKLNPCDGNSNWSTPKRKDMPLYNNT  77

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            L CNC+FP  +CHV++I L+GQ+L GVLP +L KLP+LK ID++R+YLSGTIPPEWAS K
Sbjct  78   LECNCTFPDNLCHVENIFLKGQNLSGVLPASLAKLPYLKKIDLNRNYLSGTIPPEWASTK  137

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE ++++ NRLSG +P+Y+GN+T LV L+LE N+FNG++P E+  L NLQ L L  N  T
Sbjct  138  LELMAISNNRLSGHVPEYIGNMTLLVRLSLETNLFNGSLPAEVGNLVNLQMLNLKANNFT  197

Query  662  GELPKELNSLT  694
            GE P ELN+LT
Sbjct  198  GEWPVELNNLT  208



>ref|XP_010655561.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Vitis vinifera]
Length=783

 Score =   261 bits (666),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F +  +EAQ G LP DE  AL+EIA++VGKKDW+F +NPC+ NSNW TP RK+ P YNNT
Sbjct  26   FGSSSVEAQGGQLPRDEEEALEEIAEQVGKKDWNFSLNPCDGNSNWSTPNRKEKPLYNNT  85

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            LTCNCS+P G CHV  I L+GQDL GVLPP+L KL +LKIID +R+YLSG IP EWAS++
Sbjct  86   LTCNCSYPNGQCHVVQIFLKGQDLAGVLPPSLAKLSYLKIIDFTRNYLSGNIPHEWASVQ  145

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LEY+S+TVNRLSGPIP +LGNITTL Y+++ENNMF+GTVPP+L +L NL+NLIL+ N LT
Sbjct  146  LEYMSLTVNRLSGPIPSFLGNITTLRYMSMENNMFSGTVPPQLGQLVNLENLILNANNLT  205

Query  662  GELPKELNSLT  694
            GELP  L +LT
Sbjct  206  GELPPALANLT  216



>ref|XP_008225419.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1017

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EAQS  L   E+ ALKEIA +VGKKDW+F ++PC N++NW TP+  D+P YNNTL CNC
Sbjct  33   VEAQSLRLASAEVEALKEIATQVGKKDWNFSIDPCSNDTNWATPKSADLPLYNNTLICNC  92

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S+P G CHV SI L+GQDL GV+PP+  KLP+L  +D +R+YL+GTIP EWAS KLEY+S
Sbjct  93   SYPDGFCHVVSIFLKGQDLAGVVPPSAAKLPYLTRVDFTRNYLTGTIPREWASTKLEYLS  152

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            +TVN LSGPIP YLGNI+TL+Y++LENN F+GTVPPEL KL NL NLILS N LTGELP 
Sbjct  153  ITVNNLSGPIPGYLGNISTLIYMSLENNNFSGTVPPELGKLVNLNNLILSANNLTGELPL  212

Query  677  ELNSLT  694
             L +LT
Sbjct  213  ALTNLT  218



>ref|XP_007214558.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
 gb|EMJ15757.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
Length=1017

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EAQS  L   E+ ALKEIA +VGKKDW+F ++PC N++NW TP+  D+P YNNTL CNC
Sbjct  33   VEAQSLRLASAEVEALKEIATQVGKKDWNFSIDPCSNDTNWATPKSADLPLYNNTLICNC  92

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S+P G CHV SI L+GQDL GV+PP+  KLP+L  +D +R+YL+GTIP EWAS KLEY+S
Sbjct  93   SYPDGFCHVVSIFLKGQDLAGVVPPSAAKLPYLTRVDFTRNYLTGTIPREWASTKLEYLS  152

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            +TVN LSGPIP YLGNI+TL+Y++LENN F+GTVPPEL KL NL NLILS N LTGELP 
Sbjct  153  ITVNNLSGPIPGYLGNISTLIYMSLENNNFSGTVPPELGKLVNLNNLILSANILTGELPL  212

Query  677  ELNSLT  694
             L +LT
Sbjct  213  ALTNLT  218



>ref|XP_010655560.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=970

 Score =   261 bits (666),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F +  +EAQ G LP DE  AL+EIA++VGKKDW+F +NPC+ NSNW TP RK+ P YNNT
Sbjct  26   FGSSSVEAQGGQLPRDEEEALEEIAEQVGKKDWNFSLNPCDGNSNWSTPNRKEKPLYNNT  85

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            LTCNCS+P G CHV  I L+GQDL GVLPP+L KL +LKIID +R+YLSG IP EWAS++
Sbjct  86   LTCNCSYPNGQCHVVQIFLKGQDLAGVLPPSLAKLSYLKIIDFTRNYLSGNIPHEWASVQ  145

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LEY+S+TVNRLSGPIP +LGNITTL Y+++ENNMF+GTVPP+L +L NL+NLIL+ N LT
Sbjct  146  LEYMSLTVNRLSGPIPSFLGNITTLRYMSMENNMFSGTVPPQLGQLVNLENLILNANNLT  205

Query  662  GELPKELNSLT  694
            GELP  L +LT
Sbjct  206  GELPPALANLT  216



>emb|CBI30744.3| unnamed protein product [Vitis vinifera]
Length=1144

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F +  +EAQ G LP DE  AL+EIA++VGKKDW+F +NPC+ NSNW TP RK+ P YNNT
Sbjct  26   FGSSSVEAQGGQLPRDEEEALEEIAEQVGKKDWNFSLNPCDGNSNWSTPNRKEKPLYNNT  85

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            LTCNCS+P G CHV  I L+GQDL GVLPP+L KL +LKIID +R+YLSG IP EWAS++
Sbjct  86   LTCNCSYPNGQCHVVQIFLKGQDLAGVLPPSLAKLSYLKIIDFTRNYLSGNIPHEWASVQ  145

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LEY+S+TVNRLSGPIP +LGNITTL Y+++ENNMF+GTVPP+L +L NL+NLIL+ N LT
Sbjct  146  LEYMSLTVNRLSGPIPSFLGNITTLRYMSMENNMFSGTVPPQLGQLVNLENLILNANNLT  205

Query  662  GELPKELNSLT  694
            GELP  L +LT
Sbjct  206  GELPPALANLT  216



>ref|XP_007213704.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
 gb|EMJ14903.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
Length=1017

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EAQS  L   E+ ALKEIA +VGKKDW+F ++PC N++NW TP+  D+P YNNTL CNC
Sbjct  33   VEAQSLRLASAEVEALKEIATQVGKKDWNFSIDPCSNDTNWATPKSADLPLYNNTLICNC  92

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S+P G CHV SI L+GQDL GV+PP+  KL +L  +D +R+YL+GTIP EWAS KLEY+S
Sbjct  93   SYPDGFCHVVSIFLKGQDLAGVVPPSAAKLTYLTRVDFTRNYLTGTIPREWASTKLEYLS  152

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            +TVN LSGPIP YLGNI+TL+Y++LENN F+GTVPPEL KL NL NLILS N LTGELP 
Sbjct  153  ITVNNLSGPIPGYLGNISTLIYMSLENNNFSGTVPPELGKLVNLNNLILSANNLTGELPL  212

Query  677  ELNSLT  694
             L +LT
Sbjct  213  ALTNLT  218



>ref|XP_008245181.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840 [Prunus 
mume]
Length=1017

 Score =   259 bits (661),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EAQS  L   E+ ALKEIA +VGKKDW+F ++PC N++NW TP+  D+P YNNTL CNC
Sbjct  33   VEAQSPRLASAEVEALKEIATQVGKKDWNFSIDPCSNDTNWATPKSADLPLYNNTLICNC  92

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S+P G CHV SI L+GQDL GV+P +  KLP+L  +D +R+YL+GTIP EWAS KLEY+S
Sbjct  93   SYPDGFCHVVSIFLKGQDLAGVVPLSAAKLPYLTRVDFTRNYLTGTIPREWASTKLEYLS  152

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            +TVN LSGPIP YLGNI+TL+Y++LENN F+GTVPPEL KL NL NLILS N LTGELP 
Sbjct  153  ITVNNLSGPIPGYLGNISTLIYMSLENNNFSGTVPPELGKLVNLNNLILSANNLTGELPL  212

Query  677  ELNSLT  694
             L +LT
Sbjct  213  ALTNLT  218



>ref|XP_010655558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1003

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F +  +EAQ G LP DE  AL+EIA++VGKKDW+F +NPC+ NSNW TP RK+MP YNNT
Sbjct  26   FGSSSVEAQGGQLPRDEEEALEEIAEQVGKKDWNFSLNPCDGNSNWSTPNRKEMPLYNNT  85

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            LTCNCS+P G CHV  I L+GQDL GVLP +L KLP+LKIID +R+YLSG IP EWAS++
Sbjct  86   LTCNCSYPNGQCHVVQIFLKGQDLAGVLPSSLEKLPYLKIIDFTRNYLSGNIPREWASLQ  145

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LEY+S+TVN+LSGPIP +LGNI+TL Y+++E+NMF+GTVPP+L +L NL+NLIL+ N LT
Sbjct  146  LEYMSLTVNKLSGPIPSFLGNISTLRYMSMESNMFSGTVPPQLGQLVNLENLILNTNNLT  205

Query  662  GELPKELNSLT  694
            GELP  L +LT
Sbjct  206  GELPPALANLT  216


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (51%), Gaps = 2/118 (2%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRL  514
             +Q + +Q   L+G +P ++  L  L  + IS     G+  P   +MK L+ + +    +
Sbjct  241  QLQKLEIQASGLEGPIPSSISVLTNLTELRISDLLGEGSNFPPLGNMKGLKKLMLRGCNI  300

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            SG IPKYL  +T L  L+L  N   G V P L  L  ++ + L+ N LTG +P  + S
Sbjct  301  SGSIPKYLAEMTELQILDLSFNKLEGIV-PNLEGLTQIEFMYLTSNMLTGSIPDWIES  357



>ref|XP_011461827.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Fragaria vesca subsp. vesca]
Length=1007

 Score =   255 bits (652),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  NARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTL  304
            N+  +EAQS +LP  E+ ALKEIA ++GKKDW+F V+PC N+++W TP     P +NNT+
Sbjct  24   NSIAVEAQSTNLPASEVEALKEIAAQIGKKDWNFSVDPCSNDTSWATPISAARPLFNNTV  83

Query  305  TCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKL  484
            TCNCSF  G CHV SI L+GQDL GVLPP++ KLP+L  +D +R+Y +G+IP EWAS KL
Sbjct  84   TCNCSFSDGACHVTSIFLKGQDLAGVLPPSIAKLPYLINVDFTRNYFNGSIPQEWASTKL  143

Query  485  EYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTG  664
            +Y+S+TVN LSGPIP YLGNI+TL+YL++ENNMF+G VPPEL  L NLQNLI+S N LTG
Sbjct  144  QYLSITVNNLSGPIPTYLGNISTLIYLSVENNMFSGIVPPELGNLVNLQNLIVSANSLTG  203

Query  665  ELPKELNSLT  694
            ELP  L +LT
Sbjct  204  ELPAALMNLT  213


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 68/122 (56%), Gaps = 1/122 (1%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVN  508
            + ++Q++I+    L G LP  L+ L  L  + IS +  +G +P  + S  +L+ + +  +
Sbjct  188  LVNLQNLIVSANSLTGELPAALMNLTKLTELRISSNNFTGRMPDSFQSWNQLQKLEIQAS  247

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
             L GPIP  +  ++ +  L + +    G+V P L+ + NLQ L+L    L+G +P +L++
Sbjct  248  GLQGPIPSTISVLSNITELRISDLNGGGSVFPNLSHMTNLQTLMLRSCNLSGPIPSDLSA  307

Query  689  LT  694
            ++
Sbjct  308  MS  309



>ref|XP_006358076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X2 [Solanum tuberosum]
Length=883

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F A  +EAQ+G LP DE+ AL+EIAD++GKKDWDF++NPC+ NSNW TP+RKDMP YNNT
Sbjct  18   FTAGNIEAQTGQLPKDEVKALREIADQLGKKDWDFKLNPCDGNSNWSTPKRKDMPLYNNT  77

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            L CNC+FP  +CHV++I L+GQ+L GVLP +L KLP+LK ID++R+YLSGTIPPEWAS K
Sbjct  78   LECNCTFPDNLCHVENIFLKGQNLSGVLPASLAKLPYLKKIDLNRNYLSGTIPPEWASTK  137

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE ++++ NRLSG +P+Y+GN+T LV L+LE N+FNG++P E+  L NLQ L LS N L 
Sbjct  138  LELMAISNNRLSGHVPEYIGNMTLLVRLSLETNLFNGSLPAEVGNLVNLQMLDLSFNKLE  197

Query  662  G  664
            G
Sbjct  198  G  198



>emb|CBI30745.3| unnamed protein product [Vitis vinifera]
Length=1901

 Score =   256 bits (654),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +2

Query  137   LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
             +EAQ G LP DE  AL+EIA++VGKKDW+F +NPC+ NSNW TP RK+MP YNNTLTCNC
Sbjct  929   VEAQGGQLPRDEEEALEEIAEQVGKKDWNFSLNPCDGNSNWSTPNRKEMPLYNNTLTCNC  988

Query  317   SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
             S+P G CHV  I L+GQDL GVLP +L KLP+LKIID +R+YLSG IP EWAS++LEY+S
Sbjct  989   SYPNGQCHVVQIFLKGQDLAGVLPSSLEKLPYLKIIDFTRNYLSGNIPREWASLQLEYMS  1048

Query  497   VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             +TVN+LSGPIP +LGNI+TL Y+++E+NMF+GTVPP+L +L NL+NLIL+ N LTGELP 
Sbjct  1049  LTVNKLSGPIPSFLGNISTLRYMSMESNMFSGTVPPQLGQLVNLENLILNTNNLTGELPP  1108

Query  677   ELNSLT  694
              L +LT
Sbjct  1109  ALANLT  1114


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (51%), Gaps = 2/118 (2%)
 Frame = +2

Query  338   HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRL  514
              +Q + +Q   L+G +P ++  L  L  + IS     G+  P   +MK L+ + +    +
Sbjct  1139  QLQKLEIQASGLEGPIPSSISVLTNLTELRISDLLGEGSNFPPLGNMKGLKKLMLRGCNI  1198

Query  515   SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
             SG IPKYL  +T L  L+L  N   G V P L  L  ++ + L+ N LTG +P  + S
Sbjct  1199  SGSIPKYLAEMTELQILDLSFNKLEGIV-PNLEGLTQIEFMYLTSNMLTGSIPDWIES  1255



>ref|XP_004233025.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=1002

 Score =   252 bits (644),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F A  +EAQ+G LP DE+ AL+EIAD++GKKDWDF++NPC+ NSNW TP+RKDMP Y N 
Sbjct  18   FTADNIEAQTGQLPRDEVEALREIADQLGKKDWDFKLNPCDGNSNWSTPKRKDMPWYTNM  77

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            L CNC+F   +CHV++I L GQDL GVLP +L KLP+L+ ID++R+YL+GTIPPEWAS K
Sbjct  78   LECNCTFLDNLCHVENISLIGQDLAGVLPASLAKLPYLRKIDLNRNYLNGTIPPEWASTK  137

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE ++++ NRLSG +P+Y+GN+T+LV L+LE N+FNG++P E+  L NL+ L L  N  T
Sbjct  138  LEIMAISNNRLSGHVPEYIGNMTSLVRLSLETNLFNGSLPAEVGNLVNLEMLNLKANNFT  197

Query  662  GELPKELNSLT  694
            GE P ELN+LT
Sbjct  198  GEWPVELNNLT  208



>ref|XP_010316866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=993

 Score =   248 bits (632),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 148/186 (80%), Gaps = 1/186 (1%)
 Frame = +2

Query  140  EAQS-GHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            EAQ+ G LP +E NAL+EI +E+GK DWDF VNPC+ +++W TP    +  Y + +TCNC
Sbjct  27   EAQNRGLLPEEEKNALREIGEELGKSDWDFDVNPCDESTSWSTPGTDALSVYVSNVTCNC  86

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
              P G CHVQSI+L+GQDL GVLPP+L KLP L IID+S +YLSGTIPPEW SMKLE +S
Sbjct  87   DTPDGYCHVQSILLKGQDLAGVLPPSLAKLPNLTIIDLSCNYLSGTIPPEWTSMKLETMS  146

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + +N+LSGPIPKYLGN+T+LVY+ LE+NMFNGTVP EL  + NLQ LILS N LTG+LP+
Sbjct  147  LMLNQLSGPIPKYLGNMTSLVYMRLESNMFNGTVPKELGGMVNLQILILSFNNLTGQLPE  206

Query  677  ELNSLT  694
            ELN LT
Sbjct  207  ELNKLT  212


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 59/105 (56%), Gaps = 2/105 (2%)
 Frame = +2

Query  320  FP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            FP    +  +  +IL+  +L G +PP + K+P LK++D+S +   G IP   +  KL+++
Sbjct  276  FPQLGNMTRLTRLILRNCNLSGKIPPYITKMPKLKLLDLSFNKFEGQIPNLESLKKLDFL  335

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANL  628
             +  NRL+GPIP ++ +  +   ++L  N F+ +  P   +  NL
Sbjct  336  YLVGNRLTGPIPGWVKSRNSKHMIDLSYNNFSESSEPICQETLNL  380



>ref|XP_010655586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 ref|XP_010655587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
Length=1006

 Score =   246 bits (629),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +2

Query  134  FLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCN  313
            F  A    LP  EL+AL EIA ++GKKDW+F +NPC+ NSNW TP   + P Y N ++CN
Sbjct  30   FRPATGAQLPAYELDALSEIASQLGKKDWNFSLNPCDGNSNWSTPIITEKPLYGNNVSCN  89

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS+P G CHV +I L+GQDL GVLPP+LVKLP+L++ID++R+YLSG IPP+WAS KLE +
Sbjct  90   CSYPNGECHVVNITLKGQDLAGVLPPSLVKLPYLEMIDLTRNYLSGDIPPQWASTKLEIL  149

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+++NR SGPIPK+ GNITTL YL  E N F+GTVPPEL KL NL++LIL+ N LTGELP
Sbjct  150  SISMNRFSGPIPKFFGNITTLKYLGFEGNFFSGTVPPELGKLVNLEHLILNSNNLTGELP  209

Query  674  KELNSLT  694
              L +LT
Sbjct  210  PTLANLT  216


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVN  508
            + +++ +IL   +L G LPPTL  L  LK + IS +  +G IP    + K L+Y+ +  +
Sbjct  191  LVNLEHLILNSNNLTGELPPTLANLTNLKELRISSNNFTGKIPSFIQNWKQLQYLEIQAS  250

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
               GPIP  +  +T L+ L + +    G+  P +  + +L  L+L    ++G +   L  
Sbjct  251  GFEGPIPSSISALTDLIELRISDLTGEGSKFPPIRNMKSLDKLMLRSCNISGPIRTYLAD  310

Query  689  LT  694
            +T
Sbjct  311  MT  312


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +2

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYI  493
            SF      +Q + +Q    +G +P ++  L  L  + IS     G+  P   +MK L+ +
Sbjct  234  SFIQNWKQLQYLEIQASGFEGPIPSSISALTDLIELRISDLTGEGSKFPPIRNMKSLDKL  293

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +    +SGPI  YL ++T L +L+L  N   G + P L  L N++ + L+GN L G +P
Sbjct  294  MLRSCNISGPIRTYLADMTELRFLDLSFNKLEGQI-PNLDSLTNVEAMCLTGNLLNGNIP  352

Query  674  KELNS  688
              + S
Sbjct  353  DGIKS  357



>ref|XP_011461995.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Fragaria vesca subsp. vesca]
Length=1021

 Score =   246 bits (629),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 144/189 (76%), Gaps = 3/189 (2%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNS---NWFTPERKDMPAYNNTLT  307
            +EA +  LP  E+ ALKEIA ++GK DWDF V+PC N++   +W TP+  D P +NNTLT
Sbjct  39   VEALTTLLPASEVAALKEIATQIGKTDWDFSVDPCLNDTTHTSWATPKSADRPLFNNTLT  98

Query  308  CNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLE  487
            CNCSFP G CHV +IIL+GQDL GVLPP++ KLP+L  ID +R++LSG IP EW S KLE
Sbjct  99   CNCSFPDGSCHVINIILRGQDLAGVLPPSIAKLPYLTQIDFTRNFLSGNIPSEWGSTKLE  158

Query  488  YISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGE  667
            Y+S  VN L+GPIP +LGNITTL YLNLE NMFNGTVPPEL  L NLQNLI+S N LTG 
Sbjct  159  YMSFNVNNLTGPIPAFLGNITTLRYLNLETNMFNGTVPPELGNLVNLQNLIISTNNLTGV  218

Query  668  LPKELNSLT  694
            LP  L SL+
Sbjct  219  LPVNLTSLS  227


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 67/122 (55%), Gaps = 2/122 (2%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVN  508
            + ++Q++I+   +L GVLP  L  L  L  + IS +  +G IP  + S  +L  + +  +
Sbjct  202  LVNLQNLIISTNNLTGVLPVNLTSLSKLAELRISSNNFTGKIPHYFQSWNQLTQLEIQAS  261

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
             L GPIP  +  +  L  L + +    G+V P+L+ + +LQ L+L    L G +P +L++
Sbjct  262  GLQGPIPSSISVLRNLTELRISDLNGGGSVFPDLSNMTSLQRLMLRSCNLNGSIP-DLSA  320

Query  689  LT  694
            +T
Sbjct  321  MT  322



>emb|CBI30748.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +2

Query  134  FLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCN  313
            F  A    LP  EL+AL EIA ++GKKDW+F +NPC+ NSNW TP   + P Y N ++CN
Sbjct  28   FRPATGAQLPAYELDALSEIASQLGKKDWNFSLNPCDGNSNWSTPIITEKPLYGNNVSCN  87

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS+P G CHV +I L+GQDL GVLPP+LVKLP+L++ID++R+YLSG IPP+WAS KLE +
Sbjct  88   CSYPNGECHVVNITLKGQDLAGVLPPSLVKLPYLEMIDLTRNYLSGDIPPQWASTKLEIL  147

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+++NR SGPIPK+ GNITTL YL  E N F+GTVPPEL KL NL++LIL+ N LTGELP
Sbjct  148  SISMNRFSGPIPKFFGNITTLKYLGFEGNFFSGTVPPELGKLVNLEHLILNSNNLTGELP  207

Query  674  KELNSLT  694
              L +LT
Sbjct  208  PTLANLT  214


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVN  508
            + +++ +IL   +L G LPPTL  L  LK + IS +  +G IP    + K L+Y+ +  +
Sbjct  189  LVNLEHLILNSNNLTGELPPTLANLTNLKELRISSNNFTGKIPSFIQNWKQLQYLEIQAS  248

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
               GPIP  +  +T L+ L + +    G+  P +  + +L  L+L    ++G +   L  
Sbjct  249  GFEGPIPSSISALTDLIELRISDLTGEGSKFPPIRNMKSLDKLMLRSCNISGPIRTYLAD  308

Query  689  LT  694
            +T
Sbjct  309  MT  310


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +2

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYI  493
            SF      +Q + +Q    +G +P ++  L  L  + IS     G+  P   +MK L+ +
Sbjct  232  SFIQNWKQLQYLEIQASGFEGPIPSSISALTDLIELRISDLTGEGSKFPPIRNMKSLDKL  291

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +    +SGPI  YL ++T L +L+L  N   G + P L  L N++ + L+GN L G +P
Sbjct  292  MLRSCNISGPIRTYLADMTELRFLDLSFNKLEGQI-PNLDSLTNVEAMCLTGNLLNGNIP  350

Query  674  KELNS  688
              + S
Sbjct  351  DGIKS  355



>ref|XP_010655562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=994

 Score =   244 bits (624),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 145/191 (76%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F +  +EA +GHLP +E   L+EIA+++GKKDW F +NPC+ NSNW T   +  P YNNT
Sbjct  18   FGSTSVEALAGHLPDEEKGVLEEIAEQLGKKDWKFELNPCDGNSNWNTLGSRSNPFYNNT  77

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            +TCNCSFP G CHV SI L+GQDL GVLPP L KL +LK ID++R+YLSG IPPEW + K
Sbjct  78   ITCNCSFPNGECHVDSISLKGQDLAGVLPPALAKLSYLKKIDLARNYLSGNIPPEWETTK  137

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE +S+++NRLSG IP +LGNITTL  L LE N+F+GTVPPEL KL +LQ LIL+ N LT
Sbjct  138  LETLSISMNRLSGRIPNFLGNITTLKNLGLEGNLFSGTVPPELGKLVDLQKLILNSNNLT  197

Query  662  GELPKELNSLT  694
            G LP+ L  LT
Sbjct  198  GPLPQALAHLT  208


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEY-I  493
            SF      +Q + +Q   L+G +P  +  L  L  + IS     G+  P   SMK  Y +
Sbjct  226  SFIQSWKQLQQLEIQASGLEGPIPSNISVLSNLTELRISDLNGEGSTFPPLRSMKRMYKL  285

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +    +SGPIP  +  +T L +L+L  N  NG + P L  L N++ + L GN L G +P
Sbjct  286  MLRGCNISGPIPPDIAEMTELRFLDLSFNKLNGEI-PNLDGLTNVEVMCLIGNQLNGNIP  344



>ref|XP_009600349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Nicotiana tomentosiformis]
Length=993

 Score =   244 bits (624),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 145/181 (80%), Gaps = 3/181 (2%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCE-NNSNWFTPERKDMPAYNNTLTCNCSFPA-G  331
            LP  E NALKEIA+++GKK WDF  NPC+  N+NW TP   +   Y N +TCNCS P  G
Sbjct  29   LPQQEKNALKEIAEQLGKKGWDFDANPCDVGNTNWNTPT-DNTSTYQNNVTCNCSIPNNG  87

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR  511
             CHV+SI+L+GQDL GVLPP+LVKLP+LK ID++R+YLSGTIPPEWAS K+EY+SV VN+
Sbjct  88   FCHVESILLKGQDLAGVLPPSLVKLPYLKKIDLARNYLSGTIPPEWASTKVEYMSVLVNQ  147

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            LSGPIPKYL N+T L+Y++LENNMFNGT+P EL  + NLQNL LS N LTG+LP ELN L
Sbjct  148  LSGPIPKYLENMTALLYMSLENNMFNGTIPKELGNMVNLQNLTLSFNNLTGKLPVELNKL  207

Query  692  T  694
            T
Sbjct  208  T  208



>ref|XP_010655563.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=972

 Score =   244 bits (624),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 145/191 (76%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F +  +EA +GHLP +E   L+EIA+++GKKDW F +NPC+ NSNW T   +  P YNNT
Sbjct  18   FGSTSVEALAGHLPDEEKGVLEEIAEQLGKKDWKFELNPCDGNSNWNTLGSRSNPFYNNT  77

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            +TCNCSFP G CHV SI L+GQDL GVLPP L KL +LK ID++R+YLSG IPPEW + K
Sbjct  78   ITCNCSFPNGECHVDSISLKGQDLAGVLPPALAKLSYLKKIDLARNYLSGNIPPEWETTK  137

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE +S+++NRLSG IP +LGNITTL  L LE N+F+GTVPPEL KL +LQ LIL+ N LT
Sbjct  138  LETLSISMNRLSGRIPNFLGNITTLKNLGLEGNLFSGTVPPELGKLVDLQKLILNSNNLT  197

Query  662  GELPKELNSLT  694
            G LP+ L  LT
Sbjct  198  GPLPQALAHLT  208


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEY-I  493
            SF      +Q + +Q   L+G +P  +  L  L  + IS     G+  P   SMK  Y +
Sbjct  226  SFIQSWKQLQQLEIQASGLEGPIPSNISVLSNLTELRISDLNGEGSTFPPLRSMKRMYKL  285

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +    +SGPIP  +  +T L +L+L  N  NG + P L  L N++ + L GN L G +P
Sbjct  286  MLRGCNISGPIPPDIAEMTELRFLDLSFNKLNGEI-PNLDGLTNVEVMCLIGNQLNGNIP  344



>emb|CBI30742.3| unnamed protein product [Vitis vinifera]
Length=1001

 Score =   244 bits (623),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 145/191 (76%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F +  +EA +GHLP +E   L+EIA+++GKKDW F +NPC+ NSNW T   +  P YNNT
Sbjct  710  FGSTSVEALAGHLPDEEKGVLEEIAEQLGKKDWKFELNPCDGNSNWNTLGSRSNPFYNNT  769

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            +TCNCSFP G CHV SI L+GQDL GVLPP L KL +LK ID++R+YLSG IPPEW + K
Sbjct  770  ITCNCSFPNGECHVDSISLKGQDLAGVLPPALAKLSYLKKIDLARNYLSGNIPPEWETTK  829

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE +S+++NRLSG IP +LGNITTL  L LE N+F+GTVPPEL KL +LQ LIL+ N LT
Sbjct  830  LETLSISMNRLSGRIPNFLGNITTLKNLGLEGNLFSGTVPPELGKLVDLQKLILNSNNLT  889

Query  662  GELPKELNSLT  694
            G LP+ L  LT
Sbjct  890  GPLPQALAHLT  900



>ref|XP_010655564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=972

 Score =   244 bits (623),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 145/191 (76%), Gaps = 0/191 (0%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F +  +EA +GHLP +E   L+EIA+++GKKDW F +NPC+ NSNW T   +  P YNNT
Sbjct  18   FGSTSVEALAGHLPDEEKGVLEEIAEQLGKKDWKFELNPCDGNSNWNTLGSRSNPFYNNT  77

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            +TCNCSFP G CHV SI L+GQDL GVLPP L KL +LK ID++R+YLSG IPPEW + K
Sbjct  78   ITCNCSFPNGECHVDSISLKGQDLAGVLPPALAKLSYLKKIDLARNYLSGNIPPEWETTK  137

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE +S+++NRLSG IP +LGNITTL  L LE N+F+GTVPPEL KL +LQ LIL+ N LT
Sbjct  138  LETLSISMNRLSGRIPNFLGNITTLKNLGLEGNLFSGTVPPELGKLVDLQKLILNSNNLT  197

Query  662  GELPKELNSLT  694
            G LP+ L  LT
Sbjct  198  GPLPQALAHLT  208


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEY-I  493
            SF      +Q + +Q   L+G +P  +  L  L  + IS     G+  P   SMK  Y +
Sbjct  226  SFIQSWKQLQQLEIQASGLEGPIPSNISVLSNLTELRISDLNGEGSTFPPLRSMKRMYKL  285

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +    +SGPIP  +  +T L +L+L  N  NG + P L  L N++ + L GN L G +P
Sbjct  286  MLRGCNISGPIPPDIAEMTELRFLDLSFNKLNGEI-PNLDGLTNVEVMCLIGNQLNGNIP  344



>ref|XP_010655559.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=997

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 152/191 (80%), Gaps = 6/191 (3%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F +  +EAQ G LP DE  AL+EIA++VGKKDW+F +NPC+ NSNW TP RK+MP YNNT
Sbjct  26   FGSSSVEAQGGQLPRDEEEALEEIAEQVGKKDWNFSLNPCDGNSNWSTPNRKEMPLYNNT  85

Query  302  LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            LTCNCS+P G CHV  I L+GQDL GVLP +L KLP+LKIID +R+YLSG IP EWAS++
Sbjct  86   LTCNCSYPNGQCHVVQIFLKGQDLAGVLPSSLEKLPYLKIIDFTRNYLSGNIPREWASLQ  145

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LEY+      LSGPIP +LGNI+TL Y+++E+NMF+GTVPP+L +L NL+NLIL+ N LT
Sbjct  146  LEYM------LSGPIPSFLGNISTLRYMSMESNMFSGTVPPQLGQLVNLENLILNTNNLT  199

Query  662  GELPKELNSLT  694
            GELP  L +LT
Sbjct  200  GELPPALANLT  210


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (51%), Gaps = 2/118 (2%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRL  514
             +Q + +Q   L+G +P ++  L  L  + IS     G+  P   +MK L+ + +    +
Sbjct  235  QLQKLEIQASGLEGPIPSSISVLTNLTELRISDLLGEGSNFPPLGNMKGLKKLMLRGCNI  294

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            SG IPKYL  +T L  L+L  N   G V P L  L  ++ + L+ N LTG +P  + S
Sbjct  295  SGSIPKYLAEMTELQILDLSFNKLEGIV-PNLEGLTQIEFMYLTSNMLTGSIPDWIES  351



>ref|XP_002300205.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
 gb|EEE85010.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
Length=1003

 Score =   238 bits (608),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ+G L  DE++AL EIA +VGK+DW+  V+PC N ++W TP     P ++N + C+C
Sbjct  30   LEAQAGLLASDEVDALLEIATQVGKRDWNNNVDPCSNETSWVTPTSSQRPMFDNKVVCDC  89

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+CH+ +I L+GQDL G LP ++VKLP+LK +D+  +YLSGTIP EWAS KLE +S
Sbjct  90   SFPGGVCHIVAIFLKGQDLAGSLPKSIVKLPYLKNLDLWANYLSGTIPQEWASTKLEILS  149

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            V VN L+GPIP YLG ITTL YLN++NNMF+GTVPPEL  L NL+N+ LS N LTGELP 
Sbjct  150  VAVNHLTGPIPSYLGRITTLRYLNIQNNMFSGTVPPELGNLTNLENITLSANNLTGELPL  209

Query  677  ELNSLT  694
             L +LT
Sbjct  210  ALANLT  215



>ref|XP_011045702.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
 ref|XP_011045703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1006

 Score =   238 bits (607),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 144/190 (76%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  NARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTL  304
            NA  LEAQ+G L  DE++AL EIA +VGK+DW+  V+PC N ++W TP     P ++N +
Sbjct  26   NAIKLEAQAGLLASDEVDALLEIATQVGKRDWNNNVDPCSNETSWVTPTSSQRPMFDNKV  85

Query  305  TCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKL  484
             C+CSFP G+CH+ +I L+GQDL G LP ++VKLP+LK +D+  +YLSGTIP EWA+ KL
Sbjct  86   VCDCSFPGGVCHIVAIFLKGQDLAGSLPKSIVKLPYLKNLDLWANYLSGTIPEEWANTKL  145

Query  485  EYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTG  664
            E +SV VN L+GPIP YLG ITTL YLN++NNMF+GTVPPEL  L NL+N+ LS N LTG
Sbjct  146  EILSVAVNHLTGPIPSYLGRITTLRYLNIQNNMFSGTVPPELGNLTNLENITLSANNLTG  205

Query  665  ELPKELNSLT  694
            ELP  L +LT
Sbjct  206  ELPLALANLT  215



>ref|XP_008353675.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Malus domestica]
Length=396

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            ++QS  L   E+ ALKEIA ++GK+DW+F ++PC N++NW TP+  ++P YNNT+ CNCS
Sbjct  32   QSQSVRLAPTEVEALKEIATQIGKQDWNFSIDPCSNDTNWATPKSDNLPLYNNTVICNCS  91

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            +P G CHV SI L+GQDL GV+PP++ KLP+LKI+D +R+YLSGTIP EWAS KLEY+S+
Sbjct  92   YPDGYCHVVSIFLKGQDLAGVVPPSVAKLPYLKIVDFTRNYLSGTIPSEWASTKLEYVSI  151

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            TVN L+GPIP YLGNITTL+Y+ L  N   G +P  L  L  L  L +S N  TG +P  
Sbjct  152  TVNNLTGPIPGYLGNITTLIYIILNANNLTGELPVALTNLTKLTELRISMNNFTGRIPNF  211

Query  680  LNS  688
            + S
Sbjct  212  IQS  214


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 1/118 (1%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVNRL  514
             ++ + +Q   LQG +P ++  L  L  + IS     G+  P  +SM  +  + +    L
Sbjct  217  QLKKLEIQASGLQGPIPSSISGLSNLAELRISDIDGGGSEFPPLSSMTNMNSLMLRSCNL  276

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            SG IP Y+  +TTL  L+L  N   G +P  +  L NLQ L L+ N L G +P  + S
Sbjct  277  SGSIPDYISAMTTLKILDLSFNRLEGNIPDNIGTLTNLQYLYLTSNLLHGSIPDWIKS  334



>ref|XP_011461992.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Fragaria vesca subsp. vesca]
Length=1002

 Score =   233 bits (594),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EA S  LP  E+ AL+EIA ++GK DW+F V+PC N+++W TP+  D P +NNTL CNC
Sbjct  41   VEALSTRLPATEVQALREIATQLGKNDWNFSVDPCLNDTSWITPKSVDRPQFNNTLKCNC  100

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SF  G CHV +I L+GQDL GVLPP++ KLP+L  ID SR+++SG IP EWAS KL+ + 
Sbjct  101  SFTDGSCHVINIFLKGQDLAGVLPPSIAKLPYLTRIDFSRNFISGNIPSEWASTKLDLML  160

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            ++VN LSGPIP +LGNITTL  L+LE NMF+GTVPPE+ KL NLQ LI+S N LTG LP 
Sbjct  161  LSVNNLSGPIPAFLGNITTLRNLSLETNMFSGTVPPEIGKLVNLQLLIISANNLTGVLPV  220

Query  677  ELNSLT  694
            +L +LT
Sbjct  221  DLTNLT  226



>ref|XP_008245184.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1005

 Score =   231 bits (589),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 136/186 (73%), Gaps = 0/186 (0%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EA++  LP  E  ALKEIA ++GK DW+F +NPC N +NW T      P YN TL CNC
Sbjct  19   VEARASRLPAAEEEALKEIAKQLGKTDWNFNINPCFNYTNWDTLNSTANPIYNKTLECNC  78

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S+P G CHV SI L+GQDL GVLP ++ KLP++  +D +R+YLSG IPPEWAS KLE +S
Sbjct  79   SYPDGFCHVVSIFLKGQDLAGVLPRSVAKLPYITQVDFTRNYLSGPIPPEWASTKLELLS  138

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN LSG IP+YLGNITTL+ LNLE N+F+GTVPPEL  L NL+  ILS N LTGELP 
Sbjct  139  LNVNNLSGQIPRYLGNITTLINLNLETNLFSGTVPPELGNLVNLEIFILSANNLTGELPM  198

Query  677  ELNSLT  694
               +LT
Sbjct  199  AFTNLT  204



>ref|XP_008371519.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=1011

 Score =   231 bits (588),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 149/186 (80%), Gaps = 1/186 (1%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            ++QS  L   E+ ALKEI  ++GKKDW+F ++PC N++NW TP+  D P+YNNTL CNCS
Sbjct  25   QSQSARLAPREVEALKEIRTQLGKKDWNFSIDPCSNSTNWATPKSADFPSYNNTLICNCS  84

Query  320  FPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            +PA G CHV S+ L+GQDL GVLPP++ KLP+L  +D +++YLSGTIP EWAS KLE++S
Sbjct  85   YPADGFCHVVSLFLKGQDLAGVLPPSIAKLPYLTKVDFTKNYLSGTIPREWASTKLEFLS  144

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            +TVN L+G IP YLGNITTL+Y++LENN F+G+VPPEL KL NL NLIL+ N LTGELP+
Sbjct  145  ITVNNLTGQIPDYLGNITTLIYMSLENNKFSGSVPPELGKLVNLNNLILNANNLTGELPQ  204

Query  677  ELNSLT  694
             L +LT
Sbjct  205  HLTNLT  210



>ref|XP_009352706.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Pyrus x bretschneideri]
Length=326

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 142/186 (76%), Gaps = 1/186 (1%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EA+S   P  E+  LKEIA ++GKKDW+F ++PC N++NW TP+  + P YNNT+ CNC
Sbjct  22   IEAKSQSDP-KEVETLKEIAKQIGKKDWNFSIDPCINDTNWATPKSDNFPRYNNTVICNC  80

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S P G CHV SI L GQDL GV+PP++ KLP+LK +D S++YLSGTIP EWAS KLE +S
Sbjct  81   STPDGFCHVVSIFLMGQDLAGVVPPSIAKLPYLKKVDFSKNYLSGTIPREWASTKLEVLS  140

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN LSGPIP YLG IT+L Y+NL+NNMF+GTVP EL +L NL NLIL+ N LTGELP 
Sbjct  141  INVNNLSGPIPGYLGYITSLNYMNLQNNMFSGTVPYELGRLVNLNNLILNENNLTGELPL  200

Query  677  ELNSLT  694
             L  LT
Sbjct  201  SLTKLT  206



>ref|XP_007025268.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
2, partial [Theobroma cacao]
 gb|EOY27890.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
2, partial [Theobroma cacao]
Length=692

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 140/181 (77%), Gaps = 3/181 (2%)
 Frame = +2

Query  161  PLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPA---YNNTLTCNCSFPAG  331
            P  E+ AL EIA E+GKK W+F  NPC N S+WFTP      A    N+T+TCNCSFP G
Sbjct  39   PDSEMEALNEIAAELGKKGWNFTENPCNNRSSWFTPPPPPNVAGVTNNSTVTCNCSFPNG  98

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR  511
             CH+  I L+GQDL GVLP +L KL +LK ID++R+Y++GTIP EWA+M+LE ISV++NR
Sbjct  99   ECHIDGIYLRGQDLNGVLPRSLSKLSYLKTIDLNRNYINGTIPREWATMELELISVSMNR  158

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            LSGPIP +LGNITTLVYL+LENN F+G++P EL KL NL+NLILS N+LTGE P  L++L
Sbjct  159  LSGPIPGFLGNITTLVYLSLENNQFSGSIPHELGKLVNLENLILSANFLTGEFPLALSNL  218

Query  692  T  694
            +
Sbjct  219  S  219



>ref|XP_007025266.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27888.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=988

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 140/186 (75%), Gaps = 14/186 (8%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EAQ+G LP DE++AL+EIA E+GKKDW F V+PC N+S+W TP+ +D P YNNT+ C+C
Sbjct  31   MEAQAGKLPKDEVDALREIAKELGKKDWVFSVDPCSNHSSWVTPKLQDRPLYNNTVNCSC  90

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP  +CHV SI L+GQDL GVLPP+LVKLP L+ ID++R+YL+G IP EWAS+KLE++S
Sbjct  91   SFPGDVCHVVSIFLKGQDLPGVLPPSLVKLPHLRFIDLTRNYLNGPIPREWASLKLEFLS  150

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            +  NRLSG               NLE N+F+G VPP+L KL  L+NLILS N LTG+LP+
Sbjct  151  LNANRLSGT--------------NLETNLFSGPVPPQLGKLVILENLILSANNLTGQLPR  196

Query  677  ELNSLT  694
             L SLT
Sbjct  197  ALTSLT  202



>ref|XP_002522279.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF40137.1| ATP binding protein, putative [Ricinus communis]
Length=988

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EAQ G LP +E+ AL+EIA ++ K+DW+F V+PC N+S+W TP+  +MP YNNTL CNC
Sbjct  28   VEAQFGDLPENEVEALREIAKQLRKEDWNFNVSPCSNHSSWKTPKSDNMPLYNNTLNCNC  87

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            + P GICHV  I L+GQDL GVLP  ++KLP LK +D++R+YLSG IPPEWAS  L+Y+S
Sbjct  88   TVPDGICHVAEIFLKGQDLAGVLPSAILKLPHLKTLDLTRNYLSGNIPPEWASSNLKYLS  147

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNL  637
            + VNRL+G IP YLGN+T+L+YL+LENN+FNG VPPEL  L NL NL
Sbjct  148  LCVNRLTGMIPSYLGNMTSLIYLSLENNLFNGPVPPELGNLGNLANL  194



>ref|XP_007214549.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
 gb|EMJ15748.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
Length=935

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQSI  352
            + ALKEIA +VGKKDW+F ++PC  ++NW TPE  D   Y+N L C+C++P G CHV SI
Sbjct  4    VEALKEIATQVGKKDWNFSIDPCSKDTNWNTPESAD-SLYSNILICSCTYPDGFCHVVSI  62

Query  353  ILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPK  532
             LQGQDL GV+PP+  KLP+L  +  +R+YL+GTIP EWAS KL+Y+SV VN LSGPIP 
Sbjct  63   SLQGQDLAGVVPPSAAKLPYLTTVRFTRNYLNGTIPREWASTKLKYLSVDVNNLSGPIPG  122

Query  533  YLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            YLGNI+TL +++L+NN F+GTVPPEL KL NL NLILS N LTG+LP  L +LT
Sbjct  123  YLGNISTLTHISLKNNYFSGTVPPELGKLVNLNNLILSANNLTGKLPLALTNLT  176


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRL  514
             +Q + +Q   LQG +P ++  L  L  + IS     G+  P  +SM  +E + +    L
Sbjct  201  QLQKLEIQASGLQGPIPSSISALSNLTELRISDINGPGSEFPPLSSMTGMEKLMLRSCNL  260

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            SG IP Y+  +T+L  L+L  N   G +P +LA L NL+ L L+ N LTG +P  +NS
Sbjct  261  SGRIPAYISAMTSLKILDLSFNRLEGDIP-DLAALKNLEYLYLTSNLLTGSIPNWINS  317



>ref|XP_007025267.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY27889.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1007

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 140/181 (77%), Gaps = 3/181 (2%)
 Frame = +2

Query  161  PLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAY---NNTLTCNCSFPAG  331
            P  E+ AL EIA E+GKK W+F  NPC N S+WFTP      A    N+T+TCNCSFP G
Sbjct  39   PDSEMEALNEIAAELGKKGWNFTENPCNNRSSWFTPPPPPNVAGVTNNSTVTCNCSFPNG  98

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR  511
             CH+  I L+GQDL GVLP +L KL +LK ID++R+Y++GTIP EWA+M+LE ISV++NR
Sbjct  99   ECHIDGIYLRGQDLNGVLPRSLSKLSYLKTIDLNRNYINGTIPREWATMELELISVSMNR  158

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            LSGPIP +LGNITTLVYL+LENN F+G++P EL KL NL+NLILS N+LTGE P  L++L
Sbjct  159  LSGPIPGFLGNITTLVYLSLENNQFSGSIPHELGKLVNLENLILSANFLTGEFPLALSNL  218

Query  692  T  694
            +
Sbjct  219  S  219



>ref|XP_008225260.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=983

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 135/186 (73%), Gaps = 8/186 (4%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +E Q+  LP  E+ ALKEIA ++GK DW+F +NPC N++N++           NTL CNC
Sbjct  15   VEEQASRLPAAEVEALKEIAKQLGKTDWNFNINPCNNDTNYWDTA--------NTLGCNC  66

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S P G CHV SI L+GQD  GVLPP+L KLP++  +D SR+YLSGTIPPEWAS KLE +S
Sbjct  67   SHPDGFCHVVSIFLRGQDFGGVLPPSLPKLPYIPQVDFSRNYLSGTIPPEWASTKLELLS  126

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            V+VN LSG IP+YLGNITTL+ LNLE N+F+GTVPPEL  L NL+  ILS N LTGELP 
Sbjct  127  VSVNNLSGQIPRYLGNITTLINLNLETNLFSGTVPPELGNLVNLEIFILSANNLTGELPV  186

Query  677  ELNSLT  694
               +L 
Sbjct  187  AFTNLA  192



>ref|XP_002528777.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33599.1| ATP binding protein, putative [Ricinus communis]
Length=1007

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 153/214 (71%), Gaps = 4/214 (2%)
 Frame = +2

Query  62   KHSTMSASMFiilipiillSFNARFLEAQS---GHLPLDELNALKEIADEVGKKDWDFRV  232
            +HS +  + F  ++ I+L+  +   ++ Q+   G LP+ E+ ALKEIA ++GK  W+F  
Sbjct  3    RHSAIFVTTFSSVVIILLIFISTEAIQVQAQAAGRLPVAEVVALKEIATQLGKA-WNFSA  61

Query  233  NPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPF  412
            +PC N+ +WFTP  +  P YNN++ CNCSFP G CHV  I L+GQDL GVLP  + KLP+
Sbjct  62   DPCSNDVSWFTPLSRATPLYNNSIFCNCSFPGGDCHVVKIFLKGQDLAGVLPSAITKLPY  121

Query  413  LKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNG  592
            L  +D++R+YLSG IP EWAS KLE+++++ NRL+G IP YLGNITTL  L++E+NMF+G
Sbjct  122  LTTLDLNRNYLSGNIPREWASTKLEFLAISANRLTGKIPSYLGNITTLRILSIESNMFSG  181

Query  593  TVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            ++PPEL  L N++ L+LS N LTG LP  L +LT
Sbjct  182  SIPPELGNLVNMEILVLSANNLTGNLPLALTNLT  215



>ref|XP_011046351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Populus euphratica]
Length=1022

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 138/185 (75%), Gaps = 1/185 (1%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEA++G L  DE++AL EIA +VGKKDW+  V+PC N ++W TP     P ++N + CNC
Sbjct  46   LEAEAGLLAPDEVDALLEIATQVGKKDWNNSVDPCSNETSWVTPPSPQRPMFDNNVVCNC  105

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SF  G+CH+ SI L+GQDL G LP ++VKLP+L  +D+  +YLSG IPPEWA+ KLE +S
Sbjct  106  SF-GGVCHIVSIFLKGQDLAGSLPKSIVKLPYLTHLDLWANYLSGNIPPEWANTKLEILS  164

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VNRL+GPIP YLG I TL YLN +NNMF+G VPPEL  L NL+ +ILS N LTGELP 
Sbjct  165  IAVNRLTGPIPSYLGKIITLRYLNHQNNMFSGIVPPELGNLVNLETIILSANNLTGELPL  224

Query  677  ELNSL  691
             L++L
Sbjct  225  ALSNL  229



>ref|XP_007025272.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27894.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=376

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 131/177 (74%), Gaps = 3/177 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYN---NTLTCNCSFPAGICHV  343
            + AL EIA E+GKKDW+F  NPC N S+WFTP            +T+TCNCSFP+G CH+
Sbjct  56   VQALHEIAAELGKKDWNFNENPCNNKSSWFTPPPPPNIPPAINNSTVTCNCSFPSGECHI  115

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
              I L GQDL GVLP +LVKLP +K I +  +YL GTIP EWA++KLE + +++NRLSGP
Sbjct  116  DGIYLTGQDLDGVLPRSLVKLPHIKTILLYLNYLKGTIPHEWAALKLEILVISMNRLSGP  175

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            IP YLG ITTL YL+LENN+F+GT+PPEL KL NL+NLIL+ N+LTGE P  L  L+
Sbjct  176  IPGYLGQITTLKYLSLENNLFSGTIPPELGKLVNLENLILNANFLTGEFPLALAKLS  232



>ref|XP_011463567.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Fragaria vesca 
subsp. vesca]
Length=246

 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 136/186 (73%), Gaps = 4/186 (2%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEA S  LP DE+ AL EIA+++ KKDW+   +PC N   +  P       YNNTL CNC
Sbjct  22   LEAGSMTLPADEVQALHEIAEQLNKKDWNLS-DPCRNIPTFSIPHTDQ---YNNTLFCNC  77

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP  +CHVQ+I L GQDL GVLPP+LVKLP+LK +++ ++YLSG+IPPEWAS KLE++ 
Sbjct  78   SFPGNVCHVQTIFLVGQDLDGVLPPSLVKLPYLKELNLKQNYLSGSIPPEWASTKLEFLV  137

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            ++VN LSG IP YLGNITTL  L LE+N F+G++PPE+ +L N++ L L  N LTG+LP 
Sbjct  138  LSVNNLSGSIPAYLGNITTLRALALESNFFSGSIPPEMGRLINMEVLYLRSNNLTGQLPV  197

Query  677  ELNSLT  694
             L ++T
Sbjct  198  ALINMT  203



>ref|XP_006370932.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP48729.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=598

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 137/186 (74%), Gaps = 1/186 (1%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEA++G L  DE++AL EIA +VGKKDW+  V+PC N ++W TP     P ++N + CNC
Sbjct  20   LEAEAGLLAPDEVDALLEIATQVGKKDWNNNVDPCINETSWVTPPSSQRPMFDNNVVCNC  79

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SF   +CH+ SI L+GQDL G LP ++VKLP+L  +D+  +YLSG IPPEWA+ KLE +S
Sbjct  80   SFGV-VCHIVSIFLKGQDLAGSLPKSIVKLPYLTHLDLWANYLSGNIPPEWANTKLEILS  138

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VNRL+GPIP YLG I TL  LN++NNMF+G VPPEL  L NL+N+ LS N  TGELP 
Sbjct  139  IAVNRLTGPIPSYLGKIITLRCLNIQNNMFSGIVPPELGNLVNLENINLSANNFTGELPL  198

Query  677  ELNSLT  694
             L++LT
Sbjct  199  ALSNLT  204



>ref|XP_010655576.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=985

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 136/185 (74%), Gaps = 23/185 (12%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            +AQ G LP DE+ AL EIA++VGKKDWDF +NPC+ N+NW TP+RK+MP YNNTLTCNCS
Sbjct  28   KAQGGRLPDDEVEALHEIAEQVGKKDWDFSLNPCDGNANWSTPKRKEMPLYNNTLTCNCS  87

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            +P G CHV  I L+GQDL GVLPP+L KLP+LK++                       S+
Sbjct  88   YPNGQCHVVQIFLKGQDLAGVLPPSLEKLPYLKMM-----------------------SL  124

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            TVNRLSGPIP +LGNITTL Y++LE+N+F+GTVP +L +L NL+NLIL+ N LTGELP  
Sbjct  125  TVNRLSGPIPSFLGNITTLRYMSLESNLFSGTVPHQLWQLVNLENLILNTNNLTGELPPT  184

Query  680  LNSLT  694
            L +LT
Sbjct  185  LANLT  189


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 65/139 (47%), Gaps = 25/139 (18%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVN  508
            + +++++IL   +L G LPPTL  L  L    IS +  +G IP    S K L+ + +  +
Sbjct  164  LVNLENLILNTNNLTGELPPTLANLTKLTEFRISSNNFTGKIPNFIHSWKQLQKLEIQAS  223

Query  509  RLSGPIP------------------------KYLGNITTLVYLNLENNMFNGTVPPELAK  616
             L GPIP                          LGN+T +  L L+     G++P +LAK
Sbjct  224  GLEGPIPFSISVLKNLTELRISDLPGEGSNFPSLGNMTGMKRLMLKGCNIFGSIPKDLAK  283

Query  617  LANLQNLILSGNYLTGELP  673
            +  LQ L LS N L G +P
Sbjct  284  MTELQILDLSFNKLEGTVP  302



>ref|XP_010655582.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=1001

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 137/186 (74%), Gaps = 7/186 (4%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            L +Q   LP DEL AL+EI +++GKKDW+F +NPC   +NW TP       YNN++ C C
Sbjct  51   LASQLPQLPQDELEALREIGEQLGKKDWNFSLNPC---ANWTTPSTDKY--YNNSVNCTC  105

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S     CHV +I L+GQDL GVLPP+L KL +LK ID++R+YLSG IP EWAS +LEY+ 
Sbjct  106  SLDK--CHVDTIFLRGQDLAGVLPPSLAKLRYLKTIDLNRNYLSGHIPLEWASTQLEYLG  163

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            V+VNRLSG IP +LG+I TL YL LE NMF+GTVPPEL KL NL+NLILS N LTG LP 
Sbjct  164  VSVNRLSGQIPGFLGDIVTLKYLCLETNMFSGTVPPELGKLVNLENLILSSNNLTGVLPA  223

Query  677  ELNSLT  694
            +L +LT
Sbjct  224  DLANLT  229



>ref|XP_010655581.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=1009

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 137/186 (74%), Gaps = 7/186 (4%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            L +Q   LP DEL AL+EI +++GKKDW+F +NPC   +NW TP       YNN++ C C
Sbjct  51   LASQLPQLPQDELEALREIGEQLGKKDWNFSLNPC---ANWTTPSTDKY--YNNSVNCTC  105

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S     CHV +I L+GQDL GVLPP+L KL +LK ID++R+YLSG IP EWAS +LEY+ 
Sbjct  106  SLDK--CHVDTIFLRGQDLAGVLPPSLAKLRYLKTIDLNRNYLSGHIPLEWASTQLEYLG  163

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            V+VNRLSG IP +LG+I TL YL LE NMF+GTVPPEL KL NL+NLILS N LTG LP 
Sbjct  164  VSVNRLSGQIPGFLGDIVTLKYLCLETNMFSGTVPPELGKLVNLENLILSSNNLTGVLPA  223

Query  677  ELNSLT  694
            +L +LT
Sbjct  224  DLANLT  229



>ref|XP_010655580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1038

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 137/186 (74%), Gaps = 7/186 (4%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            L +Q   LP DEL AL+EI +++GKKDW+F +NPC   +NW TP       YNN++ C C
Sbjct  51   LASQLPQLPQDELEALREIGEQLGKKDWNFSLNPC---ANWTTPSTDKY--YNNSVNCTC  105

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S     CHV +I L+GQDL GVLPP+L KL +LK ID++R+YLSG IP EWAS +LEY+ 
Sbjct  106  SLDK--CHVDTIFLRGQDLAGVLPPSLAKLRYLKTIDLNRNYLSGHIPLEWASTQLEYLG  163

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            V+VNRLSG IP +LG+I TL YL LE NMF+GTVPPEL KL NL+NLILS N LTG LP 
Sbjct  164  VSVNRLSGQIPGFLGDIVTLKYLCLETNMFSGTVPPELGKLVNLENLILSSNNLTGVLPA  223

Query  677  ELNSLT  694
            +L +LT
Sbjct  224  DLANLT  229



>gb|KHF97567.1| hypothetical protein F383_37113 [Gossypium arboreum]
 gb|KHG12062.1| hypothetical protein F383_19480 [Gossypium arboreum]
Length=226

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 127/180 (71%), Gaps = 2/180 (1%)
 Frame = +2

Query  161  PLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTP--ERKDMPAYNNTLTCNCSFPAGI  334
            P  EL AL EIA E+GKKDW+F  NPC N S+WFTP          N+T+TCNCSF  G 
Sbjct  44   PDCELKALHEIAAELGKKDWNFSENPCNNKSSWFTPPPTHGSQAINNSTVTCNCSFTNGE  103

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
            CH++ I L GQDL GVLPP+L KL ++  + + R YL G IP EWA++KLE +SV +N +
Sbjct  104  CHIEVIYLVGQDLDGVLPPSLSKLLYINTVILHRIYLKGIIPHEWAALKLETLSVAMNHI  163

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            +GPI  YLGNITTL YL+LENN F+GT+PPE  +L NL+ L L+ NYLTG+ P  L +L+
Sbjct  164  TGPITGYLGNITTLKYLSLENNQFSGTIPPEFGRLVNLEYLTLNANYLTGKFPSSLANLS  223



>gb|KJB57354.1| hypothetical protein B456_009G159400 [Gossypium raimondii]
Length=967

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +2

Query  161  PLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPE--RKDMPAYNNTLTCNCSFPAGI  334
            P  E+ AL+EIA E+GKKDW+F  NPC N S+WFTP          N+T+TCNCSF  G 
Sbjct  44   PRYEVKALREIAAELGKKDWNFSENPCNNKSSWFTPPPLHGSRAVNNSTVTCNCSFTNGE  103

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
            CH+  I L GQDL GVLP +L KL ++K + +  +YL GTIP EWA++KLE +++ +NRL
Sbjct  104  CHIDGIYLVGQDLDGVLPRSLGKLSYIKTLHLYMNYLKGTIPHEWAALKLETVTLAMNRL  163

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            SGPIP YLGNITTL YL++ENN+F+GT+PPE  +L NL+NL L+ NYLTG+ P  L +L+
Sbjct  164  SGPIPSYLGNITTLKYLSIENNLFSGTIPPEFGRLVNLENLTLNANYLTGKFPSSLANLS  223



>gb|KJB57365.1| hypothetical protein B456_009G159500 [Gossypium raimondii]
Length=1015

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 137/181 (76%), Gaps = 3/181 (2%)
 Frame = +2

Query  161  PLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERK-DMPAY--NNTLTCNCSFPAG  331
            P  E+ AL+EIA E+GKKDW++  NPC N S+WFTP    ++P    N+T+TCNCSFP G
Sbjct  43   PGYEVRALREIATELGKKDWNYNENPCNNKSSWFTPPPPPNVPEAINNSTVTCNCSFPNG  102

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR  511
             CH+  I L GQDL GVLP +LVKL ++K++ +  +YL+G IP EWA++KLE +SV +NR
Sbjct  103  ECHIDGIYLLGQDLDGVLPRSLVKLSYIKVLVLYLNYLNGEIPREWAALKLETLSVAMNR  162

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            LSGPIP YLGNIT+L YL+LENN+F+GT+PPE  KL NL+NL LS NYL G+ P  L +L
Sbjct  163  LSGPIPSYLGNITSLKYLSLENNLFSGTIPPEFGKLVNLENLTLSANYLVGKFPSSLANL  222

Query  692  T  694
            +
Sbjct  223  S  223



>gb|KJB57353.1| hypothetical protein B456_009G159400 [Gossypium raimondii]
Length=1015

 Score =   216 bits (549),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +2

Query  161  PLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPE--RKDMPAYNNTLTCNCSFPAGI  334
            P  E+ AL+EIA E+GKKDW+F  NPC N S+WFTP          N+T+TCNCSF  G 
Sbjct  44   PRYEVKALREIAAELGKKDWNFSENPCNNKSSWFTPPPLHGSRAVNNSTVTCNCSFTNGE  103

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
            CH+  I L GQDL GVLP +L KL ++K + +  +YL GTIP EWA++KLE +++ +NRL
Sbjct  104  CHIDGIYLVGQDLDGVLPRSLGKLSYIKTLHLYMNYLKGTIPHEWAALKLETVTLAMNRL  163

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            SGPIP YLGNITTL YL++ENN+F+GT+PPE  +L NL+NL L+ NYLTG+ P  L +L+
Sbjct  164  SGPIPSYLGNITTLKYLSIENNLFSGTIPPEFGRLVNLENLTLNANYLTGKFPSSLANLS  223



>ref|XP_011461991.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840, partial 
[Fragaria vesca subsp. vesca]
Length=984

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNS---NWFTPERKDMPAYNNTLTCNCSFPAGICHV  343
            + AL+EI  E+GK DW+F V+PC N++   +W TP+  D P +NNTL CNCSFP   CHV
Sbjct  5    VEALREIGKELGKNDWNFSVDPCLNDTTHTSWATPKPADRPQFNNTLICNCSFPDDSCHV  64

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
             +I L+GQDL GVLPP++ KLP+L  ID SR+++SG IP EWAS KLE + + VN LSGP
Sbjct  65   INIFLKGQDLAGVLPPSVAKLPYLTQIDFSRNFISGNIPSEWASTKLELMYLGVNNLSGP  124

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            IP +LGNITTL  L+LE NMF+G VPPE+ KL NLQ L++S N LTG LP +L +LT
Sbjct  125  IPAFLGNITTLRNLSLETNMFSGIVPPEIGKLVNLQILVISANNLTGVLPVDLTNLT  181



>ref|XP_006370935.1| hypothetical protein POPTR_0019s01920g, partial [Populus trichocarpa]
 gb|ERP48732.1| hypothetical protein POPTR_0019s01920g, partial [Populus trichocarpa]
Length=310

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 137/193 (71%), Gaps = 8/193 (4%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEA++G L  DE++AL EIA +VGKKDW+  V+PC N ++W TP     P ++N + CNC
Sbjct  20   LEAEAGLLAPDEVDALLEIATQVGKKDWNNNVDPCINETSWVTPPSSQRPMFDNNVVCNC  79

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTL--VKLPF-----LKIIDISRSYLSGTIPPEWAS  475
            SF   +CH+ SI L+GQDL G LP ++    LP+     ++  D+  +YLSG IP EWA+
Sbjct  80   SFGV-VCHIVSIFLKGQDLAGSLPKSIGETTLPYQSRFYIRCSDLWANYLSGNIPLEWAN  138

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
             KLE +S+ VNRL+GPIP +LG I TL YLN++NNMF+GTVPPEL  L NL+N+ LS N 
Sbjct  139  TKLEILSIAVNRLTGPIPSHLGKIITLRYLNIQNNMFSGTVPPELGNLVNLENITLSANN  198

Query  656  LTGELPKELNSLT  694
            LTGELP  L++LT
Sbjct  199  LTGELPLALSNLT  211



>ref|XP_011470945.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=1022

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 138/189 (73%), Gaps = 4/189 (2%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFT--PERKDMPAYNNTLTC  310
            +EAQ   LP+ E+ ALKEI  E+GK +W+F  +PC   S+W T  P+  D P+  N +TC
Sbjct  46   VEAQCSPLPVAEVEALKEIGKELGK-NWNFEEDPCSKKSSWATLVPKSDDWPSSMNNVTC  104

Query  311  NCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEY  490
            +CSFP    HV SIILQGQDL GVLP ++VKLP+L  +D++R+YLSG IP +WAS KLE+
Sbjct  105  SCSFPDETYHVISIILQGQDLHGVLPTSIVKLPYLTFLDLNRNYLSGKIPIQWASTKLEH  164

Query  491  ISVTVNRL-SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGE  667
            +SV+VN L +G IP YLGNITTL YL+LE N F+GTVPPEL  L NL+ L+LS N LTGE
Sbjct  165  LSVSVNNLPAGSIPSYLGNITTLQYLSLETNRFSGTVPPELGNLVNLETLVLSANNLTGE  224

Query  668  LPKELNSLT  694
            LP  L  LT
Sbjct  225  LPMSLTKLT  233



>ref|XP_010247771.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=384

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQ  346
            DE+NAL +IA  +GK +WDF V+PC   S W T     +    N +TCNCS    +CHV 
Sbjct  32   DEVNALGQIARRLGKTNWDFSVDPCSGQSGWKT--LHPLKGSENAVTCNCSSDNTVCHVT  89

Query  347  SIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPI  526
            SI+L+ Q L GVLPP LVKLP+L+ ID +R+YL+GTIPPEW S KLE IS+  NRLSG I
Sbjct  90   SILLKSQGLPGVLPPELVKLPYLREIDFTRNYLNGTIPPEWGSTKLEIISLQANRLSGSI  149

Query  527  PKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            PK LGNITTL  L L++N F+G +PPEL  L NLQ L+LS N LTG+LP  L++L
Sbjct  150  PKELGNITTLQQLVLDHNYFSGVLPPELGNLVNLQRLLLSSNNLTGQLPDRLSNL  204



>ref|XP_008365058.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=226

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQSI  352
            + AL++IAD++ KKDW+F  +PC N   + TP       YNNTL CNCSFP  +CH+QS+
Sbjct  2    VEALRDIADQLNKKDWNFS-DPCSNIPTFSTPHTDQ---YNNTLVCNCSFPGKVCHIQSM  57

Query  353  ILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPK  532
             L GQDL GVLPP LVKLP+LK +++ ++YLSG+IP EW S KLE + ++VN+LSGPIP 
Sbjct  58   WLVGQDLDGVLPPALVKLPYLKEVNLGQNYLSGSIPFEWTSTKLESLVLSVNKLSGPIPG  117

Query  533  YLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            YLG ITTL  L+LE+N+F+G +P EL KL N++ L L  N LTGELP  L +LT
Sbjct  118  YLGIITTLRALSLESNLFSGPIPLELGKLVNMEILYLCANDLTGELPVALTNLT  171



>ref|XP_008225417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Prunus mume]
Length=992

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 134/185 (72%), Gaps = 4/185 (2%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            +AQ+G L  DE++AL+EIA+++ KKDW+F  +PC N   + TP       YNNTL CNCS
Sbjct  32   QAQAGTLADDEVDALREIAEQLNKKDWNFS-DPCSNVPTFSTPHTDQ---YNNTLVCNCS  87

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            F   +CH+QS+ L GQ+L GVLPP LVKL +LK + + ++YLSG+IP EW S KLE + +
Sbjct  88   FTGNVCHIQSMNLTGQELDGVLPPALVKLTYLKQVILGQNYLSGSIPREWTSTKLELLVL  147

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            +VN LSGPIP YLG+ITTL  L LE+N+F+GTVP EL KL NL+ L L  N LTGELP  
Sbjct  148  SVNNLSGPIPGYLGSITTLRALALESNLFSGTVPQELGKLVNLEKLYLRANNLTGELPLA  207

Query  680  LNSLT  694
            L +LT
Sbjct  208  LTNLT  212



>ref|XP_007214698.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
 gb|EMJ15897.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
Length=936

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQSI  352
            + AL+EIA ++GK DW+F +NPC NN+NW TP+    P YNNTL CNCS+  G CHV  I
Sbjct  1    MEALEEIAKQLGKTDWNFNINPCNNNTNWDTPKSTANPLYNNTLECNCSYRGGFCHVVGI  60

Query  353  ILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPK  532
             L+GQDL GVLPP++ KLP++  +D +R+YLSG IP EWAS KLE++SV VN LSG IP 
Sbjct  61   FLKGQDLAGVLPPSVAKLPYITQVDFTRNYLSGPIPSEWASTKLEHLSVNVNNLSGQIPS  120

Query  533  YLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            +LGNI TL+YLNL+ N+F+GTVP EL  L NL+  ILS NYLTGELP    +LT
Sbjct  121  FLGNIKTLIYLNLQTNLFSGTVPHELGNLVNLELFILSSNYLTGELPVAFTNLT  174


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 72/136 (53%), Gaps = 6/136 (4%)
 Frame = +2

Query  251  SNWFTPERKDMPAYNNTLTCNCSFPAGICHVQSII---LQGQDLQGVLPPTLVKLPFLKI  421
            S W + + + +    N L+     P+ + +++++I   LQ     G +P  L  L  L++
Sbjct  97   SEWASTKLEHLSVNVNNLSGQ--IPSFLGNIKTLIYLNLQTNLFSGTVPHELGNLVNLEL  154

Query  422  IDISRSYLSGTIPPEWASM-KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTV  598
              +S +YL+G +P  + ++ KL    ++ N  +G IP YLGN   L  L ++ +  +G +
Sbjct  155  FILSSNYLTGELPVAFTNLTKLREFRISSNNFTGRIPDYLGNFKQLEKLEIQASGLHGPI  214

Query  599  PPELAKLANLQNLILS  646
            P  ++ L+NL+ L +S
Sbjct  215  PSSISVLSNLKELRVS  230



>ref|XP_011460364.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53420 [Fragaria vesca subsp. vesca]
Length=1000

 Score =   205 bits (521),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 133/186 (72%), Gaps = 4/186 (2%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
             EA++  LP DE+ AL+EIA+++ KKDW+   +PC N   +  P       Y NTL CNC
Sbjct  27   FEAEAMSLPADEVQALQEIAEQLNKKDWNLS-DPCRNVPTFSIPHADQ---YYNTLFCNC  82

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SF   +CHVQ+I L GQDL GVLPP+LVKLP+LK +++ ++YLSGTIPPEW S KLE++ 
Sbjct  83   SFSGNVCHVQTIYLVGQDLDGVLPPSLVKLPYLKELNLGQNYLSGTIPPEWGSTKLEFLV  142

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            ++VN LSGPIP +LGNITTL  L LE+N F+G +PPEL +L N++ L L  N L G+LP 
Sbjct  143  LSVNNLSGPIPAFLGNITTLRSLALESNQFSGNIPPELGRLVNMEVLYLRANNLIGQLPV  202

Query  677  ELNSLT  694
             L ++T
Sbjct  203  TLTNMT  208


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVN  508
            + +++ + L+  +L G LP TL  +  L  + I  +  +G IP  + S K L+ + +  +
Sbjct  183  LVNMEVLYLRANNLIGQLPVTLTNMTKLNTLWIGSNNFTGKIPNYFLSWKELQMLEMQAS  242

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
               GPIP  L  ++ + YL + +     +V P L+ + N+Q L+L    +TG +P+ +++
Sbjct  243  GFEGPIPSSLSALSNMTYLVISDMNGESSVFPNLSNMKNMQKLMLRSCNITGSIPEYISN  302

Query  689  LT  694
            +T
Sbjct  303  MT  304



>ref|XP_009351856.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Pyrus x bretschneideri]
Length=988

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 130/185 (70%), Gaps = 4/185 (2%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            + Q G L  DE+ AL+EIA ++ KKDW+F  +PC N      P   +   YNNTL CNCS
Sbjct  30   QEQGGTLADDEVEALREIAVQLNKKDWNFS-DPCGNIPTISIPHSDE---YNNTLVCNCS  85

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            F   +CH+QSIIL GQDL GVLPP L KLP+LK ++++R+YLSG+IP EW S KLE + +
Sbjct  86   FSGNVCHIQSIILTGQDLDGVLPPALSKLPYLKQVNLARNYLSGSIPREWNSTKLELLVL  145

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            +VN +SGPIP YLG+ITTL  L LE+N+F+GT+P EL  L NL+ L L  N LTGELP  
Sbjct  146  SVNNISGPIPGYLGSITTLQSLALESNLFSGTLPQELGNLVNLERLYLRANNLTGELPSA  205

Query  680  LNSLT  694
            L  +T
Sbjct  206  LTKMT  210


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVN  508
            + +++ + L+  +L G LP  L K+  L+++ I  +  +G IP  + S K L+ + +  +
Sbjct  185  LVNLERLYLRANNLTGELPSALTKMTKLRVLQIGSNNFAGRIPDYFRSWKNLQALEMQAS  244

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
             L GP+P  L  ++ +  L + +     +  P L+ +  +  L+L    +TGE+P+ +++
Sbjct  245  GLEGPLPSSLSALSNMTDLRISDLSGESSSFPNLSSMTGMNKLMLRSCNITGEMPEYIST  304

Query  689  LT  694
            +T
Sbjct  305  MT  306



>ref|XP_011470946.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=968

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 130/177 (73%), Gaps = 4/177 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFT--PERKDMPAYNNTLTCNCSFPAGICHVQ  346
            + ALKEI  E+GK +W+F  +PC   S+W T  P+  D P+  N +TC+CSFP    HV 
Sbjct  4    VEALKEIGKELGK-NWNFEEDPCSKKSSWATLVPKSDDWPSSMNNVTCSCSFPDETYHVI  62

Query  347  SIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL-SGP  523
            SIILQGQDL GVLP ++VKLP+L  +D++R+YLSG IP +WAS KLE++SV+VN L +G 
Sbjct  63   SIILQGQDLHGVLPTSIVKLPYLTFLDLNRNYLSGKIPIQWASTKLEHLSVSVNNLPAGS  122

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            IP YLGNITTL YL+LE N F+GTVPPEL  L NL+ L+LS N LTGELP  L  LT
Sbjct  123  IPSYLGNITTLQYLSLETNRFSGTVPPELGNLVNLETLVLSANNLTGELPMSLTKLT  179



>ref|XP_010248482.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=272

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFT--PERKDMPAYNNTLTC  310
              +QS  LP DE+ AL+ I + + K+DW+F V+PC  +S+W T   E K      N +TC
Sbjct  29   FRSQSQVLPDDEVEALRIIGNRLNKRDWNFNVDPCSGSSSWVTNTTEVKGWGGIANNVTC  88

Query  311  NCSFP---AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
            NCSF       CHV SI+L+GQ+L GVLPP LVKLP+L+ ID++ +YL+G IPP+W +M+
Sbjct  89   NCSFVNINTTHCHVISIVLKGQNLSGVLPPELVKLPYLQEIDLTLNYLTGRIPPQWGAMQ  148

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            L  ISV  NRLSGPIPK L NITTL  LNLE+N F+G +P EL  L N++ L++S N  T
Sbjct  149  LVNISVFANRLSGPIPKELANITTLRVLNLESNQFSGFIPTELGDLTNIEKLMVSSNNFT  208

Query  662  GELPKELNSLT  694
            G LP+ L  LT
Sbjct  209  GRLPETLAKLT  219



>ref|XP_008342440.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Malus domestica]
Length=404

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 128/185 (69%), Gaps = 4/185 (2%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            + Q G L  DE+ AL+EIA ++ KKDW+F  +PC   SN  T        YNNTL CNCS
Sbjct  30   QEQVGTLADDEVEALREIAVQLNKKDWNFS-DPC---SNIPTVSIXHXDQYNNTLVCNCS  85

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            F   +CH+QSI L GQDL GVLPP L KLP+LK +++ ++YLSG+IP EW S KLE++ +
Sbjct  86   FSGNVCHIQSIFLTGQDLDGVLPPALSKLPYLKQVNLGQNYLSGSIPREWNSTKLEFLVL  145

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            +VN LSGPIP YLG+ITTL  L LE+N F+GT+P EL  L N++ L L  N LTGELP  
Sbjct  146  SVNNLSGPIPGYLGSITTLQALALESNXFSGTIPLELGNLVNMELLYLRANNLTGELPLA  205

Query  680  LNSLT  694
            L  +T
Sbjct  206  LIKMT  210



>ref|XP_011460365.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Fragaria vesca subsp. vesca]
Length=1001

 Score =   202 bits (514),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 133/185 (72%), Gaps = 4/185 (2%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            +AQSG L  +E+ AL+EIA+++ KKDW+F  +PC N   + +P       YNNTL CNCS
Sbjct  31   QAQSGTLATEEVKALREIAEQLNKKDWNFS-DPCSNVPTFSSPHADQ---YNNTLVCNCS  86

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            F   ICH+QSI L GQDL GVLP +L KLP+LK +++ ++ L+G IP EWAS KLE++ +
Sbjct  87   FSGNICHIQSIYLMGQDLDGVLPASLAKLPYLKQVNLGQNDLNGLIPREWASTKLEFLVL  146

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            +VN LSGPIP YLGNITTL  L LE N+F+G VP +L KL N+++L L  N LTGELP  
Sbjct  147  SVNNLSGPIPGYLGNITTLRALALEGNLFSGPVPSDLGKLINMESLYLRVNNLTGELPVA  206

Query  680  LNSLT  694
            L +LT
Sbjct  207  LTNLT  211



>ref|XP_008225418.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Prunus mume]
Length=989

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 132/185 (71%), Gaps = 7/185 (4%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            +AQ+G L  DE++AL+EIA+++ KKDW+F  +PC N   + TP       YNNTL CNCS
Sbjct  32   QAQAGTLADDEVDALREIAEQLNKKDWNFS-DPCSNVPTFSTPHTDQ---YNNTLVCNCS  87

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            F   +CH+QS+ L GQ+L GVLPP LVKL +LK + + ++YLSG+IP EW S KLE +  
Sbjct  88   FTGNVCHIQSMNLTGQELDGVLPPALVKLTYLKQVILGQNYLSGSIPREWTSTKLELL--  145

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
             VN LSGPIP YLG+ITTL  L LE+N+F+GTVP EL KL NL+ L L  N LTGELP  
Sbjct  146  -VNNLSGPIPGYLGSITTLRALALESNLFSGTVPQELGKLVNLEKLYLRANNLTGELPLA  204

Query  680  LNSLT  694
            L +LT
Sbjct  205  LTNLT  209



>ref|XP_008377580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=987

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 4/185 (2%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            + Q G L  DE+ AL+EIA ++ KKDW+F  +PC N      P       YNNTL CNCS
Sbjct  30   QEQVGTLADDEVEALREIAVQLNKKDWNFS-DPCSNIPTISIPHTDQ---YNNTLVCNCS  85

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            F   +CH+QSI L GQDL GVLPP L KLP +K +++ ++YLSG+IP EW S KLE++ +
Sbjct  86   FSGNVCHIQSIFLMGQDLDGVLPPALSKLPXIKQVNLGQNYLSGSIPHEWNSTKLEFLVL  145

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
            +VN LSGPIP YLG++TTL  L LE+N+F+GTVPPEL  L N++ L L  N LTGELP  
Sbjct  146  SVNNLSGPIPSYLGSMTTLRALGLESNLFSGTVPPELGNLVNMEILYLRANNLTGELPLA  205

Query  680  LNSLT  694
            L ++T
Sbjct  206  LKNMT  210



>ref|XP_006371022.1| hypothetical protein POPTR_0019s027402g, partial [Populus trichocarpa]
 gb|ERP48819.1| hypothetical protein POPTR_0019s027402g, partial [Populus trichocarpa]
Length=355

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 126/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C +      P + D    +N + CNC
Sbjct  30   LEAQVGSLAPDEVEALLEVATQLGKKGWNRNMTLCNDT---ILPPKLDA---DNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+C V +I L+ QDL G LP  + KLP LK +D+  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGVCRVIAIYLKRQDLDGSLPKAIEKLPQLKHLDLWANYLSGNIPSEWANTKLEILS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN L+G IP YLG ITTL YLN++NNMF+GTVPPEL  L NL+NL LS NYLTGELP 
Sbjct  144  IGVNNLTGKIPSYLGRITTLSYLNVQNNMFSGTVPPELGGLVNLKNLTLSANYLTGELPP  203

Query  677  ELNSLT  694
               +LT
Sbjct  204  AFTNLT  209



>ref|XP_007213678.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
 gb|EMJ14877.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
Length=955

 Score =   199 bits (506),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQSI  352
            ++AL+EIA+++ KKDW+F  +PC N   + TP       YNNTL CNCSF   +CH+QS+
Sbjct  6    VDALREIAEQLNKKDWNFS-DPCSNVPTFSTPHTDQ---YNNTLICNCSFTGNVCHIQSM  61

Query  353  ILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPK  532
             L GQ+L GVLPP LVKL +LK + + ++YLSG+IP EW S KLE++ ++VN LSGPIP 
Sbjct  62   YLTGQELDGVLPPALVKLTYLKEVILGQNYLSGSIPREWTSTKLEFLVLSVNNLSGPIPG  121

Query  533  YLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            YLG+ITTL  L LE+N+F+GTVPPEL KL NL+ L L  N LTGELP  L +LT
Sbjct  122  YLGSITTLRALALESNLFSGTVPPELGKLVNLEMLYLRANNLTGELPLALTNLT  175



>ref|XP_007214035.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
 gb|EMJ15234.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
Length=876

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQSI  352
            + AL EIA ++ KKDW+F  +PC N   + TP       YNNTL CNCSFP  +CHVQSI
Sbjct  3    VEALIEIAAQLHKKDWNFS-DPCSNVPTFSTPHTDQ---YNNTLFCNCSFPGNVCHVQSI  58

Query  353  ILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPK  532
             L GQ+L GVLPP LVKLP++K +++ ++YLSG+IP +W S KLE++ ++VN LSGPIP 
Sbjct  59   FLVGQELDGVLPPALVKLPYIKQLNLGQNYLSGSIPSKWTSTKLEFLVLSVNNLSGPIPS  118

Query  533  YLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            YLGNI TL  L LE+N+F+GT+PPEL KL N++ L L  N LTGELP  L ++T
Sbjct  119  YLGNIVTLQALALESNLFSGTIPPELGKLINMEILYLRANNLTGELPVSLTNMT  172



>ref|XP_010665665.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1000

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 128/175 (73%), Gaps = 2/175 (1%)
 Frame = +2

Query  170  ELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQS  349
            E+ AL+EIA+E+ K DW+F  +PC N+++WF+        Y N +TC C    G  H+ +
Sbjct  39   EVKALQEIAEEMRKMDWNFEKDPCSNHTSWFSERDPARVTYVNQVTCKCF--GGKWHLTN  96

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIP  529
            + L+GQDL G LP +LVKL +LK ID+SR+ LSG IP EWA MKL+Y+S+  NRLSG IP
Sbjct  97   MSLKGQDLSGGLPKSLVKLHYLKTIDLSRNLLSGRIPEEWAKMKLKYVSLMANRLSGQIP  156

Query  530  KYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            KYLGNITTL+YL++E+N+F+GTVP EL KL NL+ LIL+ N L G+LP EL+ L 
Sbjct  157  KYLGNITTLLYLSIESNLFSGTVPAELGKLVNLKILILNDNNLGGQLPIELHKLA  211


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVNRL  514
             ++ + +QG    G +P ++  L  L  + IS     G+  P   ++  L  + +   +L
Sbjct  236  QLKKLEIQGSGFSGPIPLSISLLTNLVELRISDLNGEGSKFPSLENLTHLVRLMLRSCKL  295

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             G IP+Y+ N++ L  L+L  N  NG++P EL  + +LQN+ L+ N L+G +P
Sbjct  296  YGSIPRYIANMSNLKILDLSFNKLNGSIPNELQYINSLQNMYLANNMLSGPIP  348



>ref|XP_007149525.1| hypothetical protein PHAVU_005G077500g [Phaseolus vulgaris]
 gb|ESW21519.1| hypothetical protein PHAVU_005G077500g [Phaseolus vulgaris]
Length=326

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 121/185 (65%), Gaps = 5/185 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A+   +P DE+  +KEIA+ +GKKDWDF V+PC    NW      ++  + N +TCNC F
Sbjct  21   ARGATIPEDEVKVMKEIAETLGKKDWDFSVDPCSGQRNW----SVEVKGFENAVTCNCHF  76

Query  323  P-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              A ICHV SI+L+ Q+L G LP  LV+LP+L+ ID+SR+YL+GTIP +W  MKL  IS+
Sbjct  77   ANATICHVVSIVLKSQNLSGTLPSELVRLPYLQEIDLSRNYLNGTIPAQWGFMKLVNISI  136

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NR++GPIPK LGNI TL  L LE N  +G +PPEL  L  L+ L L+ NY  G LP  
Sbjct  137  LGNRVAGPIPKELGNIITLKSLVLEFNQLSGELPPELGNLHQLERLHLTSNYFIGNLPTT  196

Query  680  LNSLT  694
               LT
Sbjct  197  FARLT  201



>ref|XP_002524514.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37841.1| ATP binding protein, putative [Ricinus communis]
Length=1007

 Score =   194 bits (492),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 135/204 (66%), Gaps = 2/204 (1%)
 Frame = +2

Query  86   MFiilipiillSFNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFT  265
            MF   + +  L+F    + A    LP DE+ AL+ IA+ +GK DWDF V+PC     W  
Sbjct  1    MFFSRLLLSSLTFFGLLILAFGATLPDDEVEALRGIANTLGKNDWDFNVDPCSGKPGWTD  60

Query  266  PERKDMPAYNNTLTCNCSFPAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSY  442
            P  +++    N +TC+CS+  G ICHV +I+L+ Q+LQG LP  L KL FL++ID++R+Y
Sbjct  61   PA-QELTGIENNVTCDCSYSNGTICHVITIVLKSQNLQGTLPTDLGKLQFLQLIDLTRNY  119

Query  443  LSGTIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLA  622
            L+GTIPPEW SM+L YIS+  NRLSGPIP+ LGNITTL+ L +E N F+G +P EL  L 
Sbjct  120  LNGTIPPEWGSMQLRYISLLGNRLSGPIPRELGNITTLLELVIEFNQFSGELPQELGNLG  179

Query  623  NLQNLILSGNYLTGELPKELNSLT  694
            +++ L+ + N  TG+LP     LT
Sbjct  180  SIRRLLFTSNNFTGKLPATFAKLT  203



>ref|XP_011014230.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=980

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 127/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C  N     P+    P  +N + CNC
Sbjct  30   LEAQVGSLAPDEVEALLEVATQLGKKGWNRNMKLC--NDTILPPK----PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+C V +I L+ QDL G LP  + KLP LK +D+  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGVCRVIAIYLKRQDLDGSLPKAIEKLPQLKHLDLWANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN L+G IP YLGNITTL  LN++NNMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  IGVNHLTGKIPSYLGNITTLRSLNVQNNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209



>ref|XP_011014227.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
Length=1004

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 127/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C  N     P+    P  +N + CNC
Sbjct  30   LEAQVGSLAPDEVEALLEVATQLGKKGWNRNMKLC--NDTILPPK----PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+C V +I L+ QDL G LP  + KLP LK +D+  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGVCRVIAIYLKRQDLDGSLPKAIEKLPQLKHLDLWANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN L+G IP YLGNITTL  LN++NNMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  IGVNHLTGKIPSYLGNITTLRSLNVQNNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 63/124 (51%), Gaps = 5/124 (4%)
 Frame = +2

Query  293  NNTLTCNCSFP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPE  466
            +N L     FP    I  ++ ++L   +L G  P  L ++  LKI+D+S + L+G++P  
Sbjct  265  SNLLGDGSEFPNLEAIAGIKYLMLSNCNLSGHFPIYLTRMAKLKILDLSFNRLNGSLPTN  324

Query  467  WASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            +  +K LE + +T N L+GPIP ++    T   ++L  N F  T   +  +  NL     
Sbjct  325  YDGLKSLEKMYLTRNMLTGPIPDWIDKRDTRYEIDLSYNNF--TSEAKCRETLNLFKSTW  382

Query  644  SGNY  655
             GNY
Sbjct  383  GGNY  386



>ref|XP_011014229.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1002

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 127/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C  N     P+    P  +N + CNC
Sbjct  30   LEAQVGSLAPDEVEALLEVATQLGKKGWNRNMKLC--NDTILPPK----PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+C V +I L+ QDL G LP  + KLP LK +D+  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGVCRVIAIYLKRQDLDGSLPKAIEKLPQLKHLDLWANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN L+G IP YLGNITTL  LN++NNMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  IGVNHLTGKIPSYLGNITTLRSLNVQNNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 63/124 (51%), Gaps = 5/124 (4%)
 Frame = +2

Query  293  NNTLTCNCSFP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPE  466
            +N L     FP    I  ++ ++L   +L G  P  L ++  LKI+D+S + L+G++P  
Sbjct  265  SNLLGDGSEFPNLEAIAGIKYLMLSNCNLSGHFPIYLTRMAKLKILDLSFNRLNGSLPTN  324

Query  467  WASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            +  +K LE + +T N L+GPIP ++    T   ++L  N F  T   +  +  NL     
Sbjct  325  YDGLKSLEKMYLTRNMLTGPIPDWIDKRDTRYEIDLSYNNF--TSEAKCRETLNLFKSTW  382

Query  644  SGNY  655
             GNY
Sbjct  383  GGNY  386



>ref|XP_011046365.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X7 [Populus euphratica]
Length=1002

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 127/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C  N     P+    P  +N + CNC
Sbjct  30   LEAQVGSLAPDEVEALLEVATQLGKKGWNRNMKLC--NDTILPPK----PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+C V +I L+ QDL G LP  + KLP LK +D+  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGVCRVIAIYLKRQDLDGSLPKAIEKLPQLKHLDLWANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN L+G IP YLGNITTL  LN++NNMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  IGVNHLTGKIPSYLGNITTLRSLNVQNNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 63/124 (51%), Gaps = 5/124 (4%)
 Frame = +2

Query  293  NNTLTCNCSFP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPE  466
            +N L     FP    I  ++ ++L   +L G  P  L ++  LKI+D+S + L+G++P  
Sbjct  265  SNLLGDGSEFPNLEAIAGIKYLMLSNCNLSGHFPIYLTRMAKLKILDLSFNRLNGSLPTN  324

Query  467  WASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            +  +K LE + +T N L+GPIP ++    T   ++L  N F  T   +  +  NL     
Sbjct  325  YDGLKSLEKMYLTRNMLTGPIPDWIDKRDTRYEIDLSYNNF--TSEAKCRETLNLFKSTW  382

Query  644  SGNY  655
             GNY
Sbjct  383  GGNY  386



>ref|XP_011046364.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Populus euphratica]
Length=1002

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 130/186 (70%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C N++N   P +   P  +N + CNC
Sbjct  30   LEAQDGSLAPDEVEALLEVATQLGKKGWNRNMKLC-NDTNL--PLK---PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+C V +I L+ QDL G LP  + KLP LK +D+  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGVCRVIAIYLKRQDLDGSLPKAIEKLPQLKHLDLWANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN L+G IP YLGNITTL  LN++NNMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  IGVNHLTGKIPSYLGNITTLRSLNVQNNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 63/124 (51%), Gaps = 5/124 (4%)
 Frame = +2

Query  293  NNTLTCNCSFP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPE  466
            +N L     FP    I  ++ ++L   +L G  P  L ++  LKI+D+S + L+G++P  
Sbjct  265  SNLLGDGSEFPNLEAIAGIKYLMLSNCNLSGHFPIYLTRMAKLKILDLSFNRLNGSLPTN  324

Query  467  WASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            +  +K LE + +T N L+GPIP ++    T   ++L  N F  T   +  +  NL     
Sbjct  325  YDGLKSLEKMYLTRNMLTGPIPDWIDKRDTRYEIDLSYNNF--TSEAKCRETLNLFKSTW  382

Query  644  SGNY  655
             GNY
Sbjct  383  GGNY  386



>ref|XP_011046360.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 130/186 (70%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C N++N   P +   P  +N + CNC
Sbjct  30   LEAQDGSLAPDEVEALLEVATQLGKKGWNRNMKLC-NDTNL--PLK---PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+C V +I L+ QDL G LP  + KLP LK +D+  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGVCRVIAIYLKRQDLDGSLPKAIEKLPQLKHLDLWANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN L+G IP YLGNITTL  LN++NNMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  IGVNHLTGKIPSYLGNITTLRSLNVQNNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 63/124 (51%), Gaps = 5/124 (4%)
 Frame = +2

Query  293  NNTLTCNCSFP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPE  466
            +N L     FP    I  ++ ++L   +L G  P  L ++  LKI+D+S + L+G++P  
Sbjct  265  SNLLGDGSEFPNLEAIAGIKYLMLSNCNLSGHFPIYLTRMAKLKILDLSFNRLNGSLPTN  324

Query  467  WASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            +  +K LE + +T N L+GPIP ++    T   ++L  N F  T   +  +  NL     
Sbjct  325  YDGLKSLEKMYLTRNMLTGPIPDWIDKRDTRYEIDLSYNNF--TSEAKCRETLNLFKSTW  382

Query  644  SGNY  655
             GNY
Sbjct  383  GGNY  386



>ref|XP_011014228.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 127/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C  N     P+    P  +N + CNC
Sbjct  30   LEAQVGSLAPDEVEALLEVATQLGKKGWNRNMKLC--NDTILPPK----PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+C V +I L+ QDL G LP  + KLP LK +D+  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGVCRVIAIYLKRQDLDGSLPKAIEKLPQLKHLDLWANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN L+G IP YLGNITTL  LN++NNMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  IGVNHLTGKIPSYLGNITTLRSLNVQNNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 63/124 (51%), Gaps = 5/124 (4%)
 Frame = +2

Query  293  NNTLTCNCSFP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPE  466
            +N L     FP    I  ++ ++L   +L G  P  L ++  LKI+D+S + L+G++P  
Sbjct  265  SNLLGDGSEFPNLEAIAGIKYLMLSNCNLSGHFPIYLTRMAKLKILDLSFNRLNGSLPTN  324

Query  467  WASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            +  +K LE + +T N L+GPIP ++    T   ++L  N F  T   +  +  NL     
Sbjct  325  YDGLKSLEKMYLTRNMLTGPIPDWIDKRDTRYEIDLSYNNF--TSEAKCRETLNLFKSTW  382

Query  644  SGNY  655
             GNY
Sbjct  383  GGNY  386



>ref|XP_011046359.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
 ref|XP_011046361.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1004

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 127/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C  N     P+    P  +N + CNC
Sbjct  30   LEAQVGSLAPDEVEALLEVATQLGKKGWNRNMKLC--NDTILPPK----PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+C V +I L+ QDL G LP  + KLP LK +D+  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGVCRVIAIYLKRQDLDGSLPKAIEKLPQLKHLDLWANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN L+G IP YLGNITTL  LN++NNMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  IGVNHLTGKIPSYLGNITTLRSLNVQNNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 63/124 (51%), Gaps = 5/124 (4%)
 Frame = +2

Query  293  NNTLTCNCSFP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPE  466
            +N L     FP    I  ++ ++L   +L G  P  L ++  LKI+D+S + L+G++P  
Sbjct  265  SNLLGDGSEFPNLEAIAGIKYLMLSNCNLSGHFPIYLTRMAKLKILDLSFNRLNGSLPTN  324

Query  467  WASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            +  +K LE + +T N L+GPIP ++    T   ++L  N F  T   +  +  NL     
Sbjct  325  YDGLKSLEKMYLTRNMLTGPIPDWIDKRDTRYEIDLSYNNF--TSEAKCRETLNLFKSTW  382

Query  644  SGNY  655
             GNY
Sbjct  383  GGNY  386



>ref|XP_011046362.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=1004

 Score =   192 bits (487),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 130/186 (70%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C N++N   P +   P  +N + CNC
Sbjct  30   LEAQVGSLAPDEVEALLEVATQLGKKGWNRNMKLC-NDTNL--PLK---PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G+C V +I L+ QDL G LP  + KLP LK +D+  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGVCRVIAIYLKRQDLDGSLPKAIEKLPQLKHLDLWANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VN L+G IP YLGNITTL  LN++NNMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  IGVNHLTGKIPSYLGNITTLRSLNVQNNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 63/124 (51%), Gaps = 5/124 (4%)
 Frame = +2

Query  293  NNTLTCNCSFP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPE  466
            +N L     FP    I  ++ ++L   +L G  P  L ++  LKI+D+S + L+G++P  
Sbjct  265  SNLLGDGSEFPNLEAIAGIKYLMLSNCNLSGHFPIYLTRMAKLKILDLSFNRLNGSLPTN  324

Query  467  WASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            +  +K LE + +T N L+GPIP ++    T   ++L  N F  T   +  +  NL     
Sbjct  325  YDGLKSLEKMYLTRNMLTGPIPDWIDKRDTRYEIDLSYNNF--TSEAKCRETLNLFKSTW  382

Query  644  SGNY  655
             GNY
Sbjct  383  GGNY  386



>ref|XP_010665666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=999

 Score =   191 bits (484),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = +2

Query  170  ELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQS  349
            E+ AL+EIA+E+ K DW+F  +PC N+++WF+        Y N +TC C    G  H+ +
Sbjct  39   EVKALQEIAEEMRKMDWNFEKDPCSNHTSWFSERDPARVTYVNQVTCKCF--GGKWHLTN  96

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIP  529
            + L+GQDL G LP +LVKL +LK ID+SR+ LSG IP EWA MKL+Y+S+  NRLSG IP
Sbjct  97   MSLKGQDLSGGLPKSLVKLHYLKTIDLSRNLLSGRIPEEWAKMKLKYVSLMANRLSGQIP  156

Query  530  KYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            KYLGNITTL+YL +E+N+F+GTVP EL KL NL+ LIL+ N L G+LP EL+ L 
Sbjct  157  KYLGNITTLLYL-IESNLFSGTVPAELGKLVNLKILILNDNNLGGQLPIELHKLA  210


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVNRL  514
             ++ + +QG    G +P ++  L  L  + IS     G+  P   ++  L  + +   +L
Sbjct  235  QLKKLEIQGSGFSGPIPLSISLLTNLVELRISDLNGEGSKFPSLENLTHLVRLMLRSCKL  294

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             G IP+Y+ N++ L  L+L  N  NG++P EL  + +LQN+ L+ N L+G +P
Sbjct  295  YGSIPRYIANMSNLKILDLSFNKLNGSIPNELQYINSLQNMYLANNMLSGPIP  347



>ref|XP_011046350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=1003

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 129/186 (69%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G+L  DE  AL E+A ++GKK W+  +  C N++N   P +   P  +N + CNC
Sbjct  30   LEAQVGNLAPDEEEALLEVATQLGKKGWNRNMKLC-NDTN--LPLK---PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
              P   CHV +I L+ QDL G LP  + KLP LK +D+  +YLSG IPPEWA+ KLE +S
Sbjct  84   PVPGEACHVVAIYLKRQDLDGSLPKPIEKLPRLKHLDLWANYLSGNIPPEWANTKLELLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VNRL+G IP YLG ITTL  LN++NNMF+GTVPPEL +L NL+NL LS NYLTGELP 
Sbjct  144  IGVNRLTGKIPGYLGRITTLRSLNIQNNMFSGTVPPELGRLVNLENLTLSANYLTGELPP  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 62/124 (50%), Gaps = 5/124 (4%)
 Frame = +2

Query  293  NNTLTCNCSFP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPE  466
            +N L     FP    I  ++ ++L   +L G  P  L  +  LKI+D+S + L+G++P  
Sbjct  265  SNLLGDGSEFPHLESIKGIKYLLLSNCNLSGNFPINLTGMAHLKILDLSFNRLNGSLPTN  324

Query  467  WASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            +  +K LE + +T N L+GPIP ++    T   ++L  N F  T   +  +  NL     
Sbjct  325  YDGLKSLEKMYLTRNMLTGPIPDWIDKRDTRYEIDLSYNNF--TSEAKCRETLNLFKSTW  382

Query  644  SGNY  655
             GNY
Sbjct  383  GGNY  386



>ref|XP_011046381.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=992

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 126/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G L  DE+ AL E+A ++GKK W+  +  C +      P + +    +N + CNC
Sbjct  30   LEAQVGSLAPDEVEALLEVATQLGKKGWNRNMTLCNDT---VLPRKLEA---DNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            SFP G C V +I L+ QDL G LP  + KLP LK + +  +YLSG IP EWA+ KLE +S
Sbjct  84   SFPGGACRVIAIYLKRQDLDGTLPKAIEKLPHLKHLVLYANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            V VNRL+G IP YLG ITTL YLN+++NMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  VGVNRLTGKIPSYLGRITTLSYLNIQDNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209



>ref|XP_011046349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1005

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 129/186 (69%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G+L  DE  AL E+A ++GKK W+  +  C N++N   P +   P  +N + CNC
Sbjct  30   LEAQVGNLAPDEEEALLEVATQLGKKGWNRNMKLC-NDTN--LPLK---PDADNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
              P   CHV +I L+ QDL G LP  + KLP LK +D+  +YLSG IPPEWA+ KLE +S
Sbjct  84   PVPGEACHVVAIYLKRQDLDGSLPKPIEKLPRLKHLDLWANYLSGNIPPEWANTKLELLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            + VNRL+G IP YLG ITTL  LN++NNMF+GTVPPEL +L NL+NL LS NYLTGELP 
Sbjct  144  IGVNRLTGKIPGYLGRITTLRSLNIQNNMFSGTVPPELGRLVNLENLTLSANYLTGELPP  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALTNLT  209


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 62/124 (50%), Gaps = 5/124 (4%)
 Frame = +2

Query  293  NNTLTCNCSFP--AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPE  466
            +N L     FP    I  ++ ++L   +L G  P  L  +  LKI+D+S + L+G++P  
Sbjct  265  SNLLGDGSEFPHLESIKGIKYLLLSNCNLSGNFPINLTGMAHLKILDLSFNRLNGSLPTN  324

Query  467  WASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            +  +K LE + +T N L+GPIP ++    T   ++L  N F  T   +  +  NL     
Sbjct  325  YDGLKSLEKMYLTRNMLTGPIPDWIDKRDTRYEIDLSYNNF--TSEAKCRETLNLFKSTW  382

Query  644  SGNY  655
             GNY
Sbjct  383  GGNY  386



>ref|XP_010273496.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Nelumbo nucifera]
Length=986

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 129/194 (66%), Gaps = 8/194 (4%)
 Frame = +2

Query  131  RFLEAQ--SGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTL  304
            RF  AQ  +  L  DE+ AL+EIA  +GK++WDF V+PC   S W TP         NT+
Sbjct  21   RFGAAQPSAATLVSDEVVALREIAKRLGKREWDFSVDPCSGQSGWTTPGAP--YTQQNTV  78

Query  305  TCNCSFP----AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWA  472
             C+CSF        CHV  I+L+ Q LQGVLPP LVKLP+L+ ID++ +YLSGTIPP W 
Sbjct  79   ACDCSFANKYNTTSCHVTRILLKSQGLQGVLPPELVKLPYLQEIDLTFNYLSGTIPPGWG  138

Query  473  SMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGN  652
            SM+LE IS+  NR+SG IPK LG++TTL  L LE N  +G +PPEL  L NL+ L++S N
Sbjct  139  SMRLEIISIFGNRVSGSIPKELGSMTTLRELILEANRMSGVLPPELGNLINLERLVISSN  198

Query  653  YLTGELPKELNSLT  694
              TG+ P+ L++LT
Sbjct  199  NFTGQFPERLSALT  212



>ref|XP_010273497.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Nelumbo nucifera]
Length=979

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 129/194 (66%), Gaps = 8/194 (4%)
 Frame = +2

Query  131  RFLEAQ--SGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTL  304
            RF  AQ  +  L  DE+ AL+EIA  +GK++WDF V+PC   S W TP         NT+
Sbjct  21   RFGAAQPSAATLVSDEVVALREIAKRLGKREWDFSVDPCSGQSGWTTPGAP--YTQQNTV  78

Query  305  TCNCSFP----AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWA  472
             C+CSF        CHV  I+L+ Q LQGVLPP LVKLP+L+ ID++ +YLSGTIPP W 
Sbjct  79   ACDCSFANKYNTTSCHVTRILLKSQGLQGVLPPELVKLPYLQEIDLTFNYLSGTIPPGWG  138

Query  473  SMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGN  652
            SM+LE IS+  NR+SG IPK LG++TTL  L LE N  +G +PPEL  L NL+ L++S N
Sbjct  139  SMRLEIISIFGNRVSGSIPKELGSMTTLRELILEANRMSGVLPPELGNLINLERLVISSN  198

Query  653  YLTGELPKELNSLT  694
              TG+ P+ L++LT
Sbjct  199  NFTGQFPERLSALT  212



>ref|XP_010273494.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=1021

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 129/194 (66%), Gaps = 8/194 (4%)
 Frame = +2

Query  131  RFLEAQ--SGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTL  304
            RF  AQ  +  L  DE+ AL+EIA  +GK++WDF V+PC   S W TP         NT+
Sbjct  21   RFGAAQPSAATLVSDEVVALREIAKRLGKREWDFSVDPCSGQSGWTTPGAP--YTQQNTV  78

Query  305  TCNCSFP----AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWA  472
             C+CSF        CHV  I+L+ Q LQGVLPP LVKLP+L+ ID++ +YLSGTIPP W 
Sbjct  79   ACDCSFANKYNTTSCHVTRILLKSQGLQGVLPPELVKLPYLQEIDLTFNYLSGTIPPGWG  138

Query  473  SMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGN  652
            SM+LE IS+  NR+SG IPK LG++TTL  L LE N  +G +PPEL  L NL+ L++S N
Sbjct  139  SMRLEIISIFGNRVSGSIPKELGSMTTLRELILEANRMSGVLPPELGNLINLERLVISSN  198

Query  653  YLTGELPKELNSLT  694
              TG+ P+ L++LT
Sbjct  199  NFTGQFPERLSALT  212



>gb|KGN55040.1| hypothetical protein Csa_4G624460 [Cucumis sativus]
Length=801

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 125/182 (69%), Gaps = 2/182 (1%)
 Frame = +2

Query  155  HLPLDELNALKEIADEVGKKDWDFRVNPCENN-SNWFTPERKDMPAYNNTLTCNCSFPAG  331
             LP DE++AL+EI   +GK DW+FR +PC    S W +   K    + N +TC+C+F   
Sbjct  27   RLPPDEVDALEEIGKILGKTDWNFREDPCGGEASGWISESNKFDTNFENNVTCDCTFQNN  86

Query  332  -ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVN  508
             +CHV +I+L+ Q LQG LPP +V+LPFL+ +D++R+YLSG IPPEW S KL  IS+  N
Sbjct  87   TVCHVTNILLKAQSLQGTLPPQIVRLPFLEELDLTRNYLSGPIPPEWGSTKLLKISLLGN  146

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            RL+GPIPK +GNITTL  L LE N F+G +PPEL  LANL  L+L+ N  +GELP  L  
Sbjct  147  RLTGPIPKAIGNITTLQELVLEMNHFSGNIPPELGNLANLSRLLLTSNNFSGELPPSLAR  206

Query  689  LT  694
            +T
Sbjct  207  IT  208


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 61/124 (49%), Gaps = 5/124 (4%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++  ++L   +  G LPP+L ++  L    I  +  +G IP     W +  L+ I++ 
Sbjct  183  LANLSRLLLTSNNFSGELPPSLARITTLTDFRIGDNNFTGPIPTFLQNWTN--LDKIAIQ  240

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + LSGPIP  +G +T L  L + +     +  P L  L  L++LIL    +TG LP  L
Sbjct  241  ASGLSGPIPSEIGLLTKLTDLRISDLNGGSSQLPPLNTLTKLKHLILRSCSITGMLPDIL  300

Query  683  NSLT  694
               +
Sbjct  301  AGFS  304



>ref|XP_010273493.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Nelumbo nucifera]
Length=1025

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 129/194 (66%), Gaps = 8/194 (4%)
 Frame = +2

Query  131  RFLEAQ--SGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTL  304
            RF  AQ  +  L  DE+ AL+EIA  +GK++WDF V+PC   S W TP         NT+
Sbjct  21   RFGAAQPSAATLVSDEVVALREIAKRLGKREWDFSVDPCSGQSGWTTPGAP--YTQQNTV  78

Query  305  TCNCSFP----AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWA  472
             C+CSF        CHV  I+L+ Q LQGVLPP LVKLP+L+ ID++ +YLSGTIPP W 
Sbjct  79   ACDCSFANKYNTTSCHVTRILLKSQGLQGVLPPELVKLPYLQEIDLTFNYLSGTIPPGWG  138

Query  473  SMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGN  652
            SM+LE IS+  NR+SG IPK LG++TTL  L LE N  +G +PPEL  L NL+ L++S N
Sbjct  139  SMRLEIISIFGNRVSGSIPKELGSMTTLRELILEANRMSGVLPPELGNLINLERLVISSN  198

Query  653  YLTGELPKELNSLT  694
              TG+ P+ L++LT
Sbjct  199  NFTGQFPERLSALT  212



>ref|XP_004146082.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cucumis sativus]
Length=1007

 Score =   189 bits (479),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 125/182 (69%), Gaps = 2/182 (1%)
 Frame = +2

Query  155  HLPLDELNALKEIADEVGKKDWDFRVNPCENN-SNWFTPERKDMPAYNNTLTCNCSFPAG  331
             LP DE++AL+EI   +GK DW+FR +PC    S W +   K    + N +TC+C+F   
Sbjct  27   RLPPDEVDALEEIGKILGKTDWNFREDPCGGEASGWISESNKFDTNFENNVTCDCTFQNN  86

Query  332  -ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVN  508
             +CHV +I+L+ Q LQG LPP +V+LPFL+ +D++R+YLSG IPPEW S KL  IS+  N
Sbjct  87   TVCHVTNILLKAQSLQGTLPPQIVRLPFLEELDLTRNYLSGPIPPEWGSTKLLKISLLGN  146

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            RL+GPIPK +GNITTL  L LE N F+G +PPEL  LANL  L+L+ N  +GELP  L  
Sbjct  147  RLTGPIPKAIGNITTLQELVLEMNHFSGNIPPELGNLANLSRLLLTSNNFSGELPPSLAR  206

Query  689  LT  694
            +T
Sbjct  207  IT  208


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 61/124 (49%), Gaps = 5/124 (4%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++  ++L   +  G LPP+L ++  L    I  +  +G IP     W +  L+ I++ 
Sbjct  183  LANLSRLLLTSNNFSGELPPSLARITTLTDFRIGDNNFTGPIPTFLQNWTN--LDKIAIQ  240

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + LSGPIP  +G +T L  L + +     +  P L  L  L++LIL    +TG LP  L
Sbjct  241  ASGLSGPIPSEIGLLTKLTDLRISDLNGGSSQLPPLNTLTKLKHLILRSCSITGMLPDIL  300

Query  683  NSLT  694
               +
Sbjct  301  AGFS  304



>ref|XP_004162117.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cucumis sativus]
Length=1007

 Score =   189 bits (479),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 125/182 (69%), Gaps = 2/182 (1%)
 Frame = +2

Query  155  HLPLDELNALKEIADEVGKKDWDFRVNPCENN-SNWFTPERKDMPAYNNTLTCNCSFPAG  331
             LP DE++AL+EI   +GK DW+FR +PC    S W +   K    + N +TC+C+F   
Sbjct  27   RLPPDEVDALEEIGKILGKTDWNFREDPCGGEASGWISESNKFDTNFENNVTCDCTFQNN  86

Query  332  -ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVN  508
             +CHV +I+L+ Q LQG LPP +V+LPFL+ +D++R+YLSG IPPEW S KL  IS+  N
Sbjct  87   TVCHVTNILLKAQSLQGTLPPQIVRLPFLEELDLTRNYLSGPIPPEWGSTKLLKISLLGN  146

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            RL+GPIPK +GNITTL  L LE N F+G +PPEL  LANL  L+L+ N  +GELP  L  
Sbjct  147  RLTGPIPKAIGNITTLQELVLEMNHFSGNIPPELGNLANLSRLLLTSNNFSGELPPSLAR  206

Query  689  LT  694
            +T
Sbjct  207  IT  208


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 61/124 (49%), Gaps = 5/124 (4%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++  ++L   +  G LPP+L ++  L    I  +  +G IP     W +  L+ I++ 
Sbjct  183  LANLSRLLLTSNNFSGELPPSLARITTLTDFRIGDNNFTGPIPTFLQNWTN--LDKIAIQ  240

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + LSGPIP  +G +T L  L + +     +  P L  L  L++LIL    +TG LP  L
Sbjct  241  ASGLSGPIPSEIGLLTKLTDLRISDLNGGSSQLPPLNTLTKLKHLILRSCSITGMLPDNL  300

Query  683  NSLT  694
               +
Sbjct  301  AGFS  304



>gb|EYU38244.1| hypothetical protein MIMGU_mgv11b008016mg [Erythranthe guttata]
Length=334

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 125/187 (67%), Gaps = 6/187 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNW--FTPERKDMPAYNNTLTCNC  316
            + +  LP DE+ +L+ +A  +GK DW+F V+PC   S W    P  K+   + NTLTC+C
Sbjct  17   SGAALLPPDEVISLQVVAKSLGKTDWNFSVDPCSGLSGWVILNPAIKE---FENTLTCDC  73

Query  317  SFPAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            +F    +CHV SIIL+ Q+LQG +P  LV+LPFLK ID++R+YL+GTIPPEW SM L  I
Sbjct  74   TFDNNTVCHVISIILKAQNLQGTVPRELVRLPFLKEIDLTRNYLNGTIPPEWGSMNLVNI  133

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NR++GPIPK L NI+TL  L +E N   G +PPE   L  L+ L+++ N LTGELP
Sbjct  134  SLLGNRVTGPIPKALANISTLANLTIEYNQLTGPIPPEFGDLPQLERLLVTSNNLTGELP  193

Query  674  KELNSLT  694
              L  LT
Sbjct  194  ANLAKLT  200


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 25/138 (18%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP-------------------  460
             ++ +++   +L G LP  L KL  L+   IS +  SG+IP                   
Sbjct  177  QLERLLVTSNNLTGELPANLAKLTTLRDFRISDNSFSGSIPNFIQNWTNIEKLRISDLSG  236

Query  461  -----PEWASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLA  622
                 P+ +++K L+ + +    + G +P YLG + TL  L+L  N  +G +P     LA
Sbjct  237  NVSTFPDLSNIKKLKTLILRSCNIIGELPSYLGGMKTLKVLDLSFNKLSGPIPDTYIDLA  296

Query  623  NLQNLILSGNYLTGELPK  676
            N   + L+GN L+G LP+
Sbjct  297  NTDYIYLTGNSLSGPLPE  314



>gb|KEH19461.1| LRR receptor-like kinase [Medicago truncatula]
Length=1000

 Score =   186 bits (473),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 122/180 (68%), Gaps = 3/180 (2%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-I  334
            L  DE+ ALK+I   +GKKDWDF V+PC   +NW +  +  +    N +TCNCSF    +
Sbjct  28   LQEDEVEALKDIGKTLGKKDWDFSVDPCSGRNNWISSTQ--LHGSENAVTCNCSFQNNTL  85

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
            CHV S++L+ Q+L G LPP LV+LPFL+ ID++ +YL+GTIP EWA++KL  IS   NRL
Sbjct  86   CHVVSVVLKAQNLSGTLPPDLVRLPFLQEIDLTLNYLNGTIPKEWATLKLVNISFYGNRL  145

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            SGPIPK  GNITTL  L LE N  +G +PPEL  L+ ++ L+LS N LTG LP     LT
Sbjct  146  SGPIPKEFGNITTLKNLVLEFNQLSGNLPPELGSLSQIERLLLSSNNLTGMLPATFAKLT  205


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 64/124 (52%), Gaps = 1/124 (1%)
 Frame = +2

Query  326  AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS-MKLEYISVT  502
              +  ++ ++L   +L G+LP T  KL  LK   I  S  SG IP    S + LE +++ 
Sbjct  178  GSLSQIERLLLSSNNLTGMLPATFAKLTALKQFRIGDSGFSGAIPNFIQSWINLEMLTIQ  237

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + LSGPIP  +  +  L  L + +   + +  P+L  ++NL  L+L    ++G LP+ L
Sbjct  238  GSGLSGPIPSGISLLKNLTDLTITDLNGSDSPFPQLQNMSNLSKLVLRSCNISGALPEYL  297

Query  683  NSLT  694
              LT
Sbjct  298  GKLT  301



>ref|XP_008366034.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=980

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 127/189 (67%), Gaps = 17/189 (9%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            +AQS  LP DE+ AL+EIA ++ KKDW+F  +PC N   + TP       YNNTL CNCS
Sbjct  27   QAQSMTLPDDEVEALREIAAQLNKKDWNFS-DPCSNIPTFSTPHTDQ---YNNTLFCNCS  82

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
                +CHV+SI L  Q+L GVLPP+L KLP+LK +++ ++YLSG IP EW S KLE++ +
Sbjct  83   ISVDVCHVESIFLTAQELDGVLPPSLAKLPYLKKVNLGQNYLSGPIPHEWTSTKLEFLVL  142

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSG----------  649
            +VN LSGPIP YLGN+ TL  L LE+N+F+G +PPEL KL N++  ILSG          
Sbjct  143  SVNNLSGPIPAYLGNMITLQALALESNLFSGIIPPELGKLVNME--ILSGSCHLFRSWIG  200

Query  650  -NYLTGELP  673
             N  TG +P
Sbjct  201  SNNFTGRIP  209


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 71/136 (52%), Gaps = 10/136 (7%)
 Frame = +2

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDIS----RSYL-----SGTIPPEW  469
            ++   +  +Q++ L+     G++PP L KL  ++I+  S    RS++     +G IP  +
Sbjct  153  AYLGNMITLQALALESNLFSGIIPPELGKLVNMEILSGSCHLFRSWIGSNNFTGRIPDYF  212

Query  470  ASMK-LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILS  646
             S K L+ + +  + L GPIP  L  +  + YL + +        P L+ + N+Q L+L 
Sbjct  213  LSWKELQMLEMQGSGLEGPIPSSLSALKHMTYLCISDLSGVSADFPNLSNMTNMQTLMLR  272

Query  647  GNYLTGELPKELNSLT  694
               + GE+P+ ++++T
Sbjct  273  SCNIRGEIPQYISNMT  288



>gb|KHN19486.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=1004

 Score =   186 bits (471),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 122/184 (66%), Gaps = 2/184 (1%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A+   LP DE+  +K+I   +GKK+WDF V+PC   SNW +  +  +  + N +TC C  
Sbjct  23   ARGATLPEDEVQVMKDIGRTLGKKNWDFSVDPCSGQSNWTSFVQ--VKGFENAVTCICLA  80

Query  323  PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVT  502
             A ICHV SI+L+ Q+L G LP  LV+LP+L+ ID+SR+YL+GTIP +W SM L  IS+ 
Sbjct  81   NASICHVVSIVLKSQNLSGTLPTELVRLPYLQEIDLSRNYLNGTIPSQWGSMNLVNISIL  140

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             NRL+G IPK LGNITTL  L LE N  +G +PPEL  L  L+ L+L+ NY TG LP   
Sbjct  141  GNRLTGSIPKELGNITTLKSLVLEFNQLSGVLPPELGNLPRLERLLLTSNYFTGNLPATF  200

Query  683  NSLT  694
            + LT
Sbjct  201  SRLT  204


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 59/112 (53%), Gaps = 1/112 (1%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVNRLS  517
            ++ +++QG    G +P  +  L  L  + IS      ++ P+  ++  L+ + +    L 
Sbjct  230  LERLVMQGSGFSGPIPSGISFLNNLTDLRISDLKGPDSLFPQLKNLTSLQTLVLRSCNLV  289

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            G  P+YLGN+TTL  L+L  N   G++P  L  L ++  L L+GN  TG LP
Sbjct  290  GMAPEYLGNVTTLRSLDLSFNKLTGSIPRTLGGLNDINLLYLTGNLFTGPLP  341



>ref|XP_008356064.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 [Malus domestica]
Length=380

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 122/186 (66%), Gaps = 3/186 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            AQ   LP  E+ AL+EIA  +G K W F    C   +   T E++   +  NT  C+C+F
Sbjct  29   AQLIMLPQQEVYALREIATTMGAKYWTFNAGTCRIETVGLT-EKQPKGSEGNT-ECDCNF  86

Query  323  PAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              G +CH+ ++ L G  L G+LPP LVKLP+L+ ID S +YLSGTIP EWASMKL Y SV
Sbjct  87   ENGTVCHIATLTLMGYSLPGLLPPQLVKLPYLRKIDFSYNYLSGTIPKEWASMKLNYFSV  146

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
             VNRLSG IPK LGNITTL  LNLE N F+G++P EL  L NLQ L+LS N LTG LP+ 
Sbjct  147  LVNRLSGEIPKELGNITTLTDLNLEANQFSGSLPTELGNLVNLQTLMLSSNQLTGYLPET  206

Query  680  LNSLTI  697
             + L I
Sbjct  207  FSGLRI  212


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 64/144 (44%), Gaps = 25/144 (17%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVN  508
            + ++Q+++L    L G LP T   L  L    IS +  SGT+P    + K L  + +  +
Sbjct  186  LVNLQTLMLSSNQLTGYLPETFSGLRILTDFRISDNNFSGTLPGWVQNWKNLTRLEMHSS  245

Query  509  RLSGPIPK------------------------YLGNITTLVYLNLENNMFNGTVPPELAK  616
             L GPIP                          L N+T+LV L L N    G +P  +  
Sbjct  246  GLEGPIPSNISLLNNLKELRISDTNGPNQEFPLLRNMTSLVRLVLRNCNIXGEIPAYVWS  305

Query  617  LANLQNLILSGNYLTGELPKELNS  688
            L NL+ L +S N LTGELP  + +
Sbjct  306  LKNLEMLDVSFNKLTGELPSTIGA  329



>ref|XP_008463771.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Cucumis melo]
Length=1006

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCEN-NSNWFTPERKDMPAYNN  298
            F+  F  A +  LP DE++AL+EI   +GK DWDF  +PC    S W +   +    ++N
Sbjct  18   FSITFTSAAT-RLPPDEVDALEEIGRTLGKTDWDFTADPCGGVASGWISKSNQFDTNFDN  76

Query  299  TLTCNCSFPAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
             +TC C+F    +CHV +I+L+ Q LQG LPP +V+LPFL+ +D++R+YLSG IPPEW S
Sbjct  77   NVTCKCNFQNNTVCHVTNILLKAQSLQGTLPPQIVRLPFLEELDLTRNYLSGPIPPEWGS  136

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
             K+  IS+  NRL+GPIPK +GNITTL  L LE N F+G +P EL  LANL  L+L+ N 
Sbjct  137  TKILKISLLGNRLTGPIPKAIGNITTLQELVLEMNHFSGNIPLELGNLANLSRLLLTSNN  196

Query  656  LTGELPKELNSLT  694
             +GELP  L  +T
Sbjct  197  FSGELPSSLARIT  209



>ref|XP_010112408.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXC33466.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=941

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 120/180 (67%), Gaps = 3/180 (2%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGIC  337
            L  DE+ ALKEIA EVGKKDW+F +NPC  +  W TP    MP YNNT+ CNCS   GIC
Sbjct  30   LHADEVEALKEIAKEVGKKDWNFSINPCSKDKIWITPMPDGMPLYNNTVNCNCS--NGIC  87

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRL  514
            HV  + L+GQDL GVLPP+L KLP+L+ +D +R+YL G IP EWA+MK LEY+S+  N  
Sbjct  88   HVIHLFLKGQDLDGVLPPSLAKLPYLQQVDFTRNYLHGNIPREWATMKHLEYLSLESNMF  147

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            SGP+P  LGN+  LV L L +N   G++P  L  L+ L+ L +  +   G +P  ++ L+
Sbjct  148  SGPVPPELGNLVNLVNLILNSNNLTGSLPSALFSLSKLKELEIQASGFEGPIPSSISVLS  207



>ref|XP_010273495.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Nelumbo nucifera]
Length=991

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 120/176 (68%), Gaps = 6/176 (3%)
 Frame = +2

Query  179  ALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFP----AGICHVQ  346
            AL+EIA  +GK++WDF V+PC   S W TP         NT+ C+CSF        CHV 
Sbjct  5    ALREIAKRLGKREWDFSVDPCSGQSGWTTPGAP--YTQQNTVACDCSFANKYNTTSCHVT  62

Query  347  SIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPI  526
             I+L+ Q LQGVLPP LVKLP+L+ ID++ +YLSGTIPP W SM+LE IS+  NR+SG I
Sbjct  63   RILLKSQGLQGVLPPELVKLPYLQEIDLTFNYLSGTIPPGWGSMRLEIISIFGNRVSGSI  122

Query  527  PKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            PK LG++TTL  L LE N  +G +PPEL  L NL+ L++S N  TG+ P+ L++LT
Sbjct  123  PKELGSMTTLRELILEANRMSGVLPPELGNLINLERLVISSNNFTGQFPERLSALT  178



>ref|XP_010272760.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Nelumbo nucifera]
Length=983

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 122/177 (69%), Gaps = 5/177 (3%)
 Frame = +2

Query  179  ALKEIADEVGKKDWDFRVNPCENNSNWFT--PERKDMPAYNNTLTCNCSFP---AGICHV  343
            AL+ I + + K+DW+F V+PC  +S+W T   E K      N +TCNCSF       CHV
Sbjct  2    ALRIIGNRLNKRDWNFNVDPCSGSSSWVTNTTEVKGWGGIANNVTCNCSFVNINTTHCHV  61

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
             SI+L+GQ+L GVLPP LVKLP+L+ ID++ +YL+G IPP+W +M+L  ISV  NRLSGP
Sbjct  62   ISIVLKGQNLSGVLPPELVKLPYLQEIDLTLNYLTGRIPPQWGAMQLVNISVFANRLSGP  121

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            IPK L NITTL  LNLE+N F+G +P EL  L N++ L++S N  TG LP+ L  LT
Sbjct  122  IPKELANITTLRVLNLESNQFSGFIPTELGDLTNIEKLMVSSNNFTGRLPETLAKLT  178



>ref|XP_002325753.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
 gb|EEF00135.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
Length=972

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 126/186 (68%), Gaps = 6/186 (3%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            LEAQ G+L  DE+ AL E+A ++GKK W+  +  C +      P + +    +N + CNC
Sbjct  30   LEAQVGNLAPDEVEALLEVATQLGKKGWNRNMTLCNDT---ILPRKLEA---DNKVVCNC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S P   CHV ++ L+ QDL G LP  + KLP LK + +  +YLSG IP EWA+ KLE +S
Sbjct  84   SVPGEPCHVIALYLKMQDLDGTLPKAIEKLPHLKHLVLWANYLSGNIPSEWANTKLETLS  143

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            V VNRL+G IP YLG ITTL YLN+++NMF+GTVPPEL  L NL+NL LS N LTGELP+
Sbjct  144  VGVNRLTGKIPSYLGRITTLSYLNIQDNMFSGTVPPELGGLVNLENLTLSANNLTGELPQ  203

Query  677  ELNSLT  694
             L +LT
Sbjct  204  ALINLT  209



>ref|XP_010246510.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1011

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 124/183 (68%), Gaps = 6/183 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            AQ   L  DE+ AL++IA ++GK DWDF V+PC   S W T   K+     N + C C+ 
Sbjct  25   AQEPTLVSDEVEALRQIATKLGKTDWDFTVDPCSGQSGWKTDAPKES---RNVVECECN-  80

Query  323  PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVT  502
                CHV  I+L+ Q L GVLP  LVKLP+LK +D++R+YL+GTIP EW SMKLE I++ 
Sbjct  81   --ATCHVTIIVLKSQGLPGVLPSELVKLPYLKELDLTRNYLNGTIPQEWGSMKLEIIALQ  138

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             NRLSG +PK LGN+TTL  L L++N  +G +PPEL  L NL+ L+LS N  TG+LP +L
Sbjct  139  ANRLSGSVPKELGNLTTLHQLVLDSNQLSGVIPPELGNLVNLRRLVLSSNNFTGQLPGKL  198

Query  683  NSL  691
            ++L
Sbjct  199  SNL  201



>gb|KDO58609.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=700

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 126/192 (66%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  SFNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            +F    + A +  L  +E+ ALK+I  ++GKKDW+F V+PC    NW      D   + +
Sbjct  23   TFFGYAIAATANKLHAEEVKALKQIGRKLGKKDWNFGVDPCSQKGNW-ELSSDDKKGFES  81

Query  299  TLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
             +TC+CS  +  CHV +I L+ Q+L G LP  L KL +LK +D+SR+ L+G+  P+WAS+
Sbjct  82   NVTCDCS--SATCHVVTIALKAQNLTGTLPTELSKLRYLKQLDLSRNCLTGSFSPQWASL  139

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
            +L  +SV  NRLSGP PK L NITTL  L++E N+F G++PP++ KL NLQ LILS N  
Sbjct  140  QLVELSVMGNRLSGPFPKVLTNITTLKNLSIEGNLFTGSIPPDIRKLINLQKLILSSNSF  199

Query  659  TGELPKELNSLT  694
            TGELP EL  LT
Sbjct  200  TGELPAELTKLT  211


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            +Q + +QG  L+G +P ++  L  L  + IS    S +  P+   M L+ + +T   + G
Sbjct  237  IQKLHIQGSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKMNLKTLILTKCLIHG  296

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             IP Y+G++T L  ++L  N   G +P    KLA    + L+GN LTG +PK
Sbjct  297  EIPDYIGDMTKLKNIDLSFNNLTGGIPTTFEKLAKTNFMYLTGNKLTGPVPK  348


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++Q +IL      G LP  L KL  L  + IS +  SG IP    +W   K++ + + 
Sbjct  186  LINLQKLILSSNSFTGELPAELTKLTNLNDLRISDNNFSGKIPEFIGKWK--KIQKLHIQ  243

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + L GPIP  +  +T+L  L + +   + +  P+L K+ NL+ LIL+   + GE+P  +
Sbjct  244  GSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKM-NLKTLILTKCLIHGEIPDYI  302

Query  683  NSLT  694
              +T
Sbjct  303  GDMT  306



>ref|XP_006477830.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X1 [Citrus sinensis]
Length=1002

 Score =   183 bits (464),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 124/185 (67%), Gaps = 7/185 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP +E+ ALK+IA+ +GKKDW+F V+PC     W      ++P   N +TCNCSF
Sbjct  20   ASGAILPENEVQALKDIANTLGKKDWNFSVDPCSGEEGW-----AEIPE-ENAVTCNCSF  73

Query  323  PAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              G +C+V  I+L+ Q+L GVLPP L +L FL+ I + R+YLSGTIP EWAS+ L  IS+
Sbjct  74   SNGTVCYVFRIVLKEQNLTGVLPPKLAELTFLQDISLPRNYLSGTIPSEWASLPLLNISL  133

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+GPIPKYL NI+TLV L ++ N F+G +P EL  L NL+ L LS N  TGELPK 
Sbjct  134  LANRLTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKT  193

Query  680  LNSLT  694
               LT
Sbjct  194  FAKLT  198



>gb|EYU38245.1| hypothetical protein MIMGU_mgv1a023997mg, partial [Erythranthe 
guttata]
Length=364

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +2

Query  179  ALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-ICHVQSII  355
            +L  +A  +GK DWDF V+PC   S W T  +  +  + N LTC+C+F    +CHV SII
Sbjct  2    SLLVVAKSLGKTDWDFSVDPCSGLSGWAT--QNPVKGFENALTCDCTFENNTVCHVVSII  59

Query  356  LQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPKY  535
            L+ Q+LQG +P  LV+LPFLK ID++R+YL+GTIPPEW SM L  IS+  NR++GPIPK 
Sbjct  60   LKAQNLQGTVPRELVRLPFLKEIDLTRNYLNGTIPPEWGSMNLVNISLLGNRVTGPIPKA  119

Query  536  LGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            L NI+TL  L +E N   GT+PPE   L  ++ L  + N LTGE+P  L  LT
Sbjct  120  LANISTLANLTVEYNQLTGTIPPEFGDLPRIEKLFFTSNNLTGEIPATLAKLT  172


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 64/122 (52%), Gaps = 5/122 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVTVN  508
             ++ +     +L G +P TL KL  LK   +S +  +G+IP     W +  LE + +  +
Sbjct  149  RIEKLFFTSNNLTGEIPATLAKLTTLKDFRVSDNNFNGSIPDFVQNWTN--LEKLVIQGS  206

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
             LSGPIP  + ++T L  + + +   N +  P+L+K  NL+ LIL    L GELP  +  
Sbjct  207  GLSGPIPSGIASLTKLTDVRISDLNGNESTFPDLSKNKNLKTLILRSCNLIGELPSYIGR  266

Query  689  LT  694
            LT
Sbjct  267  LT  268


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 72/154 (47%), Gaps = 23/154 (15%)
 Frame = +2

Query  221  DFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLV  400
            DFRV+  +NN N   P+                F     +++ +++QG  L G +P  + 
Sbjct  176  DFRVS--DNNFNGSIPD----------------FVQNWTNLEKLVIQGSGLSGPIPSGIA  217

Query  401  KLPFLKIIDISRSYLSG---TIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNL  571
             L   K+ D+  S L+G   T P    +  L+ + +    L G +P Y+G +T+L  L+L
Sbjct  218  SLT--KLTDVRISDLNGNESTFPDLSKNKNLKTLILRSCNLIGELPSYIGRLTSLKALDL  275

Query  572  ENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
              N  +G +P   A L     L L+GN LTG LP
Sbjct  276  SFNKLSGPIPDSFAGLTKTSTLYLTGNSLTGPLP  309



>ref|XP_006477832.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X3 [Citrus sinensis]
Length=999

 Score =   183 bits (464),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 124/185 (67%), Gaps = 7/185 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP +E+ ALK+IA+ +GKKDW+F V+PC     W      ++P   N +TCNCSF
Sbjct  20   ASGAILPENEVQALKDIANTLGKKDWNFSVDPCSGEEGW-----AEIPE-ENAVTCNCSF  73

Query  323  PAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              G +C+V  I+L+ Q+L GVLPP L +L FL+ I + R+YLSGTIP EWAS+ L  IS+
Sbjct  74   SNGTVCYVFRIVLKEQNLTGVLPPKLAELTFLQDISLPRNYLSGTIPSEWASLPLLNISL  133

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+GPIPKYL NI+TLV L ++ N F+G +P EL  L NL+ L LS N  TGELPK 
Sbjct  134  LANRLTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKT  193

Query  680  LNSLT  694
               LT
Sbjct  194  FAKLT  198



>ref|XP_011082789.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Sesamum indicum]
Length=992

 Score =   183 bits (464),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-I  334
            LP DE+ +L+ IA  +GK+DW+F V+PC   S W T  +  +  + N LTC+C+F    I
Sbjct  22   LPADEVESLQVIARSLGKRDWNFSVDPCSGLSGWAT--QNPVKGFENALTCDCTFANNTI  79

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
            CHV SIIL+ Q+L G +P  LV+LPFL+ ID++R+YL+GTIPPEW SMKL  IS+  NR+
Sbjct  80   CHVVSIILKAQNLNGSVPRELVRLPFLQEIDLTRNYLNGTIPPEWGSMKLVNISLLANRV  139

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            +G IPK L NI+TL  L LE N  +GT+PPE   L  ++ L+ + N LTGELP  L +L
Sbjct  140  TGSIPKELANISTLANLTLEYNQLSGTIPPEFGNLPRIERLLFTSNNLTGELPPNLANL  198


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 5/115 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSG---TIPPEWASMKLEYISVTVN  508
            +++ +++Q   L G +P  +  L   K+ D+  S L+G   T PP     KL+ + +   
Sbjct  224  NIEKLVIQASGLAGPIPSGIASLT--KLTDLRISDLNGNESTFPPLSNIKKLKTLILRSC  281

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             + G +P Y+G +T L  L+L  N  +G +P     L+N   + L+GN LTG LP
Sbjct  282  NIVGELPSYIGEMTGLKVLDLSFNKLSGPIPDSFVGLSNTDYIYLTGNSLTGSLP  336


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 61/122 (50%), Gaps = 5/122 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP---PEWASMKLEYISVTVN  508
             ++ ++    +L G LPP L  L  L+   IS +   G+IP     W +  +E + +  +
Sbjct  176  RIERLLFTSNNLTGELPPNLANLITLRDFRISDNNFVGSIPGFIQNWTN--IEKLVIQAS  233

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
             L+GPIP  + ++T L  L + +   N +  P L+ +  L+ LIL    + GELP  +  
Sbjct  234  GLAGPIPSGIASLTKLTDLRISDLNGNESTFPPLSNIKKLKTLILRSCNIVGELPSYIGE  293

Query  689  LT  694
            +T
Sbjct  294  MT  295



>gb|KDO58608.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=799

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 126/192 (66%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  SFNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            +F    + A +  L  +E+ ALK+I  ++GKKDW+F V+PC    NW      D   + +
Sbjct  23   TFFGYAIAATANKLHAEEVKALKQIGRKLGKKDWNFGVDPCSQKGNW-ELSSDDKKGFES  81

Query  299  TLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
             +TC+CS  +  CHV +I L+ Q+L G LP  L KL +LK +D+SR+ L+G+  P+WAS+
Sbjct  82   NVTCDCS--SATCHVVTIALKAQNLTGTLPTELSKLRYLKQLDLSRNCLTGSFSPQWASL  139

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
            +L  +SV  NRLSGP PK L NITTL  L++E N+F G++PP++ KL NLQ LILS N  
Sbjct  140  QLVELSVMGNRLSGPFPKVLTNITTLKNLSIEGNLFTGSIPPDIRKLINLQKLILSSNSF  199

Query  659  TGELPKELNSLT  694
            TGELP EL  LT
Sbjct  200  TGELPAELTKLT  211


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            +Q + +QG  L+G +P ++  L  L  + IS    S +  P+   M L+ + +T   + G
Sbjct  237  IQKLHIQGSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKMNLKTLILTKCLIHG  296

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             IP Y+G++T L  ++L  N   G +P    KLA    + L+GN LTG +PK
Sbjct  297  EIPDYIGDMTKLKNIDLSFNNLTGGIPTTFEKLAKTNFMYLTGNKLTGPVPK  348


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++Q +IL      G LP  L KL  L  + IS +  SG IP    +W   K++ + + 
Sbjct  186  LINLQKLILSSNSFTGELPAELTKLTNLNDLRISDNNFSGKIPEFIGKWK--KIQKLHIQ  243

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + L GPIP  +  +T+L  L + +   + +  P+L K+ NL+ LIL+   + GE+P  +
Sbjct  244  GSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKM-NLKTLILTKCLIHGEIPDYI  302

Query  683  NSLT  694
              +T
Sbjct  303  GDMT  306



>ref|XP_010247772.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1001

 Score =   183 bits (464),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 124/179 (69%), Gaps = 8/179 (4%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGIC  337
            L  DE+ AL+EIA  + K DWDF V+PC   ++W    R  +  Y N +TCNC      C
Sbjct  31   LVADEVAALREIASRLNKSDWDFNVDPC---NDWI---RVSILEYQNNVTCNCFNTE--C  82

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLS  517
            HV +I+L+GQ L GVLPP L+KLP+LK ID++R+YL+GTIP +W S KLE IS+  NRLS
Sbjct  83   HVTNIVLKGQGLPGVLPPELIKLPYLKEIDLTRNYLNGTIPRQWGSSKLEIISLIGNRLS  142

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            G IPK +GNITTL  L LE+N  +GT+PPEL  L NL+ L+LS N  TG+LP+  ++L 
Sbjct  143  GSIPKEIGNITTLRELVLESNGLSGTIPPELGSLINLERLLLSSNNFTGQLPETFSNLA  201


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 63/148 (43%), Gaps = 27/148 (18%)
 Frame = +2

Query  326  AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYIS  496
              + +++ ++L   +  G LP T   L  L  + IS +  SG IP     W S  L  + 
Sbjct  174  GSLINLERLLLSSNNFTGQLPETFSNLANLSDLRISDNQFSGKIPSMIQNWTS--LTKLV  231

Query  497  VTVNRLSGPIPKYLGNITTLVYLN----------------------LENNMFNGTVPPEL  610
            +  + L GPIP     +T L  L                       L N   NGT+P E+
Sbjct  232  MQASGLQGPIPSDFSGLTKLSDLRISDLNGSESVFPKLNKGIKTLILRNCNINGTLPSEI  291

Query  611  AKLANLQNLILSGNYLTGELPKELNSLT  694
              +  L+ L LS N LTGE+P   ++L+
Sbjct  292  TSMTTLKTLDLSFNRLTGEIPSTYDALS  319



>ref|XP_006442357.1| hypothetical protein CICLE_v10018686mg [Citrus clementina]
 gb|ESR55597.1| hypothetical protein CICLE_v10018686mg [Citrus clementina]
Length=996

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 122/185 (66%), Gaps = 7/185 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP DE+ AL++IAD++GK DW+  V+PC     WF   +K      N +TCNC++
Sbjct  20   ASGATLPEDEVKALRDIADKLGKTDWNLSVDPCSGRGGWFVDLKK------NAVTCNCTY  73

Query  323  PAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              G +CHV SIIL+ Q L GVLPP L +LPFL+ ID++R+YL+GTIP EWAS+ L  IS+
Sbjct  74   SGGTVCHVVSIILKEQSLPGVLPPELSRLPFLQEIDLTRNYLNGTIPSEWASLPLVNISL  133

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+GPIPK   NI+TL  L +++N  +G +P EL  L NL+   ++ N  TGELP+ 
Sbjct  134  LANRLTGPIPKNFANISTLANLTVQSNRLSGELPEELGSLFNLEKFHINSNNFTGELPQT  193

Query  680  LNSLT  694
               LT
Sbjct  194  FAKLT  198


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 76/174 (44%), Gaps = 14/174 (8%)
 Frame = +2

Query  188  EIADEVGKKDWDFRVNPCENNSNWFTPE----------RKDMPAYNNTLTCNC-SFPAGI  334
            E+ +E+G     F +     NSN FT E           KD    +N  T    SF    
Sbjct  165  ELPEELGSL---FNLEKFHINSNNFTGELPQTFAKLTNMKDFRISDNQFTGEIPSFIQNW  221

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
              + ++++Q   L G +P  +  L  L  + IS         P+  +   E + +    L
Sbjct  222  TKLHTLLIQASGLVGPIPSVITSLRSLTDLRISDLNGPEANLPDLGNRAFENLILRNCNL  281

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            +G +  YLG +  +  L+L  N  NGT+P     L ++  + L+GN LTG++PK
Sbjct  282  TGDLLDYLGEMKEMKVLDLSFNKLNGTIPDSFVGLIDVDFIYLTGNLLTGKVPK  335



>gb|KDO58607.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=845

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 126/192 (66%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  SFNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            +F    + A +  L  +E+ ALK+I  ++GKKDW+F V+PC    NW      D   + +
Sbjct  23   TFFGYAIAATANKLHAEEVKALKQIGRKLGKKDWNFGVDPCSQKGNW-ELSSDDKKGFES  81

Query  299  TLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
             +TC+CS  +  CHV +I L+ Q+L G LP  L KL +LK +D+SR+ L+G+  P+WAS+
Sbjct  82   NVTCDCS--SATCHVVTIALKAQNLTGTLPTELSKLRYLKQLDLSRNCLTGSFSPQWASL  139

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
            +L  +SV  NRLSGP PK L NITTL  L++E N+F G++PP++ KL NLQ LILS N  
Sbjct  140  QLVELSVMGNRLSGPFPKVLTNITTLKNLSIEGNLFTGSIPPDIRKLINLQKLILSSNSF  199

Query  659  TGELPKELNSLT  694
            TGELP EL  LT
Sbjct  200  TGELPAELTKLT  211


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            +Q + +QG  L+G +P ++  L  L  + IS    S +  P+   M L+ + +T   + G
Sbjct  237  IQKLHIQGSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKMNLKTLILTKCLIHG  296

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             IP Y+G++T L  ++L  N   G +P    KLA    + L+GN LTG +PK
Sbjct  297  EIPDYIGDMTKLKNIDLSFNNLTGGIPTTFEKLAKTNFMYLTGNKLTGPVPK  348


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++Q +IL      G LP  L KL  L  + IS +  SG IP    +W   K++ + + 
Sbjct  186  LINLQKLILSSNSFTGELPAELTKLTNLNDLRISDNNFSGKIPEFIGKWK--KIQKLHIQ  243

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + L GPIP  +  +T+L  L + +   + +  P+L K+ NL+ LIL+   + GE+P  +
Sbjct  244  GSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKM-NLKTLILTKCLIHGEIPDYI  302

Query  683  NSLT  694
              +T
Sbjct  303  GDMT  306



>ref|XP_011010608.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1029

 Score =   182 bits (463),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 120/185 (65%), Gaps = 5/185 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNW-FTPERKDMPAYNNTLTCNCS  319
            + S  L   E+  L+EI  ++GKKDWDF  +PC    NW    ERK    + N++TC+CS
Sbjct  33   SASAKLHFQEVRVLREIGKKLGKKDWDFNKDPCSGEGNWSILDERK---GFENSVTCDCS  89

Query  320  FPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            F     CH+ SI L+ Q+L G++PP   K  +LK +D+SR+  +G IPP+W +++LE  S
Sbjct  90   FNNNSSCHLVSIALKSQNLSGIIPPEFSKFRYLKRLDLSRNLFTGVIPPQWGTLRLEEFS  149

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            V  NRLSGP PK L N+TTL  L++E N F+G +PPE+ +L NLQ L+ S N LTGELP 
Sbjct  150  VMGNRLSGPFPKVLTNMTTLRNLSIEGNHFSGPIPPEIGRLVNLQKLVFSSNALTGELPA  209

Query  677  ELNSL  691
            EL  L
Sbjct  210  ELGKL  214


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 63/122 (52%), Gaps = 5/122 (4%)
 Frame = +2

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            +F +    VQ + +QG  L+G +P ++  L   K+ D+  S L+G   P      +E + 
Sbjct  233  TFISKWTKVQKLHIQGTSLKGPIPSSIASLT--KLSDLRISDLTGRGSPFPPLNDMESMK  290

Query  497  VTVNR---LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGE  667
              + R   + G IP+Y+G I  L +L++  N   G +P    +LA +  L L+GN LTG 
Sbjct  291  TLILRNCLIYGEIPEYVGQIEKLKHLDVSFNNLRGEIPSTFIRLARIDFLYLTGNKLTGS  350

Query  668  LP  673
            +P
Sbjct  351  VP  352



>ref|XP_006448023.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
 gb|ESR61263.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
Length=845

 Score =   181 bits (459),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 127/192 (66%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  SFNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            +F    + A +  L  +E+ ALK+I  ++GKKDW+F V+PC    NW      D   + +
Sbjct  23   TFFGYAIAATANKLHAEEVKALKQIGRKLGKKDWNFGVDPCSQKGNW-ELSSDDKKGFES  81

Query  299  TLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
             +TC+CS  +  CHV +I L+ Q+L G LP  L KL +LK +D+SR+ L+G+ PP+WA++
Sbjct  82   NVTCDCS--SATCHVVTIALKAQNLTGTLPTELSKLRYLKQLDLSRNCLTGSFPPQWATL  139

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
            +L  +SV  NRLSGP PK L NITTL  L++E N+F G++PP++ KL NLQ LILS N  
Sbjct  140  QLVELSVMGNRLSGPFPKVLTNITTLKNLSIEGNLFTGSIPPDIRKLINLQKLILSSNSF  199

Query  659  TGELPKELNSLT  694
            TG+LP E+  LT
Sbjct  200  TGKLPAEITKLT  211


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            +Q + +QG  L+G +P ++  L  L  + IS    S +  P+   M L+ + +T   + G
Sbjct  237  IQKLHIQGSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKMNLKTLILTKCLIHG  296

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             IP Y+G++T L  ++L  N   G +P    KLA    + L+GN LTG +PK
Sbjct  297  EIPDYIGDMTKLKNIDLSFNNLTGGIPTTFEKLAKTNFMYLTGNKLTGPVPK  348


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++Q +IL      G LP  + KL  L  + IS +  SG IP    +W   K++ + + 
Sbjct  186  LINLQKLILSSNSFTGKLPAEITKLTNLNDLRISDNNFSGKIPEFIGKWK--KIQKLHIQ  243

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + L GPIP  +  +T+L  L + +   + +  P+L K+ NL+ LIL+   + GE+P  +
Sbjct  244  GSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKM-NLKTLILTKCLIHGEIPDYI  302

Query  683  NSLT  694
              +T
Sbjct  303  GDMT  306



>ref|XP_010691210.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Beta vulgaris subsp. vulgaris]
Length=1000

 Score =   182 bits (463),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 122/178 (69%), Gaps = 3/178 (2%)
 Frame = +2

Query  161  PLDELNALKEIADEVGKKDWDFRVNPCE-NNSNWFTPERKDMPAYNNTLTCNCSFPAGIC  337
            PL+E+ AL+E+A EV K DW+   +PC+ N++ W+T       +Y N ++C C    G+ 
Sbjct  28   PLEEVVALREVAREVKKPDWNCTTDPCDRNDTCWYTHVNPIQHSYVNQISCEC--INGVS  85

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLS  517
            HV +I  +GQ L+GVLP +L KLP LK  D++RS L+GTIP EW + KLEY+SV  N LS
Sbjct  86   HVTNISWKGQSLKGVLPRSLAKLPHLKTFDLARSLLTGTIPREWTATKLEYLSVFANCLS  145

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            G IP YLGNI+TL YL+LE+N FNGTVP +L  L NL NL LS N LTG LP EL  L
Sbjct  146  GRIPDYLGNISTLTYLSLESNQFNGTVPSQLGNLINLSNLTLSDNMLTGSLPVELKKL  203



>gb|KDO58604.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=907

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 126/192 (66%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  SFNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            +F    + A +  L  +E+ ALK+I  ++GKKDW+F V+PC    NW      D   + +
Sbjct  23   TFFGYAIAATANKLHAEEVKALKQIGRKLGKKDWNFGVDPCSQKGNW-ELSSDDKKGFES  81

Query  299  TLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
             +TC+CS  +  CHV +I L+ Q+L G LP  L KL +LK +D+SR+ L+G+  P+WAS+
Sbjct  82   NVTCDCS--SATCHVVTIALKAQNLTGTLPTELSKLRYLKQLDLSRNCLTGSFSPQWASL  139

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
            +L  +SV  NRLSGP PK L NITTL  L++E N+F G++PP++ KL NLQ LILS N  
Sbjct  140  QLVELSVMGNRLSGPFPKVLTNITTLKNLSIEGNLFTGSIPPDIRKLINLQKLILSSNSF  199

Query  659  TGELPKELNSLT  694
            TGELP EL  LT
Sbjct  200  TGELPAELTKLT  211


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            +Q + +QG  L+G +P ++  L  L  + IS    S +  P+   M L+ + +T   + G
Sbjct  237  IQKLHIQGSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKMNLKTLILTKCLIHG  296

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             IP Y+G++T L  ++L  N   G +P    KLA    + L+GN LTG +PK
Sbjct  297  EIPDYIGDMTKLKNIDLSFNNLTGGIPTTFEKLAKTNFMYLTGNKLTGPVPK  348


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++Q +IL      G LP  L KL  L  + IS +  SG IP    +W   K++ + + 
Sbjct  186  LINLQKLILSSNSFTGELPAELTKLTNLNDLRISDNNFSGKIPEFIGKWK--KIQKLHIQ  243

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + L GPIP  +  +T+L  L + +   + +  P+L K+ NL+ LIL+   + GE+P  +
Sbjct  244  GSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKM-NLKTLILTKCLIHGEIPDYI  302

Query  683  NSLT  694
              +T
Sbjct  303  GDMT  306



>emb|CDP06041.1| unnamed protein product [Coffea canephora]
Length=1026

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 122/175 (70%), Gaps = 3/175 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-ICHVQS  349
            + AL++IA  +GK+DW+F V+PC    NW TP    +    N +TCNCSF    +CHV S
Sbjct  52   VRALRQIAGTLGKRDWNFSVDPCSGRQNWATP--NPVKGLENAVTCNCSFVNNTVCHVVS  109

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIP  529
            I+L+ Q+L G LPP  VKLP+L+ ID++R+YL+GTIP EW SM+L  IS+  NR+SGP+P
Sbjct  110  IVLKAQNLPGTLPPEFVKLPYLREIDLTRNYLNGTIPLEWGSMQLVNISLIGNRISGPLP  169

Query  530  KYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            K LGNI+TL  L LE N  +G +PP+L  L +++ ++L+ N  TGELP  L +LT
Sbjct  170  KELGNISTLANLTLEFNQLSGNIPPDLGNLRHIERILLTSNNFTGELPATLANLT  224


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 61/122 (50%), Gaps = 5/122 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP---PEWASMKLEYISVTVN  508
            H++ I+L   +  G LP TL  L  LK   I  +   G+IP     W  + LE + +  +
Sbjct  201  HIERILLTSNNFTGELPATLANLTTLKDFRIGENQFVGSIPNFIQNW--INLEKLVIQAS  258

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
             LSGPIP  + ++T L  L + +   N T  P L    N++ LIL    + G+LP+ L S
Sbjct  259  GLSGPIPSGIASLTKLTDLRISDLNGNDTTFPPLIGATNMKTLILRSCNIAGQLPEFLGS  318

Query  689  LT  694
             T
Sbjct  319  FT  320


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 62/115 (54%), Gaps = 5/115 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSG---TIPPEWASMKLEYISVTVN  508
            +++ +++Q   L G +P  +  L   K+ D+  S L+G   T PP   +  ++ + +   
Sbjct  249  NLEKLVIQASGLSGPIPSGIASLT--KLTDLRISDLNGNDTTFPPLIGATNMKTLILRSC  306

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             ++G +P++LG+ T L  L+L  N  +G +P     L+   N+ L+GN L+G +P
Sbjct  307  NIAGQLPEFLGSFTKLKLLDLSFNKLSGPIPSTFFGLSKTDNIYLTGNILSGAVP  361



>ref|XP_010064485.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=1015

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 122/188 (65%), Gaps = 6/188 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A +  LP DE++AL+EIA  +GK DWDF+ NPC N S W   + K      N +TC+C+F
Sbjct  24   AAAATLPPDEVDALREIAKMLGKTDWDFKANPCGNISGW--GDIKLPSKTENAVTCDCNF  81

Query  323  PAG----ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEY  490
                   +CHV SI+L+ Q L G LPP L +LP+L+  D++R+YL+GTIP EW S KL  
Sbjct  82   TDANNKNVCHVTSIVLKKQSLPGTLPPRLFRLPYLQNFDVTRNYLNGTIPKEWGSTKLVN  141

Query  491  ISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGEL  670
            IS+  NRL+GPIPK LGNI+TL  L +E N  +G VPPEL  L+ L  L L+ N  TGEL
Sbjct  142  ISLLGNRLTGPIPKELGNISTLWKLVVEINQLSGAVPPELGNLSQLHQLHLTSNNFTGEL  201

Query  671  PKELNSLT  694
            PK    LT
Sbjct  202  PKTFAKLT  209


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 65/121 (54%), Gaps = 6/121 (5%)
 Frame = +2

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            F   + ++  +++QG  LQG +P  +  L   K+ D+  S L+G +  +   ++ + I+ 
Sbjct  228  FIQNLTNLYMLVIQGSGLQGPIPSGIALLE--KLSDLRISDLNG-LESQVPRLRCKNITT  284

Query  500  TVNR---LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGEL  670
             + R   L G +P YL  + TL  L+L  N   G +PP  + L+ +  + L+GN+LTG +
Sbjct  285  LILRSCNLIGELPGYLAEMITLKILDLSFNKLRGEIPPSFSSLSGVDYIYLTGNHLTGAV  344

Query  671  P  673
            P
Sbjct  345  P  345



>ref|XP_002524511.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37838.1| ATP binding protein, putative [Ricinus communis]
Length=985

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 123/180 (68%), Gaps = 4/180 (2%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            L + +  LP DE+ ALK+I   +GK  W+F V+PC  +S W TP    +  + N +TCNC
Sbjct  20   LASGAARLPNDEVEALKDIGKTLGKT-WNFTVDPCSGDSGWTTP--NPVKGFENAVTCNC  76

Query  317  SFP-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            SF  A ICHV SII++ Q LQG LP  L +LPFL+ ID +R+YL+GTIPPEW +++L  I
Sbjct  77   SFSNATICHVVSIIVKAQSLQGTLPRDLDRLPFLQEIDFTRNYLNGTIPPEWGTIQLVNI  136

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NRL+GPIPK LGNI+TL     E N  +G +PPEL  L +++ ++LS N LTG+LP
Sbjct  137  SLIGNRLTGPIPKELGNISTLASFTAEFNQLSGELPPELGDLRSIERILLSSNNLTGQLP  196



>gb|KCW67557.1| hypothetical protein EUGRSUZ_F01307 [Eucalyptus grandis]
Length=1008

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 122/188 (65%), Gaps = 6/188 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A +  LP DE++AL+EIA  +GK DWDF+ NPC N S W   + K      N +TC+C+F
Sbjct  24   AAAATLPPDEVDALREIAKMLGKTDWDFKANPCGNISGW--GDIKLPSKTENAVTCDCNF  81

Query  323  PAG----ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEY  490
                   +CHV SI+L+ Q L G LPP L +LP+L+  D++R+YL+GTIP EW S KL  
Sbjct  82   TDANNKNVCHVTSIVLKKQSLPGTLPPRLFRLPYLQNFDVTRNYLNGTIPKEWGSTKLVN  141

Query  491  ISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGEL  670
            IS+  NRL+GPIPK LGNI+TL  L +E N  +G VPPEL  L+ L  L L+ N  TGEL
Sbjct  142  ISLLGNRLTGPIPKELGNISTLWKLVVEINQLSGAVPPELGNLSQLHQLHLTSNNFTGEL  201

Query  671  PKELNSLT  694
            PK    LT
Sbjct  202  PKTFAKLT  209


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 65/121 (54%), Gaps = 6/121 (5%)
 Frame = +2

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            F   + ++  +++QG  LQG +P  +  L   K+ D+  S L+G +  +   ++ + I+ 
Sbjct  228  FIQNLTNLYMLVIQGSGLQGPIPSGIALLE--KLSDLRISDLNG-LESQVPRLRCKNITT  284

Query  500  TVNR---LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGEL  670
             + R   L G +P YL  + TL  L+L  N   G +PP  + L+ +  + L+GN+LTG +
Sbjct  285  LILRSCNLIGELPGYLAEMITLKILDLSFNKLRGEIPPSFSSLSGVDYIYLTGNHLTGAV  344

Query  671  P  673
            P
Sbjct  345  P  345



>ref|XP_004305822.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Fragaria vesca subsp. vesca]
Length=1031

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 128/197 (65%), Gaps = 7/197 (4%)
 Frame = +2

Query  119  SFNARFLEAQSGH-----LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDM  283
            +F A FL A  G      L   E+NALKEIA ++GKKDWDF ++PC    NW       M
Sbjct  19   TFTAFFLPASFGQPAIAKLHSQEVNALKEIAKKLGKKDWDFGIDPCTGEGNWRVF-VNGM  77

Query  284  PAYNNTLTCNCSFP-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP  460
             ++ + +TC+CSF     CH+ S++L+ Q+L G LPP   KL +LK +D+SR+ L+G+IP
Sbjct  78   KSFESNVTCDCSFNNHSSCHIVSLVLKSQNLTGTLPPEFAKLHYLKELDLSRNLLTGSIP  137

Query  461  PEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLI  640
             EWA M+LE + +  NRLSGP PK L +ITTL  L++E N+F+G +P E+ KL  L+ LI
Sbjct  138  SEWAIMQLEDLGLMGNRLSGPFPKVLTSITTLRNLSIEGNLFSGPIPSEIGKLVKLEKLI  197

Query  641  LSGNYLTGELPKELNSL  691
            LS N  TGELP+ L  L
Sbjct  198  LSSNLFTGELPQALAKL  214



>ref|XP_011467565.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Fragaria vesca subsp. vesca]
Length=1022

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 128/197 (65%), Gaps = 7/197 (4%)
 Frame = +2

Query  119  SFNARFLEAQSGH-----LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDM  283
            +F A FL A  G      L   E+NALKEIA ++GKKDWDF ++PC    NW       M
Sbjct  19   TFTAFFLPASFGQPAIAKLHSQEVNALKEIAKKLGKKDWDFGIDPCTGEGNWRVF-VNGM  77

Query  284  PAYNNTLTCNCSFP-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP  460
             ++ + +TC+CSF     CH+ S++L+ Q+L G LPP   KL +LK +D+SR+ L+G+IP
Sbjct  78   KSFESNVTCDCSFNNHSSCHIVSLVLKSQNLTGTLPPEFAKLHYLKELDLSRNLLTGSIP  137

Query  461  PEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLI  640
             EWA M+LE + +  NRLSGP PK L +ITTL  L++E N+F+G +P E+ KL  L+ LI
Sbjct  138  SEWAIMQLEDLGLMGNRLSGPFPKVLTSITTLRNLSIEGNLFSGPIPSEIGKLVKLEKLI  197

Query  641  LSGNYLTGELPKELNSL  691
            LS N  TGELP+ L  L
Sbjct  198  LSSNLFTGELPQALAKL  214



>ref|XP_010247776.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Nelumbo nucifera]
Length=978

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 126/186 (68%), Gaps = 8/186 (4%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            L +++  LP +E+ ALK IA ++ KK+WDF V+PC  +  W T   K+     N +TC C
Sbjct  29   LRSETQRLPDEEVKALKLIAAKLNKKNWDFSVDPC--SGKWNTSNEKETM---NAVTCYC  83

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            +     CHV +I ++ + LQGVLPP L +LP+L+IID+SR+YLSGTIPPEW +MKL  IS
Sbjct  84   N---TTCHVIAIYIKSEGLQGVLPPELAQLPYLQIIDLSRNYLSGTIPPEWGAMKLTNIS  140

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            +  NRL+GPIPK  GNITTLV L LE N  +G +P EL KL NL+ L+LS N  TG  P+
Sbjct  141  LMANRLTGPIPKEFGNITTLVDLTLEVNNLSGNIPNELGKLINLRKLVLSSNNFTGPFPE  200

Query  677  ELNSLT  694
             L+ L 
Sbjct  201  SLSKLV  206



>gb|KEH38575.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=973

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = +2

Query  182  LKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFP-AGICHVQSIIL  358
            +K+IA  +GKKDWDF ++PC   SNW +     M  + N +TCNC F  A +CH+ SI+L
Sbjct  1    MKDIAKTLGKKDWDFSIDPCSGQSNWTSSS--PMKGFANAVTCNCYFANATVCHIVSIVL  58

Query  359  QGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPKYL  538
            + Q+L G LP   VKLP+L+ ID++R+YL+GTIPP+W SM L  IS+  NRL+GPIPK L
Sbjct  59   KSQNLSGTLPWEFVKLPYLQQIDLTRNYLNGTIPPQWGSMHLVNISLLGNRLTGPIPKEL  118

Query  539  GNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            G ITTL  L LE N F+G +PPEL  L  L+ L+L+ N  TG LP   + LT
Sbjct  119  GKITTLKSLVLEFNQFSGQLPPELGNLHQLERLLLTSNNFTGNLPATFSKLT  170


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRLS  517
            ++ +++QG  L G +P  +  L  L  + IS    S +  P+  ++K LE + +    L 
Sbjct  196  LERLVMQGSGLSGPVPSGISYLKNLTDLRISDLKGSDSHFPQLMNLKNLETLILRSCNLI  255

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            G +P+YLG+IT+L  L+L  N  +G +P  L  L N+  L L+GN  TG LP
Sbjct  256  GTVPEYLGDITSLRSLDLSFNKLSGQIPNTLGGLENINILYLTGNLFTGPLP  307


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 62/122 (51%), Gaps = 5/122 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVTVN  508
             ++ ++L   +  G LP T  KL  LK I +  +  SGTIP     WAS  LE + +  +
Sbjct  147  QLERLLLTSNNFTGNLPATFSKLTNLKHIRLGDNQFSGTIPDLIQNWAS--LERLVMQGS  204

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
             LSGP+P  +  +  L  L + +   + +  P+L  L NL+ LIL    L G +P+ L  
Sbjct  205  GLSGPVPSGISYLKNLTDLRISDLKGSDSHFPQLMNLKNLETLILRSCNLIGTVPEYLGD  264

Query  689  LT  694
            +T
Sbjct  265  IT  266



>ref|XP_006448020.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
 gb|ESR61260.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
Length=1020

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 127/192 (66%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  SFNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            +F    + A +  L  +E+ ALK+I  ++GKKDW+F V+PC    NW      D   + +
Sbjct  23   TFFGYAIAATANKLHAEEVKALKQIGRKLGKKDWNFGVDPCSQKGNW-ELSSDDKKGFES  81

Query  299  TLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
             +TC+CS  +  CHV +I L+ Q+L G LP  L KL +LK +D+SR+ L+G+ PP+WA++
Sbjct  82   NVTCDCS--SATCHVVTIALKAQNLTGTLPTELSKLRYLKQLDLSRNCLTGSFPPQWATL  139

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
            +L  +SV  NRLSGP PK L NITTL  L++E N+F G++PP++ KL NLQ LILS N  
Sbjct  140  QLVELSVMGNRLSGPFPKVLTNITTLKNLSIEGNLFTGSIPPDIRKLINLQKLILSSNSF  199

Query  659  TGELPKELNSLT  694
            TG+LP E+  LT
Sbjct  200  TGKLPAEITKLT  211


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            +Q + +QG  L+G +P ++  L  L  + IS    S +  P+   M L+ + +T   + G
Sbjct  237  IQKLHIQGSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKMNLKTLILTKCLIHG  296

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             IP Y+G++T L  ++L  N   G +P    KLA    + L+GN LTG +PK
Sbjct  297  EIPDYIGDMTKLKNIDLSFNNLTGGIPTTFEKLAKTNFMYLTGNKLTGPVPK  348


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++Q +IL      G LP  + KL  L  + IS +  SG IP    +W   K++ + + 
Sbjct  186  LINLQKLILSSNSFTGKLPAEITKLTNLNDLRISDNNFSGKIPEFIGKWK--KIQKLHIQ  243

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + L GPIP  +  +T+L  L + +   + +  P+L K+ NL+ LIL+   + GE+P  +
Sbjct  244  GSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKM-NLKTLILTKCLIHGEIPDYI  302

Query  683  NSLT  694
              +T
Sbjct  303  GDMT  306



>ref|XP_006492254.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Citrus sinensis]
Length=1020

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 127/192 (66%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  SFNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            +F    + A +  L  +E+ ALK+I  ++GKKDW+F V+PC    NW      D   + +
Sbjct  23   TFFGYAIAATANKLHAEEVKALKQIGRKLGKKDWNFGVDPCSQKGNW-ELSSDDKKGFES  81

Query  299  TLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
             +TC+CS  +  CHV +I L+ Q+L G LP  L KL +LK +D+SR+ L+G+ PP+WA++
Sbjct  82   NVTCDCS--SATCHVVTIALKAQNLTGTLPTELSKLRYLKQLDLSRNCLTGSFPPQWATL  139

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
            +L  +SV  NRLSGP PK L NITTL  L++E N+F G++PP++ KL NLQ LILS N  
Sbjct  140  QLVELSVMGNRLSGPFPKVLTNITTLKNLSIEGNLFTGSIPPDIRKLINLQKLILSSNSF  199

Query  659  TGELPKELNSLT  694
            TG+LP E+  LT
Sbjct  200  TGKLPAEITKLT  211


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            +Q + +QG  L+G +P ++  L  L  + +S    S +  P+   M L+ + +T   + G
Sbjct  237  IQKLHIQGSSLEGPIPASISALTSLTDLRVSDLKGSESAFPKLDKMNLKTLILTKCLIHG  296

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             IP Y+G++T L  ++L  N   G +P    KLA    + L+GN LTG +PK
Sbjct  297  EIPGYIGDMTKLKNIDLSFNNLTGGIPTTFEKLAKTNFMYLTGNKLTGPVPK  348


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++Q +IL      G LP  + KL  L  + IS +  SG IP    +W   K++ + + 
Sbjct  186  LINLQKLILSSNSFTGKLPAEITKLTNLNDLRISDNNFSGKIPEFIGKWK--KIQKLHIQ  243

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + L GPIP  +  +T+L  L + +   + +  P+L K+ NL+ LIL+   + GE+P  +
Sbjct  244  GSSLEGPIPASISALTSLTDLRVSDLKGSESAFPKLDKM-NLKTLILTKCLIHGEIPGYI  302

Query  683  NSLT  694
              +T
Sbjct  303  GDMT  306



>ref|XP_010273487.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Nelumbo nucifera]
Length=987

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 125/191 (65%), Gaps = 8/191 (4%)
 Frame = +2

Query  131  RFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYN--NTL  304
            RF  AQ   L  DE+ AL+EIA  +GK+DW+F V+PC   S W TP       Y   N +
Sbjct  21   RFGVAQP-TLVSDEVEALREIAKRLGKRDWNFSVDPCSGQSGWTTPG----ATYRRLNIV  75

Query  305  TCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
             C+CS      CHV  I+L+ Q LQGVLPP L KLP+LK ID++ +YLSG IPP W SM+
Sbjct  76   GCDCSLVNNSACHVTRILLKSQGLQGVLPPELFKLPYLKEIDLTLNYLSGAIPPVWGSMR  135

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE IS+  NR+SG IPK LG++TTL  L LE N  +G + PEL  L NL+ L++S N  T
Sbjct  136  LEIISIYGNRVSGSIPKELGSMTTLRELVLEANHMSGVLSPELGNLINLERLVISSNNFT  195

Query  662  GELPKELNSLT  694
            G+LP+ L++LT
Sbjct  196  GQLPERLSALT  206



>ref|XP_010273490.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Nelumbo nucifera]
Length=979

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 125/191 (65%), Gaps = 8/191 (4%)
 Frame = +2

Query  131  RFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYN--NTL  304
            RF  AQ   L  DE+ AL+EIA  +GK+DW+F V+PC   S W TP       Y   N +
Sbjct  21   RFGVAQP-TLVSDEVEALREIAKRLGKRDWNFSVDPCSGQSGWTTPG----ATYRRLNIV  75

Query  305  TCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
             C+CS      CHV  I+L+ Q LQGVLPP L KLP+LK ID++ +YLSG IPP W SM+
Sbjct  76   GCDCSLVNNSACHVTRILLKSQGLQGVLPPELFKLPYLKEIDLTLNYLSGAIPPVWGSMR  135

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE IS+  NR+SG IPK LG++TTL  L LE N  +G + PEL  L NL+ L++S N  T
Sbjct  136  LEIISIYGNRVSGSIPKELGSMTTLRELVLEANHMSGVLSPELGNLINLERLVISSNNFT  195

Query  662  GELPKELNSLT  694
            G+LP+ L++LT
Sbjct  196  GQLPERLSALT  206



>ref|XP_010273489.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Nelumbo nucifera]
Length=983

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 125/191 (65%), Gaps = 8/191 (4%)
 Frame = +2

Query  131  RFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYN--NTL  304
            RF  AQ   L  DE+ AL+EIA  +GK+DW+F V+PC   S W TP       Y   N +
Sbjct  21   RFGVAQP-TLVSDEVEALREIAKRLGKRDWNFSVDPCSGQSGWTTPG----ATYRRLNIV  75

Query  305  TCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
             C+CS      CHV  I+L+ Q LQGVLPP L KLP+LK ID++ +YLSG IPP W SM+
Sbjct  76   GCDCSLVNNSACHVTRILLKSQGLQGVLPPELFKLPYLKEIDLTLNYLSGAIPPVWGSMR  135

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE IS+  NR+SG IPK LG++TTL  L LE N  +G + PEL  L NL+ L++S N  T
Sbjct  136  LEIISIYGNRVSGSIPKELGSMTTLRELVLEANHMSGVLSPELGNLINLERLVISSNNFT  195

Query  662  GELPKELNSLT  694
            G+LP+ L++LT
Sbjct  196  GQLPERLSALT  206



>ref|XP_007021936.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY13461.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=185

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP DE  ALK IA  +GK +W+F V+PC  +S+W   E +D+  Y+N +TC+CSF
Sbjct  22   AFGATLPHDEEEALKSIAKTLGKTNWNFEVDPCSRHSSWV--EVEDLKDYDNNVTCDCSF  79

Query  323  PAGI-CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
                 CHV +I L+ Q+L G LPP LV+LPFL+ ID+SR+YL+GTIPP+W SM+L  IS+
Sbjct  80   SNNTTCHVVNIRLKAQNLSGTLPPELVRLPFLQEIDLSRNYLNGTIPPKWGSMQLVNISL  139

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNL  637
              NRL+GPIPK L NI+TL  L +E N  +GT+P EL  L +++ +
Sbjct  140  LGNRLTGPIPKELANISTLTILVVEENQLSGTLPAELGHLPSIEKM  185



>ref|XP_010246509.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1013

 Score =   181 bits (458),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 124/186 (67%), Gaps = 7/186 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFT--PERKDMPAYNNTLTCNC  316
            A    L  DE+NAL++IA  +GK +WDF V+PC   S W T  PE+     + N + CNC
Sbjct  22   ASGATLVKDEVNALRQIAKTLGKTNWDFSVDPCSGLSGWTTANPEK----GFENAVYCNC  77

Query  317  SFPAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            SF    +CHV SI+L+ Q L GVLPP LVKLP+L+ ID++R+YL+GTIP EW +M+L  I
Sbjct  78   SFSNNTLCHVTSIVLKVQSLPGVLPPELVKLPYLQEIDLTRNYLNGTIPSEWGTMQLVNI  137

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NRLSGPIPK  GNITTL  L+LE N  +G +P EL  +  L+ +++S N  TG LP
Sbjct  138  SLLGNRLSGPIPKEFGNITTLKNLSLEYNQLSGVLPSELGNIVGLERILISSNNFTGPLP  197

Query  674  KELNSL  691
            +  + L
Sbjct  198  EAFSKL  203


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 60/124 (48%), Gaps = 5/124 (4%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP---PEWASMKLEYISVT  502
            I  ++ I++   +  G LP    KL  L    IS +  +GTIP    +W   KLE +++ 
Sbjct  179  IVGLERILISSNNFTGPLPEAFSKLANLGDFRISDNQFNGTIPNFIGKWT--KLEKLAIQ  236

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + L GPIP  +  +  L  L + +     +  P L+ +AN++ LIL    + G LP  L
Sbjct  237  ASGLQGPIPSNISFLENLTDLRISDISGTESTFPPLSNMANMKTLILRSCNIIGGLPSYL  296

Query  683  NSLT  694
              +T
Sbjct  297  ADMT  300



>ref|XP_010273486.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=1014

 Score =   180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 125/191 (65%), Gaps = 8/191 (4%)
 Frame = +2

Query  131  RFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYN--NTL  304
            RF  AQ   L  DE+ AL+EIA  +GK+DW+F V+PC   S W TP       Y   N +
Sbjct  21   RFGVAQP-TLVSDEVEALREIAKRLGKRDWNFSVDPCSGQSGWTTPG----ATYRRLNIV  75

Query  305  TCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
             C+CS      CHV  I+L+ Q LQGVLPP L KLP+LK ID++ +YLSG IPP W SM+
Sbjct  76   GCDCSLVNNSACHVTRILLKSQGLQGVLPPELFKLPYLKEIDLTLNYLSGAIPPVWGSMR  135

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE IS+  NR+SG IPK LG++TTL  L LE N  +G + PEL  L NL+ L++S N  T
Sbjct  136  LEIISIYGNRVSGSIPKELGSMTTLRELVLEANHMSGVLSPELGNLINLERLVISSNNFT  195

Query  662  GELPKELNSLT  694
            G+LP+ L++LT
Sbjct  196  GQLPERLSALT  206



>ref|XP_010273485.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Nelumbo nucifera]
Length=1018

 Score =   180 bits (457),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 125/191 (65%), Gaps = 8/191 (4%)
 Frame = +2

Query  131  RFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYN--NTL  304
            RF  AQ   L  DE+ AL+EIA  +GK+DW+F V+PC   S W TP       Y   N +
Sbjct  21   RFGVAQP-TLVSDEVEALREIAKRLGKRDWNFSVDPCSGQSGWTTPG----ATYRRLNIV  75

Query  305  TCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
             C+CS      CHV  I+L+ Q LQGVLPP L KLP+LK ID++ +YLSG IPP W SM+
Sbjct  76   GCDCSLVNNSACHVTRILLKSQGLQGVLPPELFKLPYLKEIDLTLNYLSGAIPPVWGSMR  135

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            LE IS+  NR+SG IPK LG++TTL  L LE N  +G + PEL  L NL+ L++S N  T
Sbjct  136  LEIISIYGNRVSGSIPKELGSMTTLRELVLEANHMSGVLSPELGNLINLERLVISSNNFT  195

Query  662  GELPKELNSLT  694
            G+LP+ L++LT
Sbjct  196  GQLPERLSALT  206



>gb|KEH38573.1| LRR receptor-like kinase [Medicago truncatula]
Length=963

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 124/185 (67%), Gaps = 3/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A+   L  +E+  +K++A  +GKKDWDF ++PC   +NW T     M  + N +TCNC+F
Sbjct  23   ARGATLLQEEVQVMKDVAKTLGKKDWDFNIDPCSGENNWTTSS--PMKGFENAVTCNCTF  80

Query  323  P-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              A +CH+ SI+L+ Q+L G LP  LV+LP+L+ ID+S +YL+GTIPP+W SM L  IS+
Sbjct  81   ANATVCHIVSIVLKSQNLSGTLPRELVRLPYLQQIDLSNNYLNGTIPPQWGSMNLVNISL  140

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+G IPK LGNI+T+  L L+ N  +G +PPEL  L  L+ L+L+ N+ TG LP  
Sbjct  141  IGNRLTGSIPKELGNISTMQKLILKFNQLSGDLPPELGNLHQLERLLLTSNFFTGNLPPT  200

Query  680  LNSLT  694
              +LT
Sbjct  201  FANLT  205


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 75/155 (48%), Gaps = 16/155 (10%)
 Frame = +2

Query  251  SNWFT----PERKDMPAYNNTLTCNCSFPAGICH-------VQSIILQGQDLQGVLPPTL  397
            SN+FT    P   ++    +   C+  F   I H       ++ +++QG  L G +P  +
Sbjct  190  SNFFTGNLPPTFANLTKLKHIRLCDNQFSGTIPHFIQNWTILERMVMQGSGLSGPIPSGI  249

Query  398  VKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR---LSGPIPKYLGNITTLVYLN  568
            + L    + D+  S L G+  P    + L+ I   V R   L G +P YLGNITTL  L+
Sbjct  250  LNLK--NLTDLRISDLKGSDSPFPQVIGLKNIQTLVLRSCNLIGEVPDYLGNITTLKSLD  307

Query  569  LENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            L  N   G +P  L  L ++  L L+GN LTG LP
Sbjct  308  LSFNKLTGPIPNTLGGLTSISMLYLTGNLLTGPLP  342


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 72/146 (49%), Gaps = 25/146 (17%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVN  508
            I  +Q +IL+   L G LPP L  L  L+ + ++ ++ +G +PP +A++ KL++I +  N
Sbjct  156  ISTMQKLILKFNQLSGDLPPELGNLHQLERLLLTSNFFTGNLPPTFANLTKLKHIRLCDN  215

Query  509  R------------------------LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAK  616
            +                        LSGPIP  + N+  L  L + +   + +  P++  
Sbjct  216  QFSGTIPHFIQNWTILERMVMQGSGLSGPIPSGILNLKNLTDLRISDLKGSDSPFPQVIG  275

Query  617  LANLQNLILSGNYLTGELPKELNSLT  694
            L N+Q L+L    L GE+P  L ++T
Sbjct  276  LKNIQTLVLRSCNLIGEVPDYLGNIT  301



>gb|KCW75322.1| hypothetical protein EUGRSUZ_E04068 [Eucalyptus grandis]
Length=329

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 120/187 (64%), Gaps = 5/187 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A S  LP DE+ AL+EI + +GK DWDF  +PC  +  W   + KD+ A +N +TC    
Sbjct  24   AASTLLPDDEVEALREIGETLGKSDWDFNADPCGVDGGW--GDNKDIDATSNAVTCQNFT  81

Query  323  PA---GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
             A    + HV SI+L+ Q L G LPP L +LP+LK  D++R+YL+G IP EW S KL  I
Sbjct  82   DADNNSVPHVISIVLRNQSLPGSLPPQLFRLPYLKNFDVTRNYLNGIIPKEWGSTKLRNI  141

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            SV +NRL+G IPK LGNI+TL  LN+E+N  +G +PP+L  L+ L  L L+ N  TGELP
Sbjct  142  SVVINRLTGSIPKELGNISTLWELNVESNQLSGALPPDLGNLSQLIQLQLTSNNFTGELP  201

Query  674  KELNSLT  694
            +    LT
Sbjct  202  QRFAELT  208



>gb|KGN47984.1| hypothetical protein Csa_6G421780 [Cucumis sativus]
Length=834

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 124/190 (65%), Gaps = 3/190 (2%)
 Frame = +2

Query  128  ARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLT  307
            A F  A +  L  +E+ ALKEI  ++GK DWDF ++PC     W     +    + +++T
Sbjct  28   ATFGLAAAAKLHREEVKALKEIEKKLGKNDWDFNIDPCSGEGKWHVVNGR--KGFESSVT  85

Query  308  CNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKL  484
            C+CSF     CH+ +I L+ Q+L G++PP   KL FLK +D+SR+ L+G +P +WA+M+L
Sbjct  86   CDCSFNHNSTCHIVAIALKSQNLSGIVPPEFSKLRFLKQLDLSRNCLTGFVPSQWATMRL  145

Query  485  EYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTG  664
              +S   N+LSGP PK L NITTL  L++E N F+G +PPE+ KL NL+ L+LS N LTG
Sbjct  146  VELSFMGNKLSGPFPKVLTNITTLRNLSIEGNQFSGRIPPEIGKLVNLEKLVLSSNGLTG  205

Query  665  ELPKELNSLT  694
            ELPK L  L+
Sbjct  206  ELPKGLAKLS  215


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 66/124 (53%), Gaps = 7/124 (6%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP---PEWASMKLEYISVT  502
            + +++ ++L    L G LP  L KL  L  + IS +  SG IP     WA  ++E + + 
Sbjct  190  LVNLEKLVLSSNGLTGELPKGLAKLSNLTDMRISDNNFSGKIPEFISNWA--QIEKLHIQ  247

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVP-PELAKLANLQNLILSGNYLTGELPKE  679
               L GPIP  +  +T+L  L + +++  G  P P L+ + +++ LIL   ++ GE+PK 
Sbjct  248  GCSLEGPIPLSISTMTSLTDLRI-SDLKGGRSPFPPLSNIKSMKTLILRKCFIFGEIPKY  306

Query  680  LNSL  691
            +  +
Sbjct  307  IGDM  310



>emb|CDP06042.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   179 bits (455),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 121/185 (65%), Gaps = 3/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    L  DE++ L+EIA  +GK DW+F V+PC   SNW          + N +TC+C F
Sbjct  27   ASGATLVPDEVDVLREIAKTLGKTDWNFGVDPCSGESNWRNATAP--KEFANAVTCDCFF  84

Query  323  P-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              +  CHV SI+L+ Q L G LPP LVKLP+L+  D++R+YLSG+IPP W +M+L  IS+
Sbjct  85   QNSTTCHVVSIVLKSQSLPGELPPELVKLPYLREFDVTRNYLSGSIPPIWGTMQLVNISL  144

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NR+SG IPK LGNI+TL  L L+ N  +GT+PPEL  L+ LQ L L+ N  TGELP+ 
Sbjct  145  NSNRISGRIPKELGNISTLANLTLDFNQLSGTIPPELGNLSRLQKLTLTSNNWTGELPRT  204

Query  680  LNSLT  694
            L  LT
Sbjct  205  LADLT  209


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 69/142 (49%), Gaps = 12/142 (8%)
 Frame = +2

Query  278  DMPAYNNTLTCNCSFPAGICH-------VQSIILQGQDLQGVLPPTLVKLPFLKIIDISR  436
            D+ A       +C+F   I +       ++++++ G  L+G +PP +  L    + D+  
Sbjct  207  DLTALKIFWIGDCNFTGSIPNFIENWKSIENLVIHGSGLKGPIPPGIASLT--NLTDLRI  264

Query  437  SYLSG---TIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPE  607
            S LSG   T P    +  +  + +    + G +P YLG++T L  L+L  N  +G +P  
Sbjct  265  SDLSGNDTTFPNLRGATNMRTLVLRSCNIVGQLPDYLGSLTKLKVLDLSFNKIDGPIPRS  324

Query  608  LAKLANLQNLILSGNYLTGELP  673
            L  L+N   + L+GN  TG +P
Sbjct  325  LDALSNTVFIYLTGNNFTGTIP  346


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 60/124 (48%), Gaps = 5/124 (4%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP---PEWASMKLEYISVT  502
            +  +Q + L   +  G LP TL  L  LKI  I     +G+IP     W S  +E + + 
Sbjct  184  LSRLQKLTLTSNNWTGELPRTLADLTALKIFWIGDCNFTGSIPNFIENWKS--IENLVIH  241

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + L GPIP  + ++T L  L + +   N T  P L    N++ L+L    + G+LP  L
Sbjct  242  GSGLKGPIPPGIASLTNLTDLRISDLSGNDTTFPNLRGATNMRTLVLRSCNIVGQLPDYL  301

Query  683  NSLT  694
             SLT
Sbjct  302  GSLT  305



>ref|XP_006477833.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Citrus sinensis]
Length=996

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 119/185 (64%), Gaps = 7/185 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP DE+ AL +IAD++GK  WD  V+PC     W    +K      N +TCNCS+
Sbjct  20   ASGATLPEDEVKALGDIADKLGKTGWDLSVDPCSRRGGWLVDLKK------NAVTCNCSY  73

Query  323  PAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              G +CHV SIIL+ Q L GVLPP L +LPFL+ ID++R+YL+GTIP EWAS+ L  IS+
Sbjct  74   SGGTVCHVVSIILKEQSLPGVLPPELSRLPFLQEIDLTRNYLNGTIPSEWASLPLVNISL  133

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+GPIPK   NI+TL  L +++N  +G +P EL  L NL+   ++ N  TGELP+ 
Sbjct  134  LANRLTGPIPKNFANISTLANLTVQSNRLSGELPEELGSLFNLEKFHINSNNFTGELPQT  193

Query  680  LNSLT  694
               LT
Sbjct  194  FAKLT  198


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 79/174 (45%), Gaps = 14/174 (8%)
 Frame = +2

Query  188  EIADEVGKKDWDFRVNPCENNSNWFTPE----------RKDMPAYNNTLTCNC-SFPAGI  334
            E+ +E+G     F +     NSN FT E           KD    +N  T    SF    
Sbjct  165  ELPEELGSL---FNLEKFHINSNNFTGELPQTFAKLTNMKDFRISDNQFTGEIPSFIQNW  221

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
              + ++ +Q   L G +   +  L  L  + IS         P+  +   + + +    L
Sbjct  222  TKLHTLFIQASGLVGPILSGITSLGSLTDLRISDLNGPEATLPDLRNRTFKNLILRSCNL  281

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            +G +P +LG ++ +  L+L  N  NGT+P   A+LA++  + L+GN LTG++P+
Sbjct  282  TGELPHFLGEVSEMKVLDLSFNKLNGTIPESFARLADVDFIYLTGNLLTGKVPQ  335



>ref|XP_007214913.1| hypothetical protein PRUPE_ppa000698mg [Prunus persica]
 gb|EMJ16112.1| hypothetical protein PRUPE_ppa000698mg [Prunus persica]
Length=1030

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 123/194 (63%), Gaps = 3/194 (2%)
 Frame = +2

Query  122  FNARFLEAQSGHLPL--DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYN  295
            F A F ++ +    L   E+NALKEI  ++GKKDWDFR +PC    NW          + 
Sbjct  24   FFATFGQSATATAKLHSQEVNALKEIGKKLGKKDWDFRKDPCTGEGNWNVSIEGRRKGFE  83

Query  296  NTLTCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWA  472
            +++ CNC+F     CHV SI L+ Q+L G +PP   KL  LK +D+SR+YL+G+IP +W 
Sbjct  84   SSVACNCTFNHNSSCHVISIALKAQNLSGTVPPEFSKLQHLKDLDLSRNYLNGSIPSQWG  143

Query  473  SMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGN  652
            +M+L  +S+  NRLSGP PK L NITTL  L++E N F+G +PPE+ KL  L+ LI+S N
Sbjct  144  TMRLVTLSLMGNRLSGPFPKVLTNITTLRNLSIEGNHFSGPIPPEIGKLIKLEKLIVSSN  203

Query  653  YLTGELPKELNSLT  694
              TGELP  L  LT
Sbjct  204  AFTGELPLALAKLT  217


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 56/115 (49%), Gaps = 5/115 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR--  511
             +  + +QG  L+G +P ++  L  L   D+  + L GT  P  +   LE +   + R  
Sbjct  242  RISKLHIQGSSLEGPIPSSISGLRSL--TDLRITDLRGTESPFPSLRNLESLKTLILRNC  299

Query  512  -LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             + G IP Y+ ++  L  L+L  N   G +P    +LA +    L+GN LTG +P
Sbjct  300  LIYGVIPAYIADMKRLKNLDLSYNELTGEIPASFVQLAKVDFTYLTGNQLTGTVP  354



>ref|XP_008463778.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Cucumis melo]
Length=1015

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 123/190 (65%), Gaps = 4/190 (2%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERK---DMPAYNNTLT  307
            + +QS  LP  E+ ALKEI   +GK+DW+F V+PC  +  W +   +   ++  + N LT
Sbjct  20   IHSQSTRLPFHEVEALKEIGKSLGKRDWNFSVDPCNGSHGWISQPNQIPYNVAGFENNLT  79

Query  308  CNCSF-PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKL  484
            C+C+F  A +CHV SI+L+ Q LQG LPP LV+LPFL+ ID++R+YLSG IPPEW S  L
Sbjct  80   CDCTFLNATVCHVISIVLKSQSLQGTLPPHLVRLPFLQQIDLTRNYLSGQIPPEWGSTNL  139

Query  485  EYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTG  664
              I +  NRL+G IP+ +GNITTL  L L  N  +G++P  L  L  +Q L L+ N  +G
Sbjct  140  VSIYLLGNRLTGLIPEEIGNITTLENLVLGINQLSGSIPQALGNLPQIQRLHLTSNNFSG  199

Query  665  ELPKELNSLT  694
            ELP  L  LT
Sbjct  200  ELPMSLGKLT  209


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 55/111 (50%), Gaps = 5/111 (5%)
 Frame = +2

Query  350  IILQGQDLQGVLPPT---LVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            + +Q   L G +P     L KL  L+I D+S +  S   P    S +L  + +    +SG
Sbjct  238  LFIQASGLSGPIPSDIGLLTKLSDLRISDLSGA--SSPFPSLGNSKELTILVLRSCNISG  295

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +P YL  + +L  L+L  N  +G +P     L  L N++L+GN L G +P
Sbjct  296  RLPNYLDRMPSLKILDLSFNSLSGRIPTRFDALKGLDNILLTGNMLNGSVP  346



>ref|XP_008229374.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=1019

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 124/194 (64%), Gaps = 3/194 (2%)
 Frame = +2

Query  122  FNARFLEAQSGHLPL--DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYN  295
            F A F ++ +    L   E+NALKEI  ++GKKDWDFR +PC    NW          + 
Sbjct  24   FFATFGQSATATAKLHSQEVNALKEIGKKLGKKDWDFRKDPCTGEGNWNGSIEGRRKGFE  83

Query  296  NTLTCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWA  472
            +++TC+C+F     CHV SI L+ Q+L G +PP   KL  LK +D+SR+YL+G+IP +W 
Sbjct  84   SSVTCDCTFNHNSSCHVISIALKAQNLSGTVPPEFSKLQHLKDLDLSRNYLNGSIPSQWG  143

Query  473  SMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGN  652
            +M+L  +S+  NRLSGP PK L NITTL  L++E N F+G +PPE+ KL  L+ L++S N
Sbjct  144  TMRLVTLSLMGNRLSGPFPKVLTNITTLRNLSIEGNHFSGPIPPEIGKLIKLEKLVVSSN  203

Query  653  YLTGELPKELNSLT  694
              TGELP  L  LT
Sbjct  204  AFTGELPLALAKLT  217


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (50%), Gaps = 5/115 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR--  511
             +  +++QG  L+G +P ++  L  L   D+  + L GT  P      LE +   + R  
Sbjct  242  QISKLLIQGSSLEGPIPSSISGLTSL--TDLRITDLRGTESPFPPLRNLESLKKLILRNC  299

Query  512  -LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             + G IP Y+G++  L  L+L  N   G +P    +LA +    L+GN LTG +P
Sbjct  300  LIYGVIPAYIGDMKRLKNLDLSYNELTGEIPASFVQLAKVDFTYLTGNQLTGTVP  354



>gb|KEH38571.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=989

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 123/185 (66%), Gaps = 3/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    L  +E+  +KEIA  +GKKDWDF ++PC   +NW +  +  +  + N +TCNC+F
Sbjct  23   ASGATLLQEEVKVMKEIAKTLGKKDWDFNIDPCTGENNWKSSVQ--VKGFENAVTCNCTF  80

Query  323  P-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              A +CH+ SI+L+ Q+L G LP  LV+LP+L+ ID+S +YL+GTIPP+W SM L  IS+
Sbjct  81   ANATVCHIVSIVLRSQNLSGTLPRELVRLPYLQQIDLSNNYLNGTIPPQWGSMNLVNISL  140

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+G IPK LGNI+T+  L L+ N  +G +PPEL  L  L+ L+L+ N+ TG LP  
Sbjct  141  IGNRLTGSIPKELGNISTMQKLILKFNQLSGELPPELGNLHQLERLLLTSNFFTGNLPAT  200

Query  680  LNSLT  694
               LT
Sbjct  201  FAKLT  205


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 62/137 (45%), Gaps = 25/137 (18%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMK---------  481
             ++ ++L      G LP T  KL  LK I +  +  SGTIP     W  ++         
Sbjct  182  QLERLLLTSNFFTGNLPATFAKLTKLKHIRLCDNQFSGTIPDFIQSWTILERMRISDLKG  241

Query  482  ----------LEYISVTVNR---LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLA  622
                      L+ I   V R   L G +P YLGNITTL  L+L  N   G +P  L  L 
Sbjct  242  SDSPFPQVIGLKNIQTLVLRSCNLIGEVPDYLGNITTLKSLDLSFNKLTGPIPITLGGLK  301

Query  623  NLQNLILSGNYLTGELP  673
            N+  L L+GN LTG LP
Sbjct  302  NINMLYLTGNLLTGPLP  318


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 69/122 (57%), Gaps = 1/122 (1%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVN  508
            I  +Q +IL+   L G LPP L  L  L+ + ++ ++ +G +P  +A + KL++I +  N
Sbjct  156  ISTMQKLILKFNQLSGELPPELGNLHQLERLLLTSNFFTGNLPATFAKLTKLKHIRLCDN  215

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            + SG IP ++ + T L  + + +   + +  P++  L N+Q L+L    L GE+P  L +
Sbjct  216  QFSGTIPDFIQSWTILERMRISDLKGSDSPFPQVIGLKNIQTLVLRSCNLIGEVPDYLGN  275

Query  689  LT  694
            +T
Sbjct  276  IT  277



>ref|XP_006477831.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X2 [Citrus sinensis]
Length=1001

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 124/185 (67%), Gaps = 8/185 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP +E+ ALK+IA+ +GKKDW+F V+PC     W      ++P   N +TCNCSF
Sbjct  20   ASGAILPENEVQALKDIANTLGKKDWNFSVDPCSGEEGW-----AEIPE-ENAVTCNCSF  73

Query  323  PAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              G +C+V  I+L+ Q+L GVLPP L +L FL+ I + R+YLSGTIP EWAS+ L  IS+
Sbjct  74   SNGTVCYVFRIVLKEQNLTGVLPPKLAELTFLQDI-LPRNYLSGTIPSEWASLPLLNISL  132

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+GPIPKYL NI+TLV L ++ N F+G +P EL  L NL+ L LS N  TGELPK 
Sbjct  133  LANRLTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKT  192

Query  680  LNSLT  694
               LT
Sbjct  193  FAKLT  197



>ref|XP_002306015.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa]
 gb|EEE86526.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa]
Length=1028

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 119/185 (64%), Gaps = 5/185 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNW-FTPERKDMPAYNNTLTCNCS  319
            + S  L   E+  L+EI  ++GKKDWDF  +PC    NW    ERK    + N++TC+CS
Sbjct  33   SASAKLHSQEVRVLREIGKKLGKKDWDFNKDPCSGEGNWSILDERK---GFENSVTCDCS  89

Query  320  FPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            F     CH+ SI L+ Q+L G++PP   K  +LK +D+SR+  +G IPP+W +++LE  S
Sbjct  90   FNNNSSCHLVSIALKSQNLSGIIPPEFSKFRYLKQLDLSRNLFTGVIPPQWGTLRLEEFS  149

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
            V  NRLSGP PK L N+TTL  L++E N F+G +PPE+ +L NLQ L+ S N LTG LP 
Sbjct  150  VMGNRLSGPFPKVLTNMTTLRNLSIEGNHFSGPIPPEIGRLINLQKLVFSSNALTGNLPA  209

Query  677  ELNSL  691
            EL  L
Sbjct  210  ELGKL  214


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 63/122 (52%), Gaps = 5/122 (4%)
 Frame = +2

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            +F +    VQ + LQG  L+G +P ++  L   K+ D+  S L+G   P      +E + 
Sbjct  233  TFISKWTKVQKLHLQGTSLKGPIPSSIASLT--KLSDLRISDLTGRGSPFPPLSDMESMK  290

Query  497  VTVNR---LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGE  667
              + R   + G IP+Y+G +  L +L++  N   G +P    +LA +  L L+GN LTG 
Sbjct  291  TLILRNCLIYGEIPEYVGQMEKLKHLDVSFNNLRGEIPSTFIQLARIDFLYLTGNKLTGS  350

Query  668  LP  673
            +P
Sbjct  351  VP  352



>ref|XP_004140247.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Cucumis sativus]
 ref|XP_004156118.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Cucumis sativus]
Length=1028

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 124/190 (65%), Gaps = 3/190 (2%)
 Frame = +2

Query  128  ARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLT  307
            A F  A +  L  +E+ ALKEI  ++GK DWDF ++PC     W     +    + +++T
Sbjct  28   ATFGLAAAAKLHREEVKALKEIEKKLGKNDWDFNIDPCSGEGKWHVVNGR--KGFESSVT  85

Query  308  CNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKL  484
            C+CSF     CH+ +I L+ Q+L G++PP   KL FLK +D+SR+ L+G +P +WA+M+L
Sbjct  86   CDCSFNHNSTCHIVAIALKSQNLSGIVPPEFSKLRFLKQLDLSRNCLTGFVPSQWATMRL  145

Query  485  EYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTG  664
              +S   N+LSGP PK L NITTL  L++E N F+G +PPE+ KL NL+ L+LS N LTG
Sbjct  146  VELSFMGNKLSGPFPKVLTNITTLRNLSIEGNQFSGRIPPEIGKLVNLEKLVLSSNGLTG  205

Query  665  ELPKELNSLT  694
            ELPK L  L+
Sbjct  206  ELPKGLAKLS  215


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 66/124 (53%), Gaps = 7/124 (6%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP---PEWASMKLEYISVT  502
            + +++ ++L    L G LP  L KL  L  + IS +  SG IP     WA  ++E + + 
Sbjct  190  LVNLEKLVLSSNGLTGELPKGLAKLSNLTDMRISDNNFSGKIPEFISNWA--QIEKLHIQ  247

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVP-PELAKLANLQNLILSGNYLTGELPKE  679
               L GPIP  +  +T+L  L + +++  G  P P L+ + +++ LIL   ++ GE+PK 
Sbjct  248  GCSLEGPIPLSISTMTSLTDLRI-SDLKGGRSPFPPLSNIKSMKTLILRKCFIFGEIPKY  306

Query  680  LNSL  691
            +  +
Sbjct  307  IGDM  310



>gb|KJB12990.1| hypothetical protein B456_002G048900 [Gossypium raimondii]
Length=830

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-ICHV  343
            +E+  L++IA  +GKKDW+F V+PC     W TP       + N +TCNC+     +CHV
Sbjct  29   NEVQYLRDIAKTLGKKDWNFNVDPCSGEEGWATPNAA--KGFENAVTCNCTVSNDTVCHV  86

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
             SI+L+ Q+LQG LP  LVK PFL+ ID++R+ L+GTIPPEW SM+L  IS+  NRL+GP
Sbjct  87   VSIVLKAQNLQGSLPKDLVKFPFLQEIDLTRNILNGTIPPEWGSMQLVNISLLGNRLTGP  146

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            IPK LGNI+TL  +++E N  +G +PP+L  L  +Q +++S N  TGE+P+    LT
Sbjct  147  IPKELGNISTLSSISVEFNQLSGALPPQLGNLPAIQRMLISSNNFTGEIPETFAKLT  203


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 67/137 (49%), Gaps = 6/137 (4%)
 Frame = +2

Query  275  KDMPAYNNTLTCNC-SFPAGICHVQSIILQGQDLQGVLP---PTLVKLPFLKIIDISRSY  442
            KD    +N  T    SF     +++ + +Q   L G +P     L KL  L+I D++ + 
Sbjct  206  KDFRISDNQFTGKIPSFIQNWTNLEKLAMQASGLMGPIPLGIGDLEKLTDLRISDLNGT-  264

Query  443  LSGTIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLA  622
               T PP     KL+ + +    L G +P YLGN+T L  L+L  N  +G +P   + + 
Sbjct  265  -DATFPPLSTMKKLKILILRSCNLIGKLPDYLGNMTKLKTLDLSFNKLSGEIPDSFSNIR  323

Query  623  NLQNLILSGNYLTGELP  673
            ++  L L+ N LTG +P
Sbjct  324  DVDYLYLTRNLLTGLIP  340


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 64/122 (52%), Gaps = 7/122 (6%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVTVNR  511
            +Q +++   +  G +P T  KL  LK   IS +  +G IP     W +  LE +++  + 
Sbjct  181  IQRMLISSNNFTGEIPETFAKLTTLKDFRISDNQFTGKIPSFIQNWTN--LEKLAMQASG  238

Query  512  LSGPIPKYLGNITTLVYLNLEN-NMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            L GPIP  +G++  L  L + + N  + T PP L+ +  L+ LIL    L G+LP  L +
Sbjct  239  LMGPIPLGIGDLEKLTDLRISDLNGTDATFPP-LSTMKKLKILILRSCNLIGKLPDYLGN  297

Query  689  LT  694
            +T
Sbjct  298  MT  299



>ref|XP_007021935.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY13460.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1016

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 120/180 (67%), Gaps = 3/180 (2%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFP-AGI  334
            LP DE+  L++IA  +GK +W+F V+PC     W T     +  + N +TCNCSF  A +
Sbjct  26   LPDDEVQYLRDIAKTLGKTNWNFSVDPCSGEEGWATA--NPVKGFENAVTCNCSFSNASV  83

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
            CHV SI+L+ Q+L G LP  LVK P+L+ ID+SR++++GTIP EW SM+L  IS+  NRL
Sbjct  84   CHVVSIVLKAQNLPGTLPKELVKFPYLQEIDLSRNFINGTIPAEWGSMQLVNISLLGNRL  143

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            SG IPK LGNITTL  ++ E N  +G +P EL KL  +Q ++LS N  TG++P+    LT
Sbjct  144  SGSIPKELGNITTLTSISAEFNQLSGALPQELGKLPKIQRMLLSSNNFTGDIPETFAKLT  203


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 67/137 (49%), Gaps = 6/137 (4%)
 Frame = +2

Query  275  KDMPAYNNTLTCNC-SFPAGICHVQSIILQGQDLQGVLPPT---LVKLPFLKIIDISRSY  442
            KD    +N  T     F      ++ + +Q   L G +  +   L KL  L+I D++ S 
Sbjct  206  KDFRISDNHFTGKIPDFIQNWTKLEKLAIQASGLIGPISSSIGALEKLTDLRISDLNGS-  264

Query  443  LSGTIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLA  622
               T PP  +  K++ + +    L G +P+YLG++TTL  L+L  N  +G +P   + L 
Sbjct  265  -DATFPPLSSMQKMKILILRSCNLIGQLPEYLGDMTTLKTLDLSFNKLSGEIPTSFSGLV  323

Query  623  NLQNLILSGNYLTGELP  673
            ++  L  + N L+G +P
Sbjct  324  DVDYLYFTRNLLSGSVP  340



>ref|XP_006592942.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Glycine max]
Length=987

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 122/177 (69%), Gaps = 4/177 (2%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPA-GICHV  343
            +E+ ALK++   +GKK+WD  ++PC +   WFTP+   +    N +TCNCS P    CHV
Sbjct  32   EEVQALKDMGKILGKKEWDTDIDPCSSQHPWFTPK---VDTVENNVTCNCSIPGDNFCHV  88

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
             SI+L+ Q+L G LPP L++LP+L+ ID++R+YL+GTIP EW S  L  IS+  NRL+GP
Sbjct  89   VSILLKSQNLPGKLPPELIRLPYLEEIDLTRNYLNGTIPTEWGSSNLRKISLLGNRLTGP  148

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            IPK +GNITTL  L LE N F+  +PPEL  L+++Q L L+ N  TGELP+ L  LT
Sbjct  149  IPKEIGNITTLESLVLEFNQFSENLPPELGNLSSIQRLHLTSNNFTGELPETLAKLT  205


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 67/130 (52%), Gaps = 14/130 (11%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            +  +Q + L   +  G LP TL KL  L  + +S +  SG IP     W ++ L  +S+ 
Sbjct  180  LSSIQRLHLTSNNFTGELPETLAKLTTLTELRLSDNNFSGKIPDFIHRWTNLVL--LSIQ  237

Query  503  VNRLSGPIP---KYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTG---  664
             + LSGPIP    +L N+T L   +L  N  + T PP +  +  LQ L LS N L+G   
Sbjct  238  GSGLSGPIPSGISFLQNLTDLRISDL--NGSDSTFPP-INNMTKLQTLDLSFNKLSGQIL  294

Query  665  ELPKELNSLT  694
            E  K L+SLT
Sbjct  295  ETYKNLSSLT  304



>ref|XP_007025275.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
 gb|EOY27897.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
Length=995

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 121/181 (67%), Gaps = 7/181 (4%)
 Frame = +2

Query  149  SGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPA  328
            + +LP DE+N L +IA  +G  DW+F  + C    N      +D  +  N +TC C    
Sbjct  27   AANLPQDEVNILNQIARRMGNSDWNFDADVCNVTEN----VDRDTGSEKN-ITCTCQ--N  79

Query  329  GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVN  508
            G CHV  +I + Q L GVLP  LV LP+LK+ID++ +YL+G+IPPEWASM+LE+ISV  N
Sbjct  80   GTCHVTHVIFKHQSLPGVLPTELVNLPYLKVIDLAYNYLNGSIPPEWASMQLEFISVFGN  139

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            RLSG IP YLGNI++L YL+LE N F+G VPPE+ KL NL+ L LS N L+G LP +L  
Sbjct  140  RLSGNIPTYLGNISSLTYLDLEANQFSGEVPPEIGKLVNLRTLRLSSNRLSGNLPVQLAQ  199

Query  689  L  691
            L
Sbjct  200  L  200



>ref|XP_010522063.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Tarenaya hassleriana]
Length=1004

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 128/193 (66%), Gaps = 4/193 (2%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F++    A +G L   E+ ALKEI +++GKKDWDF  +PC    NW   + +    + ++
Sbjct  14   FHSSLRFAGAGKLHQQEVRALKEIGEKLGKKDWDFGRDPCSGAGNWNVLDDQ-TKGFESS  72

Query  302  LTCN--CSF-PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWA  472
            +TC+  C   P   CH+  I L+ Q+L G++PP + KL  LK++D+SR+YL G+IP EWA
Sbjct  73   VTCDDDCPLHPNSSCHLIRIALKSQNLTGIVPPEISKLRHLKVLDLSRNYLRGSIPKEWA  132

Query  473  SMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGN  652
            SM+LE IS   NRLSGP PK L +ITTL  L+LE N+F+G++PP++ KL +L+ L L+ N
Sbjct  133  SMRLEDISFMGNRLSGPFPKVLTSITTLRNLSLEGNLFSGSIPPQIGKLVHLEKLHLASN  192

Query  653  YLTGELPKELNSL  691
              TG+LP EL  L
Sbjct  193  SFTGKLPAELGKL  205


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 64/136 (47%), Gaps = 6/136 (4%)
 Frame = +2

Query  278  DMPAYNNTLTCNC-SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSG-  451
            DM   +N  T     F +    +Q + + G  L+G +P ++  L  L   D+  S L G 
Sbjct  210  DMRISDNNFTGRIPDFISNWTQIQKLQMLGCGLEGPIPSSISALTTL--TDLRISDLRGK  267

Query  452  --TIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLAN  625
              + PP      L+ + +    ++G IP+Y+G++  L  L+L  N F G VP     L  
Sbjct  268  ASSFPPLKNLESLKTMILRKCMINGRIPEYIGHMKKLKTLDLSFNHFTGEVPSSFDGLKK  327

Query  626  LQNLILSGNYLTGELP  673
               + L+GN LTG +P
Sbjct  328  ADFIYLTGNNLTGSVP  343



>gb|KJB12989.1| hypothetical protein B456_002G048900 [Gossypium raimondii]
Length=1014

 Score =   177 bits (450),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-ICHV  343
            +E+  L++IA  +GKKDW+F V+PC     W TP       + N +TCNC+     +CHV
Sbjct  29   NEVQYLRDIAKTLGKKDWNFNVDPCSGEEGWATPNAA--KGFENAVTCNCTVSNDTVCHV  86

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
             SI+L+ Q+LQG LP  LVK PFL+ ID++R+ L+GTIPPEW SM+L  IS+  NRL+GP
Sbjct  87   VSIVLKAQNLQGSLPKDLVKFPFLQEIDLTRNILNGTIPPEWGSMQLVNISLLGNRLTGP  146

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            IPK LGNI+TL  +++E N  +G +PP+L  L  +Q +++S N  TGE+P+    LT
Sbjct  147  IPKELGNISTLSSISVEFNQLSGALPPQLGNLPAIQRMLISSNNFTGEIPETFAKLT  203


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 67/137 (49%), Gaps = 6/137 (4%)
 Frame = +2

Query  275  KDMPAYNNTLTCNC-SFPAGICHVQSIILQGQDLQGVLP---PTLVKLPFLKIIDISRSY  442
            KD    +N  T    SF     +++ + +Q   L G +P     L KL  L+I D++ + 
Sbjct  206  KDFRISDNQFTGKIPSFIQNWTNLEKLAMQASGLMGPIPLGIGDLEKLTDLRISDLNGT-  264

Query  443  LSGTIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLA  622
               T PP     KL+ + +    L G +P YLGN+T L  L+L  N  +G +P   + + 
Sbjct  265  -DATFPPLSTMKKLKILILRSCNLIGKLPDYLGNMTKLKTLDLSFNKLSGEIPDSFSNIR  323

Query  623  NLQNLILSGNYLTGELP  673
            ++  L L+ N LTG +P
Sbjct  324  DVDYLYLTRNLLTGLIP  340


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 64/122 (52%), Gaps = 7/122 (6%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVTVNR  511
            +Q +++   +  G +P T  KL  LK   IS +  +G IP     W +  LE +++  + 
Sbjct  181  IQRMLISSNNFTGEIPETFAKLTTLKDFRISDNQFTGKIPSFIQNWTN--LEKLAMQASG  238

Query  512  LSGPIPKYLGNITTLVYLNLEN-NMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            L GPIP  +G++  L  L + + N  + T PP L+ +  L+ LIL    L G+LP  L +
Sbjct  239  LMGPIPLGIGDLEKLTDLRISDLNGTDATFPP-LSTMKKLKILILRSCNLIGKLPDYLGN  297

Query  689  LT  694
            +T
Sbjct  298  MT  299



>ref|XP_007021940.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY13465.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1020

 Score =   177 bits (450),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 123/182 (68%), Gaps = 6/182 (3%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNW--FTPERKDMPAYNNTLTCNCSFPAG  331
            L  DE+ ALK I + +GK++WDF ++PC   S+W    P +     Y N +TC+C+F   
Sbjct  34   LAKDEVEALKSINETLGKRNWDFGIDPCSRPSSWEEVVPPKS---YYANNVTCDCTFSGN  90

Query  332  -ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVN  508
             ICH+ SI L+GQ+L G LPP LV+ P+LK ID++R+YLSGTIPPEW SM+L  IS+  N
Sbjct  91   TICHIISIELKGQNLTGTLPPELVRFPYLKKIDLTRNYLSGTIPPEWGSMQLTDISLLGN  150

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            RL+G IPK L N++ L  L LE+N F G++PP L  L N++ ++L+ N  +GELP E   
Sbjct  151  RLTGSIPKELANLSNLTSLVLEHNNFAGSLPPALWNLHNIERMLLNSNNFSGELPAEFAR  210

Query  689  LT  694
            LT
Sbjct  211  LT  212


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPP--TLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
            ++ I ++G  L G +P    L  L ++ I D++ +    T P      KL+ + +  + L
Sbjct  239  LEEIYIEGSGLSGPIPDIGALENLKYMIISDLNGA--EATFPQLGNLPKLDRLMLRSSNL  296

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             G +P  L  +TTL  L+L  N  +G +P +L+ L+NL  L L+GN  TGE+P
Sbjct  297  IGELPDNLSTLTTLKILDLSFNRLSGEIPTKLSALSNLDQLFLNGNMFTGEVP  349



>ref|XP_009135396.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Brassica rapa]
Length=1049

 Score =   177 bits (450),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 124/187 (66%), Gaps = 7/187 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCE---NNSNWFTPERKDMPAYNNTLTCN  313
            A S  LP  E++AL+ +A  + K +W F VNPC+   ++  W  P       + + +TCN
Sbjct  21   AYSQTLPKQEVDALRAVATALKKSNWKFNVNPCDLTSSDGGWRNPNAG--KGFEDAVTCN  78

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS  + +CHV SI+L+ QDLQG LP  L  LPFL+ ID+SR+YL+G+IPPEW ++ L  I
Sbjct  79   CS--STVCHVTSIVLKAQDLQGSLPKELAGLPFLQEIDLSRNYLNGSIPPEWGTLPLVNI  136

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NR+SGPIPK +GNITTL  L LE N  +G +PPEL  L  ++ ++LS NYLTG++P
Sbjct  137  SLLGNRISGPIPKEIGNITTLTSLVLEFNQISGKLPPELGNLQKIERILLSSNYLTGDIP  196

Query  674  KELNSLT  694
               + LT
Sbjct  197  STFSKLT  203


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = +2

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGT---IPPEWASMKLEYISVTVNRLSG  520
            +++Q   L G +P T+   P  K+ D+  S L+G     PP      L+ + +  + L+G
Sbjct  232  LVIQASGLVGTIPSTIG--PLGKLTDLRISDLNGPGSPFPPLQNMTSLKTLILRNSNLTG  289

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +P YLG+ITTL  L+L  N  +G +P   + L+N+ N+  + N LTGE+P
Sbjct  290  ELPAYLGSITTLKLLDLSFNKLSGPIPETYSALSNVDNIYFTSNMLTGEVP  340



>ref|XP_009135397.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Brassica rapa]
Length=1020

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 124/187 (66%), Gaps = 7/187 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCE---NNSNWFTPERKDMPAYNNTLTCN  313
            A S  LP  E++AL+ +A  + K +W F VNPC+   ++  W  P       + + +TCN
Sbjct  21   AYSQTLPKQEVDALRAVATALKKSNWKFNVNPCDLTSSDGGWRNPNAG--KGFEDAVTCN  78

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS  + +CHV SI+L+ QDLQG LP  L  LPFL+ ID+SR+YL+G+IPPEW ++ L  I
Sbjct  79   CS--STVCHVTSIVLKAQDLQGSLPKELAGLPFLQEIDLSRNYLNGSIPPEWGTLPLVNI  136

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NR+SGPIPK +GNITTL  L LE N  +G +PPEL  L  ++ ++LS NYLTG++P
Sbjct  137  SLLGNRISGPIPKEIGNITTLTSLVLEFNQISGKLPPELGNLQKIERILLSSNYLTGDIP  196

Query  674  KELNSLT  694
               + LT
Sbjct  197  STFSKLT  203


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = +2

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGT---IPPEWASMKLEYISVTVNRLSG  520
            +++Q   L G +P T+   P  K+ D+  S L+G     PP      L+ + +  + L+G
Sbjct  232  LVIQASGLVGTIPSTIG--PLGKLTDLRISDLNGPGSPFPPLQNMTSLKTLILRNSNLTG  289

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +P YLG+ITTL  L+L  N  +G +P   + L+N+ N+  + N LTGE+P
Sbjct  290  ELPAYLGSITTLKLLDLSFNKLSGPIPETYSALSNVDNIYFTSNMLTGEVP  340



>ref|XP_010487294.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Camelina sativa]
Length=1021

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 124/187 (66%), Gaps = 7/187 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPA---YNNTLTCN  313
            A S  LP +E+ AL+ +A  + K +W+F V+PC+  S+    + +D+ A     + +TCN
Sbjct  22   ASSATLPPEEVEALRSVATALKKTNWNFSVDPCDETSS--DGKWRDLKAPKGEEDAVTCN  79

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS  +GICHV  IIL+GQDLQG LP  L  LPFL+ ID++++YL+G+IPPEW S  L  I
Sbjct  80   CS--SGICHVTHIILKGQDLQGSLPTDLSGLPFLQEIDLTKNYLNGSIPPEWGSSSLVNI  137

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NR++GPIPK L N+T L  L LE N  +G +PPEL  L NLQ L LS NYLTGE+P
Sbjct  138  SILGNRITGPIPKELANLTNLFSLVLEYNQLSGKLPPELGNLPNLQRLFLSSNYLTGEIP  197

Query  674  KELNSLT  694
                 LT
Sbjct  198  SSFAKLT  204



>ref|XP_009353452.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 [Pyrus x bretschneideri]
Length=1004

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 122/186 (66%), Gaps = 3/186 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            AQ   LP  E+ AL+EIA  +G K W F    C   +   T E++   +  NT  C+C F
Sbjct  28   AQLNMLPQQEVYALQEIATTMGAKYWTFNAGGCRIETVGLT-EKQPKGSEGNT-ECDCDF  85

Query  323  P-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              + +CH+ ++ L G  L G+LPP LVKLP+L+ ID S +YLSGTIP EWASMKL YISV
Sbjct  86   ENSTVCHIATLTLMGYSLPGLLPPQLVKLPYLRKIDFSYNYLSGTIPQEWASMKLNYISV  145

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
             VNRLSG IPK LGNITTL  LNLE N F+G++P +L  L NLQ L+LS N LTG LP+ 
Sbjct  146  LVNRLSGEIPKELGNITTLTDLNLEANQFSGSLPTKLGNLVNLQTLMLSSNQLTGYLPET  205

Query  680  LNSLTI  697
             + L I
Sbjct  206  FSGLKI  211


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 65/150 (43%), Gaps = 32/150 (21%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS-------MKLEY  490
            + ++Q+++L    L G LP T   L  L    IS +  SGT+P +W           L  
Sbjct  185  LVNLQTLMLSSNQLTGYLPETFSGLKILTDFRISDNNFSGTLP-DWVQNNKTLNWKNLTR  243

Query  491  ISVTVNRLSGPIPK------------------------YLGNITTLVYLNLENNMFNGTV  598
            + +  + L GPIP                          L N+T+LV L L N   +G +
Sbjct  244  LEMHSSGLEGPIPSNISLLNNLKELRISDINGPNQEFPLLRNMTSLVRLVLRNCNISGEI  303

Query  599  PPELAKLANLQNLILSGNYLTGELPKELNS  688
            P  +  + NL+ L +S N LTGELP  + +
Sbjct  304  PAYVWSMKNLEMLDVSFNKLTGELPSTIGA  333



>ref|XP_009351815.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X3 [Pyrus x bretschneideri]
Length=1002

 Score =   177 bits (448),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 120/186 (65%), Gaps = 3/186 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            AQ   LP  E++AL+EIA  +G K W F  + C   +   T ++      N    C+C+F
Sbjct  28   AQLPKLPQQEVDALQEIATTMGAKYWTFNADACRIETVGLTKKQPKGSQANTD--CDCNF  85

Query  323  P-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              + +CHV ++ L+G  L G+LPP LVKLP+L+ ID + +YLSGT P EWAS KL YISV
Sbjct  86   ENSTVCHVATLTLKGYSLPGLLPPQLVKLPYLRKIDFAYNYLSGTTPQEWASTKLTYISV  145

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
             VNRLSG IPK LG ITTL +LNLE N F+G VP EL  L NLQ L+LS N LTG LP+ 
Sbjct  146  LVNRLSGQIPKDLGKITTLTFLNLEGNQFSGIVPTELGNLVNLQTLMLSSNQLTGYLPES  205

Query  680  LNSLTI  697
             + L I
Sbjct  206  FSGLRI  211


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (46%), Gaps = 27/145 (19%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS--MKLEYISVTV  505
            + ++Q+++L    L G LP +   L  LK   I+ +  SGT+P +W     KL  + +  
Sbjct  185  LVNLQTLMLSSNQLTGYLPESFSGLRILKDFRINDNNFSGTLP-DWVQNWKKLTRLEMHS  243

Query  506  NRLSGPIPK------------------------YLGNITTLVYLNLENNMFNGTVPPELA  613
            + L GPIP                          L N+T+LV L L N   +G +P  + 
Sbjct  244  SGLEGPIPSNISLLNNLEVLRISDTNGPYQEFPLLRNMTSLVRLVLRNCNISGEIPAYIW  303

Query  614  KLANLQNLILSGNYLTGELPKELNS  688
             + NL+ L +S N L G+LP  + +
Sbjct  304  SMKNLEMLDVSFNKLAGQLPSTIGA  328



>ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES99711.1| LRR receptor-like kinase [Medicago truncatula]
Length=996

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 120/180 (67%), Gaps = 3/180 (2%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFP-AGI  334
            L  DE+  LK+IA  +GKKDWDF V+PC    NW +  +  +    N +TCNC+F  A +
Sbjct  28   LSKDEVEVLKDIAKTLGKKDWDFSVDPCSGERNWTSSVQ--VKGSENAVTCNCTFVNATV  85

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
            CHV +I+L+ Q+L G LP  LV+LP+L+ ID+SR+YL+GTIP EW SM L  IS+  NRL
Sbjct  86   CHVTNILLKQQNLPGTLPKELVRLPYLQEIDLSRNYLNGTIPDEWGSMNLVNISLIGNRL  145

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            +G IP  + NI+TL  L LE+N F+G +PPE   L  +Q +++S N  TGELP  L  LT
Sbjct  146  TGKIPIAITNISTLQSLVLESNQFSGNLPPEFGNLTQIQRVLISSNNFTGELPATLAKLT  205


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = +2

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP---PEWASMKLEYISVTVNRLSG  520
            +I++G  L G +P  + KL   K+ D+  S LSG+     P+   +KL+ + +    ++G
Sbjct  234  LIIEGSGLSGPIPSGISKLE--KLTDLRISDLSGSEFSPFPQLKDLKLKTLILRNCNING  291

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +P+YLG +TTL  L+L  N  +G +P     L  +  + L+GN LTG +P
Sbjct  292  TLPEYLGTMTTLKNLDLSFNKLSGPIPSNYDPLRKVDYIYLTGNLLTGPVP  342


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 62/147 (42%), Gaps = 29/147 (20%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            +  +Q +++   +  G LP TL KL  L+ I I  +  SG IP     W S  L  + + 
Sbjct  180  LTQIQRVLISSNNFTGELPATLAKLTTLQDIRIQDNQFSGKIPDFIQSWTS--LTKLIIE  237

Query  503  VNRLSGPIPKYLGNITTLVYLN------------------------LENNMFNGTVPPEL  610
             + LSGPIP  +  +  L  L                         L N   NGT+P  L
Sbjct  238  GSGLSGPIPSGISKLEKLTDLRISDLSGSEFSPFPQLKDLKLKTLILRNCNINGTLPEYL  297

Query  611  AKLANLQNLILSGNYLTGELPKELNSL  691
              +  L+NL LS N L+G +P   + L
Sbjct  298  GTMTTLKNLDLSFNKLSGPIPSNYDPL  324



>ref|XP_008380257.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Malus domestica]
Length=551

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 121/193 (63%), Gaps = 2/193 (1%)
 Frame = +2

Query  122  FNARFLE-AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            F A F + A +  L   E+N LKEI  ++GKKDWDF  +PC    NW  P      A+++
Sbjct  24   FFATFGQSATTAKLHTQEVNVLKEIGKKMGKKDWDFGKDPCTEEGNWTVPISTGKKAFDS  83

Query  299  TLTCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
             + C+C+F     CHV  I L+ Q+L G +PP   KL +L+ +D+SR+ L+GTIP +WA+
Sbjct  84   AVICDCTFNHNSSCHVIRIFLKSQNLSGTVPPEFSKLXYLEELDLSRNVLNGTIPSQWAT  143

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
            M+L  +S   NRLSGP PK L NITTL  L++E N F+G +P E+ KL  L+ LILS N 
Sbjct  144  MRLHTLSFMGNRLSGPFPKVLTNITTLRNLSIEGNHFSGPIPWEIGKLIKLEKLILSSNA  203

Query  656  LTGELPKELNSLT  694
             TG+LP  L  LT
Sbjct  204  FTGKLPSTLGKLT  216


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 5/121 (4%)
 Frame = +2

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
            F      V  ++++G  L+G +P T+  L  L   D+  + L G   P      LE +  
Sbjct  235  FIGNWTRVSKLLIEGSSLEGPIPSTISALTSL--TDLRITDLKGNRSPFPPLSNLESLKT  292

Query  500  TVNR---LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGEL  670
             + R   +   IP Y+G++  L  L+L  N   G +P    +L  +  + L+GN LTG +
Sbjct  293  LILRNCLIHXEIPDYIGDMENLKNLDLSFNELTGEIPASFVRLEKIDIMYLTGNQLTGTI  352

Query  671  P  673
            P
Sbjct  353  P  353



>emb|CDX82466.1| BnaA03g33550D [Brassica napus]
Length=1020

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 123/187 (66%), Gaps = 7/187 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCE---NNSNWFTPERKDMPAYNNTLTCN  313
            A S  LP  E+ AL+ +A  + K +W F VNPC+   ++  W  P       + + +TCN
Sbjct  21   AYSQTLPKQEVGALRAVATALKKSNWKFNVNPCDLTSSDGGWRNPNAG--KGFEDAVTCN  78

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS  + +CHV SI+L+ QDLQG LP  L  LPFL+ ID+SR+YL+G+IPPEW ++ L  I
Sbjct  79   CS--STVCHVTSIVLKAQDLQGSLPKELAGLPFLQEIDLSRNYLNGSIPPEWGTLPLVNI  136

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NR+SGPIPK +GNITTL  L LE N  +G +PPEL  L  ++ ++LS NYLTG++P
Sbjct  137  SLLGNRISGPIPKEIGNITTLTSLVLEFNQISGKLPPELGNLQKIERILLSSNYLTGDIP  196

Query  674  KELNSLT  694
               + LT
Sbjct  197  STFSKLT  203


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = +2

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGT---IPPEWASMKLEYISVTVNRLSG  520
            +++Q   L G +P T+   P  K+ D+  S L+G     PP      L+ + +  + L+G
Sbjct  232  LVIQASGLVGTIPSTIG--PLGKLTDLRISDLNGPGSPFPPLQNMTSLKTLILRNSNLTG  289

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +P YLG+ITTL  L+L  N  +G +P   + L+N+ N+  + N LTGE+P
Sbjct  290  ELPAYLGSITTLKLLDLSFNKLSGPIPETYSALSNVDNIYFTSNMLTGEVP  340



>ref|XP_008449503.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Cucumis melo]
Length=1024

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 121/177 (68%), Gaps = 3/177 (2%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPA-GICHV  343
            +E+ ALKEI  ++GKKDW+F ++PC     W     +    + +++TC+CSF     CH+
Sbjct  37   EEVKALKEIEKKLGKKDWNFNIDPCSGEGKWLVVNGR--KGFESSVTCDCSFNRNSTCHI  94

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
             +I L+ Q+L G++PP   KL FLK +D+SR+ L+G++P +WA+M+L  +S   N+LSGP
Sbjct  95   VAIALKSQNLSGIVPPEFSKLRFLKQLDLSRNCLTGSVPSQWATMRLVELSFMGNKLSGP  154

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
             PK L NITTL  L++E N F+G +PPE+ KL NL+ L+LS N LTGELPK L  L+
Sbjct  155  FPKVLTNITTLRNLSIEGNQFSGRIPPEIGKLVNLEKLVLSSNGLTGELPKGLAKLS  211


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 66/124 (53%), Gaps = 7/124 (6%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP---PEWASMKLEYISVT  502
            + +++ ++L    L G LP  L KL  L  + IS +  SG IP     WA  ++E + + 
Sbjct  186  LVNLEKLVLSSNGLTGELPKGLAKLSNLTDMRISDNNFSGKIPEFISNWA--QIEKLHIQ  243

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVP-PELAKLANLQNLILSGNYLTGELPKE  679
               L GPIP  +  +T+L  L + +++  G  P P L+ + +++ LIL   ++ GE+PK 
Sbjct  244  GCSLEGPIPLSISTMTSLTDLRI-SDLKGGRSPFPPLSNIKSMKTLILRKCFIFGEIPKY  302

Query  680  LNSL  691
            +  +
Sbjct  303  IGDM  306



>ref|XP_010093467.1| hypothetical protein L484_017528 [Morus notabilis]
 gb|EXB54091.1| hypothetical protein L484_017528 [Morus notabilis]
Length=772

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 121/183 (66%), Gaps = 3/183 (2%)
 Frame = +2

Query  149  SGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF-P  325
            S  LP  E+ AL+EIA  +GK +W+F V+PC  +  W T  +  +  + N ++CN SF  
Sbjct  28   SAQLPKSEVEALREIAKTLGKTNWNFSVDPCSGDYGWVT--KNPVQGFENAVSCNRSFCS  85

Query  326  AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTV  505
            A  CHV SI+L+ Q L G LP  L+KLP+L+  D+SR+YL+GTIPPEW S +L  IS+  
Sbjct  86   ATACHVTSIVLKAQSLPGTLPKDLLKLPYLQEFDLSRNYLNGTIPPEWGSSQLVNISLLG  145

Query  506  NRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELN  685
            NRL+G IPK L NITTL  L LE N  +G +PPEL  L+N++  +++ N  TGELP+ L 
Sbjct  146  NRLTGSIPKELANITTLKSLVLEINRLSGNLPPELGNLSNIERFLVTSNNFTGELPETLG  205

Query  686  SLT  694
             LT
Sbjct  206  KLT  208


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 5/120 (4%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSG---TIPPEWASMKLEYISVT  502
            + +++  ++   +  G LP TL KL  LK  D+  S LSG   T PP     K++ + + 
Sbjct  183  LSNIERFLVTSNNFTGELPETLGKLTTLK--DLRISDLSGSEATFPPLNNMTKMKTLILR  240

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
               L+G IP YLG +++L  L+L  N  +G VP  LA L+N+  + L+GN L+GE+ + L
Sbjct  241  NCNLNGTIPDYLGEMSSLKTLDLSFNKLSGNVPNSLASLSNVDYIFLTGNLLSGEVAEWL  300



>gb|KDO58605.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=869

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = +2

Query  179  ALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQSIIL  358
            ALK+I  ++GKKDW+F V+PC    NW      D   + + +TC+CS  +  CHV +I L
Sbjct  5    ALKQIGRKLGKKDWNFGVDPCSQKGNW-ELSSDDKKGFESNVTCDCS--SATCHVVTIAL  61

Query  359  QGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPKYL  538
            + Q+L G LP  L KL +LK +D+SR+ L+G+  P+WAS++L  +SV  NRLSGP PK L
Sbjct  62   KAQNLTGTLPTELSKLRYLKQLDLSRNCLTGSFSPQWASLQLVELSVMGNRLSGPFPKVL  121

Query  539  GNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
             NITTL  L++E N+F G++PP++ KL NLQ LILS N  TGELP EL  LT
Sbjct  122  TNITTLKNLSIEGNLFTGSIPPDIRKLINLQKLILSSNSFTGELPAELTKLT  173


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            +Q + +QG  L+G +P ++  L  L  + IS    S +  P+   M L+ + +T   + G
Sbjct  199  IQKLHIQGSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKMNLKTLILTKCLIHG  258

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             IP Y+G++T L  ++L  N   G +P    KLA    + L+GN LTG +PK
Sbjct  259  EIPDYIGDMTKLKNIDLSFNNLTGGIPTTFEKLAKTNFMYLTGNKLTGPVPK  310


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++Q +IL      G LP  L KL  L  + IS +  SG IP    +W   K++ + + 
Sbjct  148  LINLQKLILSSNSFTGELPAELTKLTNLNDLRISDNNFSGKIPEFIGKWK--KIQKLHIQ  205

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             + L GPIP  +  +T+L  L + +   + +  P+L K+ NL+ LIL+   + GE+P  +
Sbjct  206  GSSLEGPIPASISALTSLTDLRISDLKGSESAFPKLDKM-NLKTLILTKCLIHGEIPDYI  264

Query  683  NSLT  694
              +T
Sbjct  265  GDMT  268



>gb|KEH38568.1| LRR receptor-like kinase, partial [Medicago truncatula]
Length=767

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 121/185 (65%), Gaps = 3/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    L  +E   +K++A  +GKKDWDF  +PC   +NW +  +  +  + N +TCNC+F
Sbjct  23   ASGATLLQEEAQVMKDVAKTLGKKDWDFNKDPCSGENNWKSSVK--VKGFENAVTCNCTF  80

Query  323  P-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              A +CH+ SI+L+ Q+L G LP  LV+LP+L+ ID+S +YL+GTIPP+W SM L  IS+
Sbjct  81   ANATVCHIVSIVLRSQNLSGTLPKELVRLPYLQQIDLSNNYLNGTIPPQWGSMNLVNISL  140

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+G IPK LGNI+T+  L L+ N  +G +PPEL  L  L+ L+L+ N+ TG LP  
Sbjct  141  IGNRLTGSIPKELGNISTMQKLILKFNQLSGELPPELGNLHQLERLLLTSNFFTGNLPAT  200

Query  680  LNSLT  694
               LT
Sbjct  201  FAKLT  205


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 74/158 (47%), Gaps = 22/158 (14%)
 Frame = +2

Query  251  SNWFTPERKDMPAYNNTLT-------CNCSFPAGICH-------VQSIILQGQDLQGVLP  388
            SN+FT    ++PA    LT       C+  F   I +       ++ +++QG  L G +P
Sbjct  190  SNFFT---GNLPATFAKLTKLKHIRLCDNQFSGTIPYFIQSWTILERMVMQGSGLSGPIP  246

Query  389  PTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR---LSGPIPKYLGNITTLV  559
              +  L  L   D+  S L G+  P    + L  I   V R   L G +P YLG+ITTL 
Sbjct  247  SGISYLKNLN--DLRISDLKGSDSPFPQLIGLTNIETLVLRSCNLIGEVPDYLGHITTLK  304

Query  560  YLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             L+L  N   G +P  L  L N+  L L+GN  TG LP
Sbjct  305  SLDLSFNKLTGPIPNTLGGLKNINMLYLTGNLFTGPLP  342


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRL  514
             ++ ++L      G LP T  KL  LK I +  +  SGTIP    S   LE + +  + L
Sbjct  182  QLERLLLTSNFFTGNLPATFAKLTKLKHIRLCDNQFSGTIPYFIQSWTILERMVMQGSGL  241

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            SGPIP  +  +  L  L + +   + +  P+L  L N++ L+L    L GE+P  L  +T
Sbjct  242  SGPIPSGISYLKNLNDLRISDLKGSDSPFPQLIGLTNIETLVLRSCNLIGEVPDYLGHIT  301



>ref|XP_010657080.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 emb|CBI22045.3| unnamed protein product [Vitis vinifera]
Length=1011

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 119/183 (65%), Gaps = 3/183 (2%)
 Frame = +2

Query  149  SGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPA  328
            S  LP DEL ALK I   +GK+DWDF  +PC    NW +   K      +++TC+C+F  
Sbjct  22   SAKLPADELKALKVIGTRLGKRDWDFGKDPCSGEGNWSSVNEK--KGVESSVTCDCTFHH  79

Query  329  GI-CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTV  505
               CHV +I L+ Q+L G LPP L KL  LK +D+SR+  SG+IP +WA+M+L  +S+  
Sbjct  80   NASCHVVTIALKAQNLSGSLPPELSKLYHLKHLDLSRNLFSGSIPSQWATMRLVELSLMG  139

Query  506  NRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELN  685
            NRLSGP PK L NITTL  L++E N+F+G +PPE+ KL  ++ ++LS N  TGELP  L 
Sbjct  140  NRLSGPFPKVLTNITTLRNLSIEGNLFSGPIPPEIGKLIRIEKMVLSSNAFTGELPVALA  199

Query  686  SLT  694
             LT
Sbjct  200  KLT  202


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 77/170 (45%), Gaps = 15/170 (9%)
 Frame = +2

Query  200  EVGKKDWDFRVNPCENNSNWFTPER----------KDMPAYNNTLTCNC-SFPAGICHVQ  346
            E+GK     R+     +SN FT E            DM   +N  +     F     HVQ
Sbjct  173  EIGKL---IRIEKMVLSSNAFTGELPVALAKLTNLTDMRINDNHFSGRIPEFIGNWTHVQ  229

Query  347  SIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSG-TIPPEWASMKLEYISVTVNRLSGP  523
             + +QG  L+G +P ++  L  L  + IS     G T PP      L+ + +    + G 
Sbjct  230  KLHIQGSSLEGPIPSSISALTSLSDLRISDLKGRGSTFPPLSTIESLKTLVLRKCLIHGE  289

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            IP+Y+G++  L +L+L  N   G +P    +LA    + L+GN LTG +P
Sbjct  290  IPEYIGDMKKLKHLDLSFNELAGEIPTSFQELAKTDFMYLTGNMLTGHIP  339



>ref|XP_010060750.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Eucalyptus grandis]
Length=839

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 119/192 (62%), Gaps = 7/192 (4%)
 Frame = +2

Query  134  FLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCN  313
            F  A +  LP DE+ ALKEIA+ +GK +WDF ++PC     W   +++ +    N + CN
Sbjct  23   FAAAATTCLPDDEVAALKEIAETLGKSNWDFDLDPCSRTGVW--SDQRPLDDTTNDVACN  80

Query  314  CSFPAGI-----CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
            CS    I     CHV SI+L  Q L G LP  L +LPFL+  D++R+YL+GTIP EW S 
Sbjct  81   CSSTCDIDNTTACHVTSIVLNEQSLSGTLPHRLFRLPFLENFDVTRNYLNGTIPKEWGST  140

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
            KL  ISV  NRL+GPIPK LGNI+TL  L +E N  +G +PPEL  L+ L+ L LS N  
Sbjct  141  KLRNISVLGNRLTGPIPKELGNISTLEVLVVEINQLSGPLPPELGNLSRLRRLCLSSNNF  200

Query  659  TGELPKELNSLT  694
            TGELP     LT
Sbjct  201  TGELPPRFAELT  212


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 72/153 (47%), Gaps = 11/153 (7%)
 Frame = +2

Query  248  NSNWFT----PERKDMPAYNNTLTCNCSFPAGICH-------VQSIILQGQDLQGVLPPT  394
            +SN FT    P   ++ A  +    + +F   I H       +  + +QG  LQG +P  
Sbjct  196  SSNNFTGELPPRFAELTALQDLRLSDNNFTGQIPHFIQNWTNLSRLAIQGSGLQGPIPSE  255

Query  395  LVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLE  574
            +  L  L  + IS      +  P  +S  ++ + +    L+G +P YL  +T L  L+L 
Sbjct  256  ITLLKNLIYLSISDLEGPESPVPHLSSTNIQRLILRSCNLTGELPVYLAGMTQLKILDLS  315

Query  575  NNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             N  +G +P + + L ++  + L+GN LTG +P
Sbjct  316  FNKLSGEIPDDFSNLVDIDFIYLTGNQLTGAVP  348



>gb|KEH38576.1| LRR receptor-like kinase [Medicago truncatula]
Length=1017

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 118/185 (64%), Gaps = 4/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    L  +E+  +K+IA  +GKKDWDF ++PC   SNW +     M  + N +TCNC F
Sbjct  28   ASGATLLEEEVQVMKDIAKTLGKKDWDFSIDPCSGQSNWTSSP---MKGFANAVTCNCYF  84

Query  323  P-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              + +CH+ SI+L+ Q+L G LP  L +LP+L+ ID++R+YL+GTIPP+W SM L  IS+
Sbjct  85   ANSTVCHIVSIVLKSQNLSGTLPRELARLPYLQEIDLTRNYLNGTIPPQWGSMHLVNISL  144

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+GPIPK LG I TL  L LE N  +G +PPEL  L  L+ L+L+ N  TG LP  
Sbjct  145  LGNRLTGPIPKELGKIITLKSLVLEFNQLSGQLPPELGNLHRLERLLLTSNNFTGNLPAT  204

Query  680  LNSLT  694
               L 
Sbjct  205  FAKLA  209


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRLS  517
            ++ +++QG  L G +P  +  L  L  + IS    S +  P+  ++K LE + +    L 
Sbjct  235  LERLVMQGSGLSGPIPSGISYLKNLTDLRISDLKGSDSHFPQLNNLKNLETLVLRSCNLI  294

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            G +P+YLGNIT L  L+L  N  +G +P  L  L N+  L L+ N  TG LP
Sbjct  295  GTVPEYLGNITNLKSLDLSFNKLSGQIPNTLGGLKNINILYLTRNLFTGPLP  346


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 70/145 (48%), Gaps = 29/145 (20%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVTVN  508
             ++ ++L   +  G LP T  KL  LK I +  +  SGT+P     W S  LE + +  +
Sbjct  186  RLERLLLTSNNFTGNLPATFAKLANLKQIRLGDNQFSGTLPDFIQSWES--LERLVMQGS  243

Query  509  RLSGPIP---KYLGNITTLVYLNLE---------NNMFN------------GTVPPELAK  616
             LSGPIP    YL N+T L   +L+         NN+ N            GTVP  L  
Sbjct  244  GLSGPIPSGISYLKNLTDLRISDLKGSDSHFPQLNNLKNLETLVLRSCNLIGTVPEYLGN  303

Query  617  LANLQNLILSGNYLTGELPKELNSL  691
            + NL++L LS N L+G++P  L  L
Sbjct  304  ITNLKSLDLSFNKLSGQIPNTLGGL  328



>ref|XP_008371728.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103435116 
[Malus domestica]
Length=2029

 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 125/193 (65%), Gaps = 4/193 (2%)
 Frame = +2

Query  122   FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
             F  R L AQ   LP  E++AL+EIA  +G   W F  + C   +   T ++      N  
Sbjct  1036  FTLRGL-AQLPKLPQQEVDALQEIATTMGANYWTFNTDACRIETVGLTKKQPKGSQANTD  1094

Query  302   LTCNCSFP-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
               C+C+F  + +CHV ++ L+G  L G+LPP LVKLP+L+ ID + +YL+GTIP EWAS 
Sbjct  1095  --CDCNFENSTVCHVATLTLKGFSLPGLLPPQLVKLPYLRKIDFAYNYLNGTIPREWAST  1152

Query  479   KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
             KL YISV VNRLSG IPK+LG+ITTL +LNLE N F+G VP EL  L NLQ L+LS N L
Sbjct  1153  KLTYISVLVNRLSGQIPKHLGHITTLTFLNLEGNQFSGIVPTELGNLVNLQTLMLSSNQL  1212

Query  659   TGELPKELNSLTI  697
             TG LP+  + L I
Sbjct  1213  TGYLPETFSGLRI  1225


 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 119/186 (64%), Gaps = 5/186 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRV--NPCENNSNWFTPERKDMPAYNNTLTCNC  316
            AQ   LP +E++AL+++A  +G K W F    + C  +    T E +   +  NT  C C
Sbjct  29   AQPPQLPQEEVDALQQVATTMGAKYWSFNAGADACRIDMVGVT-ENQPRGSQKNT-DCEC  86

Query  317  SFPAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            +F    +CHV  ++++G  L G+LPP LVKLP+L+ ID + +YL GTIP EWASMKL YI
Sbjct  87   NFENNTVCHVVKLMIKGYSLPGLLPPQLVKLPYLREIDFAYNYLKGTIPREWASMKLTYI  146

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            SV  NRLSG +PK LGN+TTL +LNLE N F+G +P EL  L  LQ L +S N LTG LP
Sbjct  147  SVLANRLSGEVPKELGNMTTLTFLNLEANQFSGILPTELGHLVGLQALFISSNQLTGNLP  206

Query  674  KELNSL  691
            +  + L
Sbjct  207  ETFSEL  212



>ref|XP_010272741.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nelumbo nucifera]
Length=1008

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGI-  334
            LP DE+ AL+EIA  + K DW+F V+PC N S+W T   K    +NN +TC+CS+  G  
Sbjct  33   LPEDEVGALREIAKTLHKVDWNFGVDPCINESSWLTQNPKG--KFNNNVTCDCSYNNGTT  90

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNR  511
            CHV S+IL+ Q+L G LPP L  LP+L+ ID  R++L+GTIP EWASMK +++IS+  NR
Sbjct  91   CHVISMILKNQNLSGRLPPELANLPYLQHIDFRRNFLNGTIPVEWASMKNIQFISLVGNR  150

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            +SG IPK +G +  L YL+LE N  +G +P EL  L  L+NL LS N  +G LP +L +L
Sbjct  151  ISGEIPKEIGKMANLTYLSLEANQLSGAIPSELGDLIKLKNLSLSSNNFSGTLPSKLANL  210


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 1/98 (1%)
 Frame = +2

Query  356  LQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVNRLSGPIPK  532
            L+   L G +P  L  L  LK + +S +  SGT+P + A++  L+  S++ N LSGPIP 
Sbjct  170  LEANQLSGAIPSELGDLIKLKNLSLSSNNFSGTLPSKLANLINLKEFSISDNNLSGPIPD  229

Query  533  YLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILS  646
            ++ N T L  + ++ +   G +P  ++ L NL +L +S
Sbjct  230  FIQNWTHLDKMVMQASGLEGPIPSVISVLQNLTDLRIS  267



>gb|KEH38566.1| LRR receptor-like kinase, partial [Medicago truncatula]
Length=880

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 121/185 (65%), Gaps = 3/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    L  +E   +K++A  +GKKDWDF  +PC   +NW +  +  +  + N +TCNC+F
Sbjct  23   ASGATLLQEEAQVMKDVAKTLGKKDWDFNKDPCSGENNWKSSVK--VKGFENAVTCNCTF  80

Query  323  P-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              A +CH+ SI+L+ Q+L G LP  LV+LP+L+ ID+S +YL+GTIPP+W SM L  IS+
Sbjct  81   ANATVCHIVSIVLRSQNLSGTLPKELVRLPYLQQIDLSNNYLNGTIPPQWGSMNLVNISL  140

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+G IPK LGNI+T+  L L+ N  +G +PPEL  L  L+ L+L+ N+ TG LP  
Sbjct  141  IGNRLTGSIPKELGNISTMQKLILKFNQLSGELPPELGNLHQLERLLLTSNFFTGNLPAT  200

Query  680  LNSLT  694
               LT
Sbjct  201  FAKLT  205


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 74/158 (47%), Gaps = 22/158 (14%)
 Frame = +2

Query  251  SNWFTPERKDMPAYNNTLT-------CNCSFPAGICH-------VQSIILQGQDLQGVLP  388
            SN+FT    ++PA    LT       C+  F   I +       ++ +++QG  L G +P
Sbjct  190  SNFFT---GNLPATFAKLTKLKHIRLCDNQFSGTIPYFIQSWTILERMVMQGSGLSGPIP  246

Query  389  PTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR---LSGPIPKYLGNITTLV  559
              +  L  L   D+  S L G+  P    + L  I   V R   L G +P YLG+ITTL 
Sbjct  247  SGISYLKNLN--DLRISDLKGSDSPFPQLIGLTNIETLVLRSCNLIGEVPDYLGHITTLK  304

Query  560  YLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             L+L  N   G +P  L  L N+  L L+GN  TG LP
Sbjct  305  SLDLSFNKLTGPIPNTLGGLKNINMLYLTGNLFTGPLP  342


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRL  514
             ++ ++L      G LP T  KL  LK I +  +  SGTIP    S   LE + +  + L
Sbjct  182  QLERLLLTSNFFTGNLPATFAKLTKLKHIRLCDNQFSGTIPYFIQSWTILERMVMQGSGL  241

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            SGPIP  +  +  L  L + +   + +  P+L  L N++ L+L    L GE+P  L  +T
Sbjct  242  SGPIPSGISYLKNLNDLRISDLKGSDSPFPQLIGLTNIETLVLRSCNLIGEVPDYLGHIT  301



>ref|XP_010272742.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=954

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGI-  334
            LP DE+ AL+EIA  + K DW+F V+PC N S+W T   K    +NN +TC+CS+  G  
Sbjct  33   LPEDEVGALREIAKTLHKVDWNFGVDPCINESSWLTQNPKG--KFNNNVTCDCSYNNGTT  90

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNR  511
            CHV S+IL+ Q+L G LPP L  LP+L+ ID  R++L+GTIP EWASMK +++IS+  NR
Sbjct  91   CHVISMILKNQNLSGRLPPELANLPYLQHIDFRRNFLNGTIPVEWASMKNIQFISLVGNR  150

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            +SG IPK +G +  L YL+LE N  +G +P EL  L  L+NL LS N  +G LP +L +L
Sbjct  151  ISGEIPKEIGKMANLTYLSLEANQLSGAIPSELGDLIKLKNLSLSSNNFSGTLPSKLANL  210


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 1/98 (1%)
 Frame = +2

Query  356  LQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVNRLSGPIPK  532
            L+   L G +P  L  L  LK + +S +  SGT+P + A++  L+  S++ N LSGPIP 
Sbjct  170  LEANQLSGAIPSELGDLIKLKNLSLSSNNFSGTLPSKLANLINLKEFSISDNNLSGPIPD  229

Query  533  YLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILS  646
            ++ N T L  + ++ +   G +P  ++ L NL +L +S
Sbjct  230  FIQNWTHLDKMVMQASGLEGPIPSVISVLQNLTDLRIS  267



>ref|XP_010465400.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Camelina sativa]
Length=1022

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 120/185 (65%), Gaps = 3/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMP-AYNNTLTCNCS  319
            A S  LP +E+ ALK +A  + K +W+F V+PC+  S+     + + P    + +TCNCS
Sbjct  23   ASSATLPKEEVEALKSVATALKKTNWNFSVDPCDETSSEGGWRKLNQPKGAEDAVTCNCS  82

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              +G CHV +I L+GQDLQG LP  L  LPFL+ ID++R+YL+G+IPPEW S  L  I +
Sbjct  83   --SGTCHVTNITLKGQDLQGSLPTDLSGLPFLQQIDLTRNYLNGSIPPEWGSSSLISIEL  140

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NR++GPIPK L N+T L  L LE N  +G +PPEL  L NLQ L LS NYLTGE+P  
Sbjct  141  LGNRITGPIPKELANLTNLYSLVLEYNQLSGKLPPELGNLPNLQRLFLSSNYLTGEIPST  200

Query  680  LNSLT  694
               LT
Sbjct  201  FAKLT  205



>gb|KCW67581.1| hypothetical protein EUGRSUZ_F01338, partial [Eucalyptus grandis]
Length=205

 Score =   164 bits (414),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 112/178 (63%), Gaps = 7/178 (4%)
 Frame = +2

Query  176  NALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-----ICH  340
            +AL+EIAD +GK++WDF  +PC   S W   ++K      N + C+C+   G     +CH
Sbjct  1    DALREIADALGKRNWDFETDPCNKTSTW--SDKKLPDDTTNDVNCSCTSIGGADNTTVCH  58

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            V SI+L  Q L G LP  L +LPFL+  D++R++L+GTIP EW S KL  ISV  NRL+G
Sbjct  59   VTSIVLNEQSLSGTLPHRLSRLPFLENFDVTRNFLNGTIPTEWGSTKLVNISVLGNRLTG  118

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            PIPK LGNI+TL  L +E N  +G +PPEL  L+ L  L LS N  TGELP     LT
Sbjct  119  PIPKELGNISTLFKLVVEINQLSGHLPPELGNLSQLHILHLSSNNFTGELPPRFAELT  176



>ref|XP_007149528.1| hypothetical protein PHAVU_005G077700g [Phaseolus vulgaris]
 gb|ESW21522.1| hypothetical protein PHAVU_005G077700g [Phaseolus vulgaris]
Length=327

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 115/178 (65%), Gaps = 9/178 (5%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNW-FTPERKDMPAYNNTLTCNCSFPAG-ICH  340
            +E+ ALK+I   +G K+WD  ++PC N   W  TPE        N ++CNCS P    CH
Sbjct  32   EEVKALKDIGKTLGNKNWDTDIDPCSNQPPWSVTPEI-------NNVSCNCSIPTDTFCH  84

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            V SIIL+ Q+L G LP  LV+LP+L+ I +SR+YL+GTIPP+W  MKL  IS+  NR++G
Sbjct  85   VVSIILKSQNLSGTLPSELVRLPYLQKIHLSRNYLNGTIPPQWGFMKLVNISILGNRVTG  144

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            PIPK LGNITTL  L LE N  +G +P EL  L  L+ L+L+ NY TG LP     LT
Sbjct  145  PIPKELGNITTLKSLALEFNQLSGELPLELGNLPQLERLLLTSNYFTGNLPATFARLT  202



>ref|XP_010060749.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Eucalyptus grandis]
Length=1021

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 119/192 (62%), Gaps = 7/192 (4%)
 Frame = +2

Query  134  FLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCN  313
            F  A +  LP DE+ ALKEIA+ +GK +WDF ++PC     W   +++ +    N + CN
Sbjct  23   FAAAATTCLPDDEVAALKEIAETLGKSNWDFDLDPCSRTGVW--SDQRPLDDTTNDVACN  80

Query  314  CSFPAGI-----CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
            CS    I     CHV SI+L  Q L G LP  L +LPFL+  D++R+YL+GTIP EW S 
Sbjct  81   CSSTCDIDNTTACHVTSIVLNEQSLSGTLPHRLFRLPFLENFDVTRNYLNGTIPKEWGST  140

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
            KL  ISV  NRL+GPIPK LGNI+TL  L +E N  +G +PPEL  L+ L+ L LS N  
Sbjct  141  KLRNISVLGNRLTGPIPKELGNISTLEVLVVEINQLSGPLPPELGNLSRLRRLCLSSNNF  200

Query  659  TGELPKELNSLT  694
            TGELP     LT
Sbjct  201  TGELPPRFAELT  212


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 72/153 (47%), Gaps = 11/153 (7%)
 Frame = +2

Query  248  NSNWFT----PERKDMPAYNNTLTCNCSFPAGICH-------VQSIILQGQDLQGVLPPT  394
            +SN FT    P   ++ A  +    + +F   I H       +  + +QG  LQG +P  
Sbjct  196  SSNNFTGELPPRFAELTALQDLRLSDNNFTGQIPHFIQNWTNLSRLAIQGSGLQGPIPSE  255

Query  395  LVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLE  574
            +  L  L  + IS      +  P  +S  ++ + +    L+G +P YL  +T L  L+L 
Sbjct  256  ITLLKNLIYLSISDLEGPESPVPHLSSTNIQRLILRSCNLTGELPVYLAGMTQLKILDLS  315

Query  575  NNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             N  +G +P + + L ++  + L+GN LTG +P
Sbjct  316  FNKLSGEIPDDFSNLVDIDFIYLTGNQLTGAVP  348



>ref|XP_007149537.1| hypothetical protein PHAVU_005G078500g [Phaseolus vulgaris]
 gb|ESW21531.1| hypothetical protein PHAVU_005G078500g [Phaseolus vulgaris]
Length=998

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 120/185 (65%), Gaps = 3/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP DE+ AL++IA  +GKKDWDF V+PC    NW +  +  +    N + CNC +
Sbjct  24   ASGATLPQDEVKALEDIAKILGKKDWDFSVDPCSKERNWTSAVQ--VKGSENEVRCNCDY  81

Query  323  PAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              G +CHV +IIL+ Q+L G LP  L +LP+L+ ID++R+YL+GTIP EW S KL  IS+
Sbjct  82   NNGTVCHVTNIILKAQNLPGTLPQDLFRLPYLQEIDLTRNYLNGTIPKEWGSTKLLNISL  141

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+G IPK + NI+TL    +E N  +G +PPEL  L  +Q L+LS N  TGELP+ 
Sbjct  142  LGNRLTGSIPKEIANISTLQSFVVEANQLSGDLPPELGDLPQIQRLLLSSNNFTGELPET  201

Query  680  LNSLT  694
            L  +T
Sbjct  202  LAKIT  206


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 67/143 (47%), Gaps = 25/143 (17%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVNRL  514
             +Q ++L   +  G LP TL K+  L+ I I  +  SG IP    S+  L+ + +  + L
Sbjct  183  QIQRLLLSSNNFTGELPETLAKITTLQDIRIGDNQFSGKIPDFIQSLTSLQKLVIQGSGL  242

Query  515  SGPIPK---YLGNIT---------------------TLVYLNLENNMFNGTVPPELAKLA  622
            +GPIP     L N+T                     TL YL L N   NGT+P  L  + 
Sbjct  243  NGPIPSGISLLKNLTDLRISDLNGSEHSPFPQLNNMTLKYLILRNCNINGTLPIYLGSMT  302

Query  623  NLQNLILSGNYLTGELPKELNSL  691
             L+NL LS N LTG +P   ++L
Sbjct  303  TLKNLDLSFNKLTGPIPSNYDAL  325


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +2

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP-PEWASMKLEYIS  496
            F   +  +Q +++QG  L G +P  +  L  L  + IS    S   P P+  +M L+Y+ 
Sbjct  225  FIQSLTSLQKLVIQGSGLNGPIPSGISLLKNLTDLRISDLNGSEHSPFPQLNNMTLKYLI  284

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            +    ++G +P YLG++TTL  L+L  N   G +P     L  +  + L+GN L G +P
Sbjct  285  LRNCNINGTLPIYLGSMTTLKNLDLSFNKLTGPIPSNYDALRKVDYIYLTGNLLNGPVP  343



>ref|XP_010247775.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=938

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 122/185 (66%), Gaps = 10/185 (5%)
 Frame = +2

Query  140  EAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCS  319
            + Q+  L  +E  ALK IA ++ KK+WDF VNPC   + W T    D     N + CNC+
Sbjct  27   QTQTPTLAPEEWEALKLIAAKL-KKNWDFSVNPC---TKWNTSMEHDTM---NAVACNCT  79

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
                 CHV +I ++ + LQGVLPP L +LP+L+IID+SR+YLSGTIPPEW +MKL  IS+
Sbjct  80   ---NTCHVTAIYIKSEGLQGVLPPELAQLPYLQIIDLSRNYLSGTIPPEWGAMKLTNISL  136

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+GPIPK  GNITTLV L LE N  +G +P EL KL NL+ L+LS N  TG  P+ 
Sbjct  137  MANRLTGPIPKEFGNITTLVDLTLEVNNLSGNIPNELGKLINLRKLVLSSNNFTGPFPES  196

Query  680  LNSLT  694
            L+ L 
Sbjct  197  LSKLV  201



>emb|CDP06039.1| unnamed protein product [Coffea canephora]
Length=998

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF-PAGI  334
            LP DE+ AL++IA  + K DW+F V+PC    NW TP   +     N +TC+CSF    +
Sbjct  22   LPPDEVRALQQIAGTLRKTDWNFSVDPCSGLQNWSTPNPIET---QNAVTCDCSFFNHTV  78

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
            CHV SIIL+ Q+L G LPP L+KLP+L+ ID++R+YL+GTIP EW SM+L  IS+  NR+
Sbjct  79   CHVVSIILKAQNLPGSLPPELIKLPYLREIDLTRNYLNGTIPREWGSMQLVNISLLGNRI  138

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            SG +PK LGNI+TLV L +E N  + T+PPEL  L  ++ + L+ N  TGELP  L  LT
Sbjct  139  SGSLPKELGNISTLVNLTVEFNQLSETIPPELGNLTLIEKIHLTSNNFTGELPGTLARLT  198


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 62/115 (54%), Gaps = 5/115 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGT---IPPEWASMKLEYISVTVN  508
            +++ +++Q   L G +P  +  L   K+ D+  S L+G     PP  A+  ++ + +   
Sbjct  223  NLEKLVIQASGLSGPMPSGIASLT--KLTDLRISDLNGNDTNFPPLSAATNMKTLILRSC  280

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             + G +P +LG+   L  L+L  N  +G +P  L  L  ++N+ L+GN+LTG +P
Sbjct  281  NIVGQLPGFLGSFKKLKLLDLSFNKLSGPIPRTLFGLPKIENIYLTGNFLTGAVP  335


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 5/120 (4%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP---PEWASMKLEYISVTVNR  511
            ++ I L   +  G LP TL +L  LK   I  +   G+IP     W +  LE + +  + 
Sbjct  176  IEKIHLTSNNFTGELPGTLARLTNLKDFRIGENQFLGSIPNFIQSWTN--LEKLVIQASG  233

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            LSGP+P  + ++T L  L + +   N T  P L+   N++ LIL    + G+LP  L S 
Sbjct  234  LSGPMPSGIASLTKLTDLRISDLNGNDTNFPPLSAATNMKTLILRSCNIVGQLPGFLGSF  293



>gb|KHN36922.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=999

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 119/185 (64%), Gaps = 3/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    L  DE+ AL++IA  +GKKDWDF V+PC    NW +  +  +    N +TC+C+F
Sbjct  24   ASGATLLQDEVKALEDIAKTLGKKDWDFNVDPCSGQRNWTSAVQ--VKGSENNVTCDCTF  81

Query  323  PAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              G +CHV +I+L+ Q+L G LP  L +LPFL+ ID++R+YL+GTIP EW S KL  IS+
Sbjct  82   ANGTVCHVTNILLKSQNLPGTLPRDLFRLPFLQEIDLTRNYLNGTIPKEWGSTKLAIISL  141

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+G IP  + NI+TL  L LE N  +G +PPEL  L  +Q L+LS N   GELP  
Sbjct  142  LGNRLTGSIPIEIANISTLQSLVLEGNQLSGNLPPELGNLTQIQRLLLSSNNFIGELPVT  201

Query  680  LNSLT  694
            L  LT
Sbjct  202  LVKLT  206


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 70/146 (48%), Gaps = 26/146 (18%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVN  508
            +  +Q ++L   +  G LP TLVKL  L+ I I  +  SG IP    S+  L+ + +  +
Sbjct  181  LTQIQRLLLSSNNFIGELPVTLVKLTTLQDIRIGDNQFSGKIPNFIQSLTSLQKLVIQGS  240

Query  509  RLSGPIPK---YLGNIT----------------------TLVYLNLENNMFNGTVPPELA  613
             LSGPIP    +L N+T                       L YL L N   NGT+PP L 
Sbjct  241  GLSGPIPSGISFLENLTDLRISDLNGSEHSLFPQLNQMKNLKYLILRNCNINGTLPPYLG  300

Query  614  KLANLQNLILSGNYLTGELPKELNSL  691
             +  L+NL LS N LTG +P   ++L
Sbjct  301  NMTTLKNLDLSFNKLTGPIPSTYDAL  326


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 65/122 (53%), Gaps = 6/122 (5%)
 Frame = +2

Query  320  FPAGICHVQSIILQGQDLQGVLPPT---LVKLPFLKIIDISRSYLSGTIPPEWASMK-LE  487
            F   +  +Q +++QG  L G +P     L  L  L+I D++ S  S  + P+   MK L+
Sbjct  225  FIQSLTSLQKLVIQGSGLSGPIPSGISFLENLTDLRISDLNGSEHS--LFPQLNQMKNLK  282

Query  488  YISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGE  667
            Y+ +    ++G +P YLGN+TTL  L+L  N   G +P     L  +  + L+GN L G+
Sbjct  283  YLILRNCNINGTLPPYLGNMTTLKNLDLSFNKLTGPIPSTYDALRKVDYIYLTGNLLNGQ  342

Query  668  LP  673
            +P
Sbjct  343  VP  344



>gb|ABF70100.1| protein kinase, putative [Musa balbisiana]
Length=1016

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = +2

Query  179  ALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQSIIL  358
            AL+ IA ++ KK WDF V+PC   + W  P R DMP + + +TC+C+  + ICHV SI L
Sbjct  11   ALRVIASKLEKK-WDFSVDPCSQTNGWVVPGRSDMPVFTDNVTCDCNRTSNICHVTSIKL  69

Query  359  QGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPKYL  538
            +GQ+L G LPP   KLPFL  ID++ +YL+GTIP  WAS+ L ++S+  N++SGPIP+  
Sbjct  70   KGQNLTGTLPPEFSKLPFLTDIDLTWNYLNGTIPAAWASLPLVHLSLLGNQVSGPIPEEF  129

Query  539  GNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
              + TL  L LE N   G +P  L KLANL+ L+ +GNYL+GELP+ L +L
Sbjct  130  AKMITLEELVLEGNQLQGPIPAALGKLANLKRLLANGNYLSGELPESLGNL  180



>ref|XP_004488998.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cicer arietinum]
Length=1007

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 119/178 (67%), Gaps = 4/178 (2%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPA-GICHV  343
            DE  AL++IA+ +GKKDW+F ++PC NNSNW TP   ++    N +TCNCS      CHV
Sbjct  31   DEKKALEDIANSLGKKDWNFDIDPCSNNSNWATPTISNI--VENNVTCNCSVAGDNFCHV  88

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRLSG  520
             +I L+GQ+L G LPP L KL  L+IID+SR+YL+GTIP EW SM  L  I++  NRL+G
Sbjct  89   VTITLKGQNLPGNLPPALSKLRHLQIIDLSRNYLNGTIPKEWGSMSNLLNITLPGNRLTG  148

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
             IPK + NI+TL+ L L  N  +G +PPEL  LA +  L LS N  TGELP  L  LT
Sbjct  149  SIPKEIANISTLIQLELTANQMSGNLPPELGNLAQILTLRLSSNNFTGELPLTLAKLT  206


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 70/119 (59%), Gaps = 12/119 (10%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-------LEYIS  496
            ++ S+I+QG  L G +P  + +L    + D+  S L+G+   E+AS+        L+ + 
Sbjct  231  NIYSLIIQGSGLSGPIPSEISRLR--NLTDLRISDLNGS---EYASLPQLKNIPLLKTLI  285

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            +    ++G +P YLGN+TTL +L+L  N  +GT+P   A  +++Q + L+GN LTG +P
Sbjct  286  LRNCNINGKLPDYLGNMTTLKHLDLSFNKLSGTIPISYAITSSVQYIFLTGNLLTGPIP  344



>gb|KDP24892.1| hypothetical protein JCGZ_25154 [Jatropha curcas]
Length=359

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 124/201 (62%), Gaps = 16/201 (8%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F +  LEA    LP DE+  L+EI   +GK DW+F V+PC   S W  P        +N 
Sbjct  16   FTSLVLEA--AELPNDEVEGLREIGKTLGKTDWNFSVDPCSRQSGWANPAT----GQDNN  69

Query  302  LTCNCSFPAG-ICHVQSII---------LQGQDLQGVLPPTLVKLPFLKIIDISRSYLSG  451
            +TC+CSF  G ICHV  +          L+ Q+LQG+LP  L KLP+LK ID++R+YL+G
Sbjct  70   ITCDCSFSNGTICHVIFMYVSAPLAKKSLKSQNLQGMLPTDLSKLPYLKDIDLTRNYLNG  129

Query  452  TIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQ  631
            TIP  W S +LE IS+  NRL+GPIPK +GNI+TL    +E N  +G +P EL  L N++
Sbjct  130  TIPSTWGSTQLEVISLLGNRLTGPIPKEIGNISTLREFVVEYNQLSGELPQELGNLNNIR  189

Query  632  NLILSGNYLTGELPKELNSLT  694
             ++LS N  +G+LP+   +LT
Sbjct  190  RMLLSSNNFSGQLPETFANLT  210



>ref|XP_008380254.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Malus domestica]
Length=1030

 Score =   174 bits (441),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 121/193 (63%), Gaps = 2/193 (1%)
 Frame = +2

Query  122  FNARFLE-AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            F A F + A +  L   E+N LKEI  ++GKKDWDF  +PC    NW  P      A+++
Sbjct  24   FFATFGQSATTAKLHTQEVNVLKEIGKKMGKKDWDFGKDPCTEEGNWTVPISTGKKAFDS  83

Query  299  TLTCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
             + C+C+F     CHV  I L+ Q+L G +PP   KL +L+ +D+SR+ L+GTIP +WA+
Sbjct  84   AVICDCTFNHNSSCHVIRIFLKSQNLSGTVPPEFSKLXYLEELDLSRNVLNGTIPSQWAT  143

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
            M+L  +S   NRLSGP PK L NITTL  L++E N F+G +P E+ KL  L+ LILS N 
Sbjct  144  MRLHTLSFMGNRLSGPFPKVLTNITTLRNLSIEGNHFSGPIPWEIGKLIKLEKLILSSNA  203

Query  656  LTGELPKELNSLT  694
             TG+LP  L  LT
Sbjct  204  FTGKLPSTLGKLT  216


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 55/115 (48%), Gaps = 5/115 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR--  511
             V  ++++G  L+G +P T+  L  L   D+  + L G   P      LE +   + R  
Sbjct  241  RVSKLLIEGSSLEGPIPSTISALTSL--TDLRITDLKGNRSPFPPLSNLESLKTLILRNC  298

Query  512  -LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +   IP Y+G++  L  L+L  N   G +P    +L  +  + L+GN LTG +P
Sbjct  299  LIHXEIPDYIGDMENLKNLDLSFNELTGEIPASFVRLEKIDIMYLTGNQLTGTIP  353



>ref|XP_008380255.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Malus domestica]
Length=1021

 Score =   174 bits (441),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 121/193 (63%), Gaps = 2/193 (1%)
 Frame = +2

Query  122  FNARFLE-AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            F A F + A +  L   E+N LKEI  ++GKKDWDF  +PC    NW  P      A+++
Sbjct  24   FFATFGQSATTAKLHTQEVNVLKEIGKKMGKKDWDFGKDPCTEEGNWTVPISTGKKAFDS  83

Query  299  TLTCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
             + C+C+F     CHV  I L+ Q+L G +PP   KL +L+ +D+SR+ L+GTIP +WA+
Sbjct  84   AVICDCTFNHNSSCHVIRIFLKSQNLSGTVPPEFSKLXYLEELDLSRNVLNGTIPSQWAT  143

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
            M+L  +S   NRLSGP PK L NITTL  L++E N F+G +P E+ KL  L+ LILS N 
Sbjct  144  MRLHTLSFMGNRLSGPFPKVLTNITTLRNLSIEGNHFSGPIPWEIGKLIKLEKLILSSNA  203

Query  656  LTGELPKELNSLT  694
             TG+LP  L  LT
Sbjct  204  FTGKLPSTLGKLT  216


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 55/115 (48%), Gaps = 5/115 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR--  511
             V  ++++G  L+G +P T+  L  L   D+  + L G   P      LE +   + R  
Sbjct  241  RVSKLLIEGSSLEGPIPSTISALTSL--TDLRITDLKGNRSPFPPLSNLESLKTLILRNC  298

Query  512  -LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +   IP Y+G++  L  L+L  N   G +P    +L  +  + L+GN LTG +P
Sbjct  299  LIHXEIPDYIGDMENLKNLDLSFNELTGEIPASFVRLEKIDIMYLTGNQLTGTIP  353



>ref|XP_006574177.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Glycine max]
Length=997

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 121/184 (66%), Gaps = 7/184 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP DE+ AL++IA  +GKK+W++ V+PC+  SNW + ++       N +TCNCSF
Sbjct  22   AVGATLPEDEVQALRDIAHTIGKKNWNYSVDPCDGKSNWNSSQK-------NVVTCNCSF  74

Query  323  PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVT  502
                CHV SIIL+ Q+L G++   LV+LP+L+ ID +R+YL+GTIP +  ++ L  IS  
Sbjct  75   VNHTCHVVSIILKEQNLSGIISADLVRLPYLQQIDFTRNYLNGTIPKQLGTLNLVNISFL  134

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             NRL+GPIPK LGNITTL  L LE N  +G++P EL  L  ++ L L+ N  TGELP  L
Sbjct  135  GNRLTGPIPKELGNITTLKALVLEFNQLSGSLPLELGNLTQIEKLHLTSNNFTGELPATL  194

Query  683  NSLT  694
              LT
Sbjct  195  ARLT  198



>ref|XP_006573362.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X2 [Glycine 
max]
Length=711

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 120/184 (65%), Gaps = 7/184 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP DE+ AL++IA  +GKK+W++ V+PC   SNW + E+       N +TCNCSF
Sbjct  22   AFGATLPEDEVQALRDIAHTIGKKNWNYSVDPCTGKSNWNSSEK-------NVVTCNCSF  74

Query  323  PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVT  502
                CHV SIIL+ Q+L G++   LV+LP+L+ ID +R+YL+GTIP +  ++ L  IS  
Sbjct  75   VNHTCHVVSIILKEQNLSGIISADLVRLPYLQQIDFTRNYLNGTIPKQLGTLNLVNISFL  134

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             NRL+GPIPK LGNITTL  L LE N  +G++P EL  L  ++ L L+ N  TGELP  L
Sbjct  135  GNRLTGPIPKELGNITTLKALVLEFNQLSGSLPLELGNLTQIEKLHLTSNNFTGELPATL  194

Query  683  NSLT  694
              LT
Sbjct  195  ARLT  198


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 64/145 (44%), Gaps = 25/145 (17%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS-MKLEYISVTVN  508
            +  ++ + L   +  G LP TL +L  LK + I  +  SG IP    S + LE + +  +
Sbjct  173  LTQIEKLHLTSNNFTGELPATLARLTTLKELRIGDNQFSGAIPNFIQSWINLEILVMQGS  232

Query  509  RLSGPIPK------------------------YLGNITTLVYLNLENNMFNGTVPPELAK  616
             LSGPIP                          L N+T LV L L +    G++P  L K
Sbjct  233  GLSGPIPSGISILRNLTDLRVTDLNGSDSWFPQLNNMTNLVTLILRSCNIIGSLPENLGK  292

Query  617  LANLQNLILSGNYLTGELPKELNSL  691
            L NL+ L +S N LTG +P     L
Sbjct  293  LTNLEVLDVSYNKLTGPIPSIFGDL  317



>ref|XP_006573364.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Glycine max]
Length=998

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 119/179 (66%), Gaps = 7/179 (4%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGIC  337
            LP DE+ AL++IA  +GKK+W++ V+PC   SNW + E+       N +TCNCSF    C
Sbjct  27   LPEDEVQALRDIAHTIGKKNWNYSVDPCTGKSNWNSSEK-------NVVTCNCSFVNHTC  79

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLS  517
            HV SIIL+ Q+L G++   LV+L +L+ ID +R+YL+GTIP +  ++ L  IS   NRL+
Sbjct  80   HVVSIILKEQNLSGIISTDLVRLSYLQQIDFTRNYLNGTIPRQLGTLNLVNISFIGNRLT  139

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            GPIPK LGNITTL  L LE N  +G++P EL  LA ++ L L+ N  TGELP  L  LT
Sbjct  140  GPIPKELGNITTLKILKLEFNQLSGSLPLELGNLAQIEKLHLTSNNFTGELPATLARLT  198


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 66/145 (46%), Gaps = 25/145 (17%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS-MKLEYISVTVN  508
            +  ++ + L   +  G LP TL +L  LK + I  +  SG IP    S + LE + +  +
Sbjct  173  LAQIEKLHLTSNNFTGELPATLARLTTLKELRIGDNQFSGAIPNFIQSWINLEKLIMHGS  232

Query  509  RLSGPIPK---YLGNITTLVYLNLE---------NNMFN------------GTVPPELAK  616
             LSGPIP     L N+T L   +L          NNM N            G++P  L K
Sbjct  233  GLSGPIPSGISILRNLTDLRVTDLNGSDSRFPQLNNMTNLLTLIFRSCNIIGSLPENLVK  292

Query  617  LANLQNLILSGNYLTGELPKELNSL  691
            L NL+ L +S N LTG +P     L
Sbjct  293  LTNLEILDVSYNKLTGPIPSIFGDL  317



>ref|XP_010272732.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nelumbo nucifera]
Length=1024

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 120/193 (62%), Gaps = 4/193 (2%)
 Frame = +2

Query  122  FNARFLEAQSG-HLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            F   F  ++S   L   E+ ALKEI   +GK+DWDF  +PC    NW  PE   M  +  
Sbjct  25   FGTSFASSESKPKLTSAEVEALKEIGKGLGKRDWDFDEDPCGGEGNWNVPET--MKGFAR  82

Query  299  TLTCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
            ++ C+CSF     CHV +I L+ Q+L G LPP   KLPFL+ +D+SR+ LSG+IP +WA+
Sbjct  83   SVICDCSFDNNSTCHVVTIELKAQNLSGHLPPEFHKLPFLQHLDLSRNILSGSIPSKWAT  142

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
            M L  +S+  NRLSG  PK L NITTL  L++E N F+G +PPE+  L NLQ  ++S N 
Sbjct  143  MSLLDLSLMGNRLSGSFPKALTNITTLRNLSIEGNRFSGVLPPEIGNLINLQKFVISSNK  202

Query  656  LTGELPKELNSLT  694
             TGELP  L  LT
Sbjct  203  FTGELPVALAKLT  215


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR--  511
             ++ + +QG  L+G +P ++  L  L  + IS     G+  P  + M  E + + + R  
Sbjct  240  QIEKLHIQGCSLEGPIPSSISALTSLTDLRISDLNGRGSDFPPLSRM--ESMKILILRKC  297

Query  512  -LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             +SG IP+Y+G++  L  L+L  N  +G +P   +KL     + L+GN LTG +P+
Sbjct  298  SISGNIPEYIGDLKKLKTLDLSFNNLSGEIPESFSKLGKADFMYLTGNKLTGPVPE  353



>ref|XP_009148012.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Brassica rapa]
Length=1012

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 120/189 (63%), Gaps = 3/189 (2%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F+ R   + +  L   E+ ALKEI  ++GKKDWDF  +PC    NW          + + 
Sbjct  18   FHGRLGFSDNNKLHEAEVRALKEIGKKLGKKDWDFNKDPCSGQGNWVVTTYTS-KEFESN  76

Query  302  LTCNCSFPA--GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
            +TC+CSF      CHV  I L+ Q+L G++PP   KL  LK++D+SR+YL+G+IP EWAS
Sbjct  77   ITCDCSFLPLNSSCHVIRIALKSQNLTGIVPPEFSKLRHLKVLDLSRNYLTGSIPKEWAS  136

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
            M++E +S   NRLSGP PK L  +TTL  L+LE N+F+G +PPE+ ++ +L+ L L  N 
Sbjct  137  MRVEDLSFMGNRLSGPFPKVLTRLTTLRNLSLEGNLFSGQIPPEIKRMIHLERLHLPSNA  196

Query  656  LTGELPKEL  682
             TG LPKEL
Sbjct  197  FTGPLPKEL  205



>ref|XP_007142243.1| hypothetical protein PHAVU_008G264400g [Phaseolus vulgaris]
 gb|ESW14237.1| hypothetical protein PHAVU_008G264400g [Phaseolus vulgaris]
Length=1027

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 123/191 (64%), Gaps = 6/191 (3%)
 Frame = +2

Query  134  FLEAQSGHLP---LDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTL  304
            FL   S   P     E+ ALKEI  ++GKKDWDF V+PC    +W   +  D   + +++
Sbjct  23   FLHLASAATPKLNTQEVKALKEIGSKIGKKDWDFGVDPCSGKGSWNASD--DRKGFESSV  80

Query  305  TCNCSFP-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK  481
             C+CSF  +  CHV SI L+GQ+L G L P   KL +L  +D+SR+ ++G+IPP+W++M+
Sbjct  81   MCDCSFNNSTSCHVVSIFLKGQNLSGSLSPMFSKLQYLTHLDLSRNIITGSIPPQWSTMR  140

Query  482  LEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLT  661
            L  IS   N+LSGP PK L NITTL  L++E N+F+G +P E+ KL NL+ +ILS N  T
Sbjct  141  LVEISFMGNKLSGPFPKVLTNITTLRNLSIEGNLFSGHIPTEIEKLINLEKIILSSNGFT  200

Query  662  GELPKELNSLT  694
            G LP  L+ LT
Sbjct  201  GALPPSLSKLT  211


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 59/114 (52%), Gaps = 4/114 (4%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPT---LVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR  511
            ++ + +QG  L+G +P +   L +L  L+I D+     S   PP      ++ + +    
Sbjct  237  IEKLHMQGCSLEGPIPSSISALTRLSDLRITDLKGDKTSA-FPPLNNLKSMKTLVLRKCM  295

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            + G IP+Y+G +  L  L+L  N  +G +P   ++L  +  + L+GN L+G +P
Sbjct  296  IKGEIPEYIGRMEKLKILDLSYNGLSGEIPESFSELDKVDFMYLTGNKLSGTIP  349



>ref|XP_006573361.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X1 [Glycine 
max]
Length=954

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 120/184 (65%), Gaps = 7/184 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP DE+ AL++IA  +GKK+W++ V+PC   SNW + E+       N +TCNCSF
Sbjct  22   AFGATLPEDEVQALRDIAHTIGKKNWNYSVDPCTGKSNWNSSEK-------NVVTCNCSF  74

Query  323  PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVT  502
                CHV SIIL+ Q+L G++   LV+LP+L+ ID +R+YL+GTIP +  ++ L  IS  
Sbjct  75   VNHTCHVVSIILKEQNLSGIISADLVRLPYLQQIDFTRNYLNGTIPKQLGTLNLVNISFL  134

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             NRL+GPIPK LGNITTL  L LE N  +G++P EL  L  ++ L L+ N  TGELP  L
Sbjct  135  GNRLTGPIPKELGNITTLKALVLEFNQLSGSLPLELGNLTQIEKLHLTSNNFTGELPATL  194

Query  683  NSLT  694
              LT
Sbjct  195  ARLT  198


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 64/145 (44%), Gaps = 25/145 (17%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS-MKLEYISVTVN  508
            +  ++ + L   +  G LP TL +L  LK + I  +  SG IP    S + LE + +  +
Sbjct  173  LTQIEKLHLTSNNFTGELPATLARLTTLKELRIGDNQFSGAIPNFIQSWINLEILVMQGS  232

Query  509  RLSGPIPK------------------------YLGNITTLVYLNLENNMFNGTVPPELAK  616
             LSGPIP                          L N+T LV L L +    G++P  L K
Sbjct  233  GLSGPIPSGISILRNLTDLRVTDLNGSDSWFPQLNNMTNLVTLILRSCNIIGSLPENLGK  292

Query  617  LANLQNLILSGNYLTGELPKELNSL  691
            L NL+ L +S N LTG +P     L
Sbjct  293  LTNLEVLDVSYNKLTGPIPSIFGDL  317



>emb|CDX95138.1| BnaC05g05330D [Brassica napus]
Length=1012

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 120/189 (63%), Gaps = 3/189 (2%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F+ R   + +  L   E+ ALKEI  ++GKKDWDF  +PC    NW          + + 
Sbjct  18   FHGRLGFSDNNKLHEAEVRALKEIGKKLGKKDWDFNKDPCSGQGNWVVTTYTS-KEFESN  76

Query  302  LTCNCSFPA--GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
            +TC+CSF      CHV  I L+ Q+L GV+PP   KL  LK++D+SR+YL+G+IP EWAS
Sbjct  77   ITCDCSFLPLNSSCHVIRIALKSQNLTGVVPPEFSKLRHLKVLDLSRNYLTGSIPKEWAS  136

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
            M+LE +S   NRLSGP PK L  +TTL  L+LE N+F+G +PPE+ ++ +L+ L L  N 
Sbjct  137  MRLEDLSFMGNRLSGPFPKVLTRLTTLRNLSLEGNLFSGQIPPEIKRMIHLERLHLPSNA  196

Query  656  LTGELPKEL  682
             TG LP+EL
Sbjct  197  FTGPLPEEL  205



>gb|KHN04126.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=953

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 120/184 (65%), Gaps = 7/184 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    LP DE+ AL++IA  +GKK+W++ V+PC   SNW + E+       N +TCNCSF
Sbjct  21   AFGATLPEDEVQALRDIAHTIGKKNWNYSVDPCTGKSNWNSSEK-------NVVTCNCSF  73

Query  323  PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVT  502
                CHV SIIL+ Q+L G++   LV+LP+L+ ID +R+YL+GTIP +  ++ L  IS  
Sbjct  74   VNHTCHVVSIILKEQNLSGIISADLVRLPYLQQIDFTRNYLNGTIPKQLGTLNLVNISFL  133

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             NRL+GPIPK LGNITTL  L LE N  +G++P EL  L  ++ L L+ N  TGELP  L
Sbjct  134  GNRLTGPIPKELGNITTLKALVLEFNQLSGSLPLELGNLTQIEKLHLTSNNFTGELPATL  193

Query  683  NSLT  694
              LT
Sbjct  194  ARLT  197


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 64/145 (44%), Gaps = 25/145 (17%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS-MKLEYISVTVN  508
            +  ++ + L   +  G LP TL +L  LK + I  +  SG IP    S + LE + +  +
Sbjct  172  LTQIEKLHLTSNNFTGELPATLARLTTLKELRIGDNQFSGAIPNFIQSWINLEILVMQGS  231

Query  509  RLSGPIPK------------------------YLGNITTLVYLNLENNMFNGTVPPELAK  616
             LSGPIP                          L N+T LV L L +    G++P  L K
Sbjct  232  GLSGPIPSGISILRNLTDLRVTDLNGSDSWFPQLNNMTKLVTLILRSCNIIGSLPENLGK  291

Query  617  LANLQNLILSGNYLTGELPKELNSL  691
            L NL+ L +S N LTG +P     L
Sbjct  292  LTNLEVLDVSYNKLTGPIPSIFGDL  316



>ref|XP_007149531.1| hypothetical protein PHAVU_005G078000g [Phaseolus vulgaris]
 gb|ESW21525.1| hypothetical protein PHAVU_005G078000g [Phaseolus vulgaris]
Length=326

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 115/178 (65%), Gaps = 10/178 (6%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNW-FTPERKDMPAYNNTLTCNCSFPAG-ICH  340
            +E+ ALK+I   +G K+WD  ++PC N   W  TPE          ++CNCS P    CH
Sbjct  32   EEVKALKDIGKTLGNKNWDTDIDPCSNQPPWSVTPEIN--------VSCNCSIPTDTFCH  83

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            V SI+L+ Q+L G LP  LV+LP+L+ ID+S +YL+GTIPP+W SMKL  IS+  NR++G
Sbjct  84   VVSIVLKSQNLSGTLPSELVRLPYLQEIDLSLNYLNGTIPPQWGSMKLVNISILGNRVTG  143

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            PIPK LGNITTL  L LE N  +G +P EL  L  L+ L+L+ NY TG LP     LT
Sbjct  144  PIPKELGNITTLKSLVLEFNQLSGELPLELGNLPRLERLLLTSNYFTGNLPATFARLT  201


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +2

Query  326  AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVT  502
              I  ++S++L+   L G LP  L  LP L+ + ++ +Y +G +P  +A +  L+YI + 
Sbjct  150  GNITTLKSLVLEFNQLSGELPLELGNLPRLERLLLTSNYFTGNLPATFARLTTLKYIRLG  209

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILS  646
             N+ SG +P ++   T+L  L +  + F+G +P  ++ L  L NL +S
Sbjct  210  DNQFSGTLPDFIQRWTSLDRLVIHGSGFSGPIPSGISFLNKLTNLRIS  257



>ref|XP_007213739.1| hypothetical protein PRUPE_ppa000808mg [Prunus persica]
 gb|EMJ14938.1| hypothetical protein PRUPE_ppa000808mg [Prunus persica]
Length=997

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 123/187 (66%), Gaps = 3/187 (2%)
 Frame = +2

Query  134  FLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCN  313
             LE     LP +E++AL++I   +G K W F  + C       T E+    A +NT  C 
Sbjct  20   LLELAESKLPQEEVDALQQITTTMGAKYWRFNNDACRIEMVGVT-EKPPKGAQSNT-DCE  77

Query  314  CSFPAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEY  490
            C F    +CHV  ++L+G  L G+LPP LVKLP+L+ ID + +YL+GTIPPEWAS KL Y
Sbjct  78   CYFENNTVCHVVKLMLKGYSLPGLLPPQLVKLPYLREIDFAYNYLNGTIPPEWASTKLTY  137

Query  491  ISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGEL  670
            ISV VNRLSG IPK LGNITTL YL+LE+N F+G +P EL  L NLQ L+LS N LTG+L
Sbjct  138  ISVLVNRLSGQIPKELGNITTLTYLSLESNKFSGILPIELGNLINLQTLMLSSNQLTGKL  197

Query  671  PKELNSL  691
            P+  + +
Sbjct  198  PEAFSGI  204



>gb|KJB33249.1| hypothetical protein B456_006G003800 [Gossypium raimondii]
Length=1020

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 112/176 (64%), Gaps = 2/176 (1%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-ICHV  343
            +E+ ALK I  ++ KKDWDF ++PC    NW      D   + + + CNCSF     CHV
Sbjct  44   EEVKALKAIGKKIEKKDWDFGIDPCSGKGNWMAKGDGD-EGFESIVICNCSFNNNKTCHV  102

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
             SI L   ++   LPP   KL  LK++D+SR+Y +GTIP EW ++KLE +S   NRLSGP
Sbjct  103  VSISLTALNISATLPPDFSKLRHLKVLDLSRNYFTGTIPREWTTLKLETLSFMGNRLSGP  162

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
             PK L NIT+L  L++E N F+G++PPE+ KL NLQ L LS N  +GELP EL  L
Sbjct  163  FPKVLTNITSLTNLSIEGNNFSGSIPPEIGKLINLQKLTLSSNAFSGELPVELAKL  218


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 5/116 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR--  511
             +Q + +QG  L+G +P ++  L  L   D+  S L G   P      ++ +   + R  
Sbjct  244  QIQKLQIQGSSLEGPIPSSISALTSLS--DLRISDLKGARSPFPLLRNMDSLKTLILRNC  301

Query  512  -LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             + G IP+Y+G++  L  L+L  N   G +P    KL     L L+GN LTG +P+
Sbjct  302  LIYGEIPEYIGDMKKLKTLDLSYNNLTGEIPGSFHKLTKADFLYLTGNQLTGSVPQ  357



>gb|KHN36926.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=250

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 116/175 (66%), Gaps = 7/175 (4%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPA-GICHVQS  349
            + ALK++   +GKK+WD  ++PC     WFT +       NN +TCNC+ P    CHV  
Sbjct  5    VQALKDMGKTLGKKEWDTDIDPCSGQPPWFTSKE------NNNVTCNCTIPGENFCHVVI  58

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIP  529
            I+L+ Q+L+G+LP  L++LP+L+ ID++++YL+GTIP +W S  L  IS+  NRL+GPIP
Sbjct  59   ILLKSQNLRGMLPRELIRLPYLEEIDLTKNYLNGTIPTQWGSSNLRSISLYGNRLTGPIP  118

Query  530  KYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            K + NIT L  L LE N F+G +PPEL  L ++Q L L+ N  TGELP+ L  LT
Sbjct  119  KEIANITNLQNLVLEFNQFSGNLPPELGNLPSIQKLHLTSNNFTGELPETLAKLT  173



>ref|XP_009406148.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Musa acuminata subsp. malaccensis]
Length=1007

 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 116/175 (66%), Gaps = 1/175 (1%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGICHVQ  346
            DE+ AL+ IA ++ KK WDF V+PC   + W  P R DMP + + +TC+C+  + +CHV 
Sbjct  44   DEVAALRVIASKLEKK-WDFSVDPCSQTNGWVVPGRSDMPVFTDNVTCDCNRTSNVCHVT  102

Query  347  SIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPI  526
            SI L+GQ+L G LP    KLPFL  ID++ +YL+GTIP  WAS+ L ++S+  NR+SGPI
Sbjct  103  SIKLKGQNLTGTLPAEFSKLPFLTDIDLTWNYLNGTIPAAWASLPLVHLSLLGNRVSGPI  162

Query  527  PKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            P+    + TL  L LE N   G +P  L KLANL+  + +GN L+GELP+ L +L
Sbjct  163  PEEFAKMITLEELVLEGNQLQGPIPAALGKLANLKRFLANGNNLSGELPESLGNL  217



>ref|XP_008463772.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840 [Cucumis 
melo]
Length=1022

 Score =   172 bits (436),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 125/201 (62%), Gaps = 12/201 (6%)
 Frame = +2

Query  122  FNARFLEA--------QSGHLPLDELNALKEIADEVGKKDWDFRVNPCEN-NSNWFTPER  274
            F A+FL           +  LP DE+ AL+EI   +GK +W F+ +PC   N  W T   
Sbjct  48   FMAQFLAVFLFFSLVYAAARLPADEVEALREIGKTLGKANWSFKTDPCGGENGGWITISM  107

Query  275  KDMPAYNNTLTCNCSFP-AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSG  451
            +    + N LTC+CSF    +CHV  I L+ Q+L G LPP + KLP+L+ +D++R+YLSG
Sbjct  108  E--LGFVNNLTCDCSFQNHKVCHVTKIRLRSQNLPGTLPPQIAKLPYLEELDLARNYLSG  165

Query  452  TIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQ  631
             IPPEW   KL  +SV  N+L+GPIPK +GNI+TL  L LE N F+G++P EL  L NL+
Sbjct  166  PIPPEWGLTKLVNLSVLGNQLTGPIPKEIGNISTLKELVLEVNQFSGSLPQELGNLKNLK  225

Query  632  NLILSGNYLTGELPKELNSLT  694
             L++S N  TGELP  L  +T
Sbjct  226  RLLVSSNKFTGELPSSLGKIT  246


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 66/122 (54%), Gaps = 7/122 (6%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIP---PEWASMKLEYISVTVN  508
            +++ +++      G LP +L K+  +    IS ++ +G+IP     W   KL+ +++  +
Sbjct  223  NLKRLLVSSNKFTGELPSSLGKITTMTDFRISDNHFTGSIPNFIRNWP--KLQKLAIQAS  280

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVP-PELAKLANLQNLILSGNYLTGELPKELN  685
             LSGPIP  +G +T L  L + +++  G+ P P +  L NL+ LIL    + G LP  LN
Sbjct  281  GLSGPIPPEIGRLTLLDDLRI-SDLNGGSSPFPPVNILENLKTLILRSCNIIGMLPPRLN  339

Query  686  SL  691
             L
Sbjct  340  GL  341



>ref|XP_011470947.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=924

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +2

Query  296  NTLTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
            N +TC+CSFP    HV SIILQGQDL GVLP ++VKLP+L  +D++R+YLSG IP +WAS
Sbjct  2    NNVTCSCSFPDETYHVISIILQGQDLHGVLPTSIVKLPYLTFLDLNRNYLSGKIPIQWAS  61

Query  476  MKLEYISVTVNRL-SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGN  652
             KLE++SV+VN L +G IP YLGNITTL YL+LE N F+GTVPPEL  L NL+ L+LS N
Sbjct  62   TKLEHLSVSVNNLPAGSIPSYLGNITTLQYLSLETNRFSGTVPPELGNLVNLETLVLSAN  121

Query  653  YLTGELPKELNSLT  694
             LTGELP  L  LT
Sbjct  122  NLTGELPMSLTKLT  135



>ref|NP_001237014.1| receptor-like protein kinase 2-like precursor [Glycine max]
 gb|AAU10526.1| putative receptor-like protein kinase 2 [Glycine max]
Length=999

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 115/177 (65%), Gaps = 3/177 (2%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-ICHV  343
            DE+ AL++I+  +GKKDWDF VNPC    NW +  +  +    N +TC+C+F  G +CHV
Sbjct  32   DEVKALEDISKTLGKKDWDFNVNPCSGQRNWTSAVQ--VKGSENNVTCDCTFANGTVCHV  89

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
             +I+L+ Q L G LP  L +LPFL+ ID++R+YL+GTIP EW S KL  IS+  NRL G 
Sbjct  90   TNILLKSQKLPGTLPRDLFRLPFLQEIDLTRNYLNGTIPKEWGSTKLAIISLLGNRLIGS  149

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            IP  + NI+TL  L LE N  +G +PPEL  L  +Q L+LS N   GELP  L  LT
Sbjct  150  IPIEIANISTLQSLVLEGNQLSGNLPPELGNLTQIQKLLLSSNNFIGELPVTLVKLT  206


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 70/146 (48%), Gaps = 26/146 (18%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVN  508
            +  +Q ++L   +  G LP TLVKL  L+ I I  +  SG IP    S+  L+ + +  +
Sbjct  181  LTQIQKLLLSSNNFIGELPVTLVKLTTLQDIRIGDNQFSGKIPNFIQSLTSLQKLVIQGS  240

Query  509  RLSGPIPK---YLGNIT----------------------TLVYLNLENNMFNGTVPPELA  613
             LSGPIP    +L N+T                       L YL L N   NGT+PP L 
Sbjct  241  GLSGPIPSGISFLENLTDLRISDLNGSEHSLFPQLNQMKNLKYLILRNCNINGTLPPYLG  300

Query  614  KLANLQNLILSGNYLTGELPKELNSL  691
             +  L+NL LS N LTG +P   ++L
Sbjct  301  NMTTLKNLDLSFNKLTGPIPSTYDAL  326


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 65/122 (53%), Gaps = 6/122 (5%)
 Frame = +2

Query  320  FPAGICHVQSIILQGQDLQGVLPPT---LVKLPFLKIIDISRSYLSGTIPPEWASMK-LE  487
            F   +  +Q +++QG  L G +P     L  L  L+I D++ S  S  + P+   MK L+
Sbjct  225  FIQSLTSLQKLVIQGSGLSGPIPSGISFLENLTDLRISDLNGSEHS--LFPQLNQMKNLK  282

Query  488  YISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGE  667
            Y+ +    ++G +P YLGN+TTL  L+L  N   G +P     L  +  + L+GN L G+
Sbjct  283  YLILRNCNINGTLPPYLGNMTTLKNLDLSFNKLTGPIPSTYDALRKVDYIYLTGNLLNGQ  342

Query  668  LP  673
            +P
Sbjct  343  VP  344



>ref|XP_004491065.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cicer arietinum]
Length=760

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 119/185 (64%), Gaps = 3/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A    L  DE+ ALK+IA+ +GKKDWDF V+PC    NW +  +  +    N +TCNCSF
Sbjct  23   AFGATLSKDEVEALKDIANTLGKKDWDFSVDPCSGEQNWTSSVQ--VKGSENAVTCNCSF  80

Query  323  PAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
                ICHV +I+L+ Q+L G LPP L++LP L+ ID +R+YL+GTIP EW SM L  IS+
Sbjct  81   VNNTICHVTNILLKQQNLPGTLPPELIRLPHLQEIDFTRNYLNGTIPKEWGSMNLVNISL  140

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRL+G IP  + NI+TL  L LE N  +G +P EL  L  +Q L+LS N  TG+LP  
Sbjct  141  LGNRLTGSIPIEITNISTLQSLVLEANQLSGNLPLELGNLTQIQRLLLSSNNFTGQLPAT  200

Query  680  LNSLT  694
            +  LT
Sbjct  201  MVKLT  205


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 74/160 (46%), Gaps = 30/160 (19%)
 Frame = +2

Query  296  NTLTCNCSFPAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---  463
            N L+ N     G +  +Q ++L   +  G LP T+VKL  L+ I IS +  +G IP    
Sbjct  167  NQLSGNLPLELGNLTQIQRLLLSSNNFTGQLPATMVKLTTLQDIRISDNQFTGKIPDFIQ  226

Query  464  EWASMKLEYISVTVNRLSGPIPKYLGNITTLV------------------------YLNL  571
             W S  L+ + +  + LSGPIP  + N+  L                         YL L
Sbjct  227  SWTS--LQKLVIEGSGLSGPIPSGISNLKNLTDLRISDLNGSEHSPFPQLNDMNLKYLIL  284

Query  572  ENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
             +   NGT+P  L  L +L+NL LS N L+G +P   ++L
Sbjct  285  RSCNINGTLPSFLRTLTSLKNLDLSFNKLSGPIPSNYDAL  324



>ref|XP_006575671.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X3 [Glycine max]
Length=544

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 119/192 (62%), Gaps = 3/192 (2%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F  +   A +  L   E+ ALKEI  ++GKKDWDF V+PC    NW   + +    + ++
Sbjct  24   FFPQLASAATPKLNTQEVKALKEIGSKIGKKDWDFGVDPCSGKGNWNVSDAR--KGFESS  81

Query  302  LTCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
            + C+CSF     CHV SI L+ Q+L G L P   KL  L+ +D+SR+ ++G IPP+W +M
Sbjct  82   VICDCSFDHNSSCHVVSISLKAQNLSGSLSPDFSKLHHLQELDLSRNIITGAIPPQWGTM  141

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
            +L  +S   N+LSGP PK L NITTL  L++E N F+G +P E+ KL NL+ LILS N  
Sbjct  142  RLVELSFMGNKLSGPFPKVLTNITTLRNLSIEGNQFSGHIPTEIGKLTNLEKLILSSNGF  201

Query  659  TGELPKELNSLT  694
            TG LP  L+ LT
Sbjct  202  TGALPPTLSKLT  213


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 58/114 (51%), Gaps = 4/114 (4%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPT---LVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR  511
            ++ + + G  L+G +P +   L +L  L+I D+  S  S   PP      ++ + +    
Sbjct  239  IEKLHMHGCSLEGPIPSSISALTRLSDLRIADLKGSK-SSAFPPLNNLKSMKTLVLRKCM  297

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            + G IP Y+G +  L  L+L  N  +G +P   A+L  +  + L+GN L+G +P
Sbjct  298  IKGEIPAYIGRMEKLKILDLSYNGLSGEIPESFAQLDKVDFMYLTGNKLSGIIP  351



>ref|XP_008225259.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=883

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 108/171 (63%), Gaps = 24/171 (14%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EA++  LP  E  ALKEIA+++GK DW+F +NPC N +NW T      P YN TL CNC
Sbjct  32   VEAKASLLPAAEEEALKEIANQLGKTDWNFNINPCFNYTNWDTLNSTANPIYNKTLECNC  91

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S+P G CHV SI                        D S +YLSGTIPPEWAS KLE +S
Sbjct  92   SYPNGFCHVVSI------------------------DFSLNYLSGTIPPEWASTKLELLS  127

Query  497  VTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSG  649
            V+ N LSG IP+YLGNITTL+ LNLE N+F+GTVPPEL  L NL+    +G
Sbjct  128  VSANNLSGQIPRYLGNITTLINLNLEMNLFSGTVPPELGNLVNLEIFNFTG  178



>ref|XP_006370080.1| hypothetical protein POPTR_0001s39360g [Populus trichocarpa]
 gb|ERP66649.1| hypothetical protein POPTR_0001s39360g [Populus trichocarpa]
Length=1005

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 116/181 (64%), Gaps = 3/181 (2%)
 Frame = +2

Query  155  HLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-  331
             LP DE+ AL+++A  +GK +W+F  +PC     W  P    +    N ++C+C+F  G 
Sbjct  25   RLPDDEVEALRDMAKTIGKTNWNFSADPCGGQWGWVDP--NPVKGNENAVSCDCTFSNGT  82

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNR  511
            ICHV SI+L+ Q+L+G LP  L + P+L+ ID+SR+YL+GTIP EW +  L  IS+  NR
Sbjct  83   ICHVISIVLKTQNLEGSLPRDLGRFPYLQEIDLSRNYLNGTIPAEWGATPLATISIIGNR  142

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            L+GPIPK +GNI+TL    +E N  +G +PPEL  L  L+ + LS NY TG+LP     L
Sbjct  143  LTGPIPKEIGNISTLANFTVEFNQLSGVLPPELGNLTRLEKMHLSSNYFTGQLPATFEKL  202

Query  692  T  694
            T
Sbjct  203  T  203


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/166 (25%), Positives = 72/166 (43%), Gaps = 20/166 (12%)
 Frame = +2

Query  227  RVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGI--------------CHVQSIILQG  364
            R+     +SN+FT +   +PA    LT    F  G                +++ +++QG
Sbjct  180  RLEKMHLSSNYFTGQ---LPATFEKLTTLKDFRIGDNNFTGQIPNLIQKWTNLEKLVIQG  236

Query  365  QDLQGVLPPTLV---KLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPKY  535
              L G +P  +    K+  L+I D+  +      PP     KL+ + +    + GP+P +
Sbjct  237  SGLSGPIPSGIALLEKMVDLRISDLQGNGTEAPFPPLTNMKKLKTLILRSCNIIGPLPVF  296

Query  536  LGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            +G +  L  L+L  N   G +P   + L     + L+GN L G +P
Sbjct  297  VGELLKLTTLDLSFNKLIGEIPSSFSGLRKADYIYLTGNQLNGTVP  342



>gb|KFK38835.1| hypothetical protein AALP_AA3G166500 [Arabis alpina]
Length=1048

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 123/184 (67%), Gaps = 7/184 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A S  LP DE++AL+++A  + K+DWDF V+PC   + W +   K      NT+ CNCS 
Sbjct  21   ASSQTLPKDEVDALRDVATALKKRDWDFTVDPCGGENGWRSVNGK---GSENTVICNCS-  76

Query  323  PAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVT  502
               +CHV +I+L+ Q+LQG LP  L  LPFL+ ID+SR+YL+G+IP EW +++L  IS+ 
Sbjct  77   --SVCHVTNIVLKEQNLQGTLPK-LAGLPFLQEIDLSRNYLNGSIPTEWGALQLVNISIL  133

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             NR++G IPK + NITTL+ L LE+N  +G +PPEL  L N+Q L L+ N+ +GE+P   
Sbjct  134  GNRITGQIPKEIANITTLMGLVLESNQISGELPPELGTLPNIQRLFLTSNFFSGEIPSTF  193

Query  683  NSLT  694
              LT
Sbjct  194  AKLT  197



>ref|XP_009350015.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Pyrus x bretschneideri]
Length=1030

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 116/185 (63%), Gaps = 1/185 (1%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF  322
            A +  L   ++N LK I  ++GKKDWDF  +PC    NW  P  +    +++ + C+C+F
Sbjct  32   ATTAKLHTQDVNVLKVIGKKLGKKDWDFGKDPCTGEGNWTIPIGRGKKGFDSAVICDCTF  91

Query  323  PA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
                 C V  I L+ Q+L G +PP   KLP+L+ +D+SR+ L+GTIP +WA+M+L  +S 
Sbjct  92   NHNSSCRVIRIFLKAQNLSGTVPPEFSKLPYLQELDLSRNVLNGTIPSQWATMRLHTLSF  151

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NRLSGP PK L NITTL  L++E N F+G +P E+ KL  L+ LILS N  TGELP  
Sbjct  152  MGNRLSGPFPKVLTNITTLRNLSIEGNHFSGPIPREIGKLIKLEKLILSSNAFTGELPST  211

Query  680  LNSLT  694
            L  LT
Sbjct  212  LVKLT  216


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 64/141 (45%), Gaps = 29/141 (21%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            +  ++ +IL      G LP TLVKL  L  + IS +  SG IP     W   ++  + + 
Sbjct  191  LIKLEKLILSSNAFTGELPSTLVKLTNLSDMRISDNNFSGKIPDFIGNWT--RVSKLLIE  248

Query  503  VNRLSGPIPKYLGNITTLVYLN------------------------LENNMFNGTVPPEL  610
             + L GPIP  +  +T+L +L                         L N + +G +P  +
Sbjct  249  GSSLEGPIPSTISALTSLTHLRITDLKGNRSPFPPLSNLESLKILILRNCLIHGEIPDYI  308

Query  611  AKLANLQNLILSGNYLTGELP  673
              + NL+NL LS N LTGE+P
Sbjct  309  GDMENLKNLDLSYNELTGEIP  329


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 63/139 (45%), Gaps = 12/139 (9%)
 Frame = +2

Query  278  DMPAYNNTLTCNC-SFPAGICHVQSIILQGQDLQGVLPPT---LVKLPFLKIIDISRSYL  445
            DM   +N  +     F      V  ++++G  L+G +P T   L  L  L+I D     L
Sbjct  220  DMRISDNNFSGKIPDFIGNWTRVSKLLIEGSSLEGPIPSTISALTSLTHLRITD-----L  274

Query  446  SGTIPPEWASMKLEYISVTVNR---LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAK  616
             G   P      LE + + + R   + G IP Y+G++  L  L+L  N   G +P    +
Sbjct  275  KGNRSPFPPLSNLESLKILILRNCLIHGEIPDYIGDMENLKNLDLSYNELTGEIPASFVR  334

Query  617  LANLQNLILSGNYLTGELP  673
            L  +  + L+GN LTG +P
Sbjct  335  LEKIDIMYLTGNQLTGTIP  353



>ref|XP_009135398.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Brassica rapa]
Length=1015

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 124/187 (66%), Gaps = 6/187 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSN---WFTPERKDMPAYNNTLTCN  313
            A S  LP +E++AL+ +A  + K +W+F V+PC+  S+   W          + +T+TCN
Sbjct  22   ASSQTLPKEEVDALRAVATALKKSNWNFNVDPCDLTSSEGGWRNLNATS-KQFADTVTCN  80

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS  + +CHV SI+L+ Q LQG LP     LPFL+ ID+SR+YL+G+IPPEW ++ L  I
Sbjct  81   CS--STVCHVTSIVLKAQSLQGSLPKEFAGLPFLQEIDLSRNYLNGSIPPEWGTLPLVNI  138

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NR+SGPIPK +GNITTL  L LE+N  +G +PPEL  L N+  ++L  NYLTG++P
Sbjct  139  SLLANRISGPIPKEIGNITTLKTLVLESNQISGNLPPELGNLQNIDKILLGTNYLTGDIP  198

Query  674  KELNSLT  694
               + LT
Sbjct  199  STFSKLT  205


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 5/112 (4%)
 Frame = +2

Query  350  IILQGQDLQGVLPPT---LVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            + +Q   L G +P T   LVKL  L+I D++        PP      L+ + +  + L+G
Sbjct  234  LAIQASGLVGPIPSTIGTLVKLTDLRISDLNGP--GSPFPPIQNMTSLKTLILRNSNLTG  291

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             +P YLG+ITTL  L+L  N  +G +P   + L N+ N+  + N L GE+P+
Sbjct  292  ELPAYLGSITTLKLLDLSFNKLSGPIPATYSNLWNVDNIYFTSNMLNGEVPR  343



>gb|AET00430.2| LRR receptor-like kinase [Medicago truncatula]
Length=1022

 Score =   171 bits (434),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 3/192 (2%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F + F  A +  L   E+ ALKEI +++GKKDWDF V+PC     W   + +    + + 
Sbjct  19   FISHFASAATLKLNTQEVKALKEIGNKIGKKDWDFGVDPCSGKGKWNVSDSR--KGFESA  76

Query  302  LTCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
            + CNCSF     CHV SI L+ Q+L G L P   KLP LKI+D+SR+ ++G+IP +WA M
Sbjct  77   VICNCSFNHNSSCHVVSIFLKAQNLSGTLSPEFSKLPHLKILDLSRNIITGSIPQQWAKM  136

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
             L  +S   NR SGP P  L NITTL  L++E N F+G +P ++ KL NL+ L+L  N  
Sbjct  137  NLVDLSFMGNRFSGPFPTVLTNITTLKNLSIEGNQFSGFIPEDIGKLINLEKLVLQSNRF  196

Query  659  TGELPKELNSLT  694
            TG LP   + LT
Sbjct  197  TGALPSAFSKLT  208



>emb|CDX93632.1| BnaA06g04160D [Brassica napus]
Length=1012

 Score =   171 bits (434),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 120/189 (63%), Gaps = 3/189 (2%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F+ R   + +  L   E+ ALKEI  ++GKKDWDF  +PC    +W          + + 
Sbjct  18   FHGRLGFSDNNKLHEAEVRALKEIGKKLGKKDWDFNKDPCSGQGSWVVTTYTS-KEFESN  76

Query  302  LTCNCSFPA--GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
            +TC+CSF      CHV  I L+ Q+L G++PP   KL  LK++D+SR+YL+G+IP EWAS
Sbjct  77   ITCDCSFLPLNSSCHVIRIALKSQNLTGIVPPEFSKLRHLKVLDLSRNYLTGSIPKEWAS  136

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
            M++E +S   NRLSGP PK L  +TTL  L+LE N+F+G +PPE+ ++ +L+ L L  N 
Sbjct  137  MRVEDLSFMGNRLSGPFPKVLTRLTTLRNLSLEGNLFSGQIPPEIKRMIHLERLHLPSNA  196

Query  656  LTGELPKEL  682
             TG LPKEL
Sbjct  197  FTGPLPKEL  205



>ref|XP_007213636.1| hypothetical protein PRUPE_ppa001834mg [Prunus persica]
 gb|EMJ14835.1| hypothetical protein PRUPE_ppa001834mg [Prunus persica]
Length=759

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 139/207 (67%), Gaps = 10/207 (5%)
 Frame = +2

Query  77   SASMFiilipiillSFNA-RFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNS  253
            S+S+F++L+ ++  SF++ RF E++   +P DE++AL+EI   +G K W F  + C+   
Sbjct  5    SSSLFVLLVTVLSCSFSSVRFAESK---VPQDEIDALQEITSTMGAKFWKFNGDSCKIEM  61

Query  254  NWFTPERKDMPAYNNT-LTCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDI  430
               T    D P  + T ++C+C+  + +CHV ++ L+   L G+LPP LVKLP+LK ID+
Sbjct  62   VGVTA---DPPKGSETGISCDCN--STVCHVVTLALKRYSLPGMLPPQLVKLPYLKEIDL  116

Query  431  SRSYLSGTIPPEWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPEL  610
            S +YL+GTIP EW +M+L  IS+ VNRLSG IPK LGNITTL YL LE N F+G VPPEL
Sbjct  117  SLNYLNGTIPGEWGAMQLTKISLLVNRLSGEIPKELGNITTLTYLTLEANQFSGVVPPEL  176

Query  611  AKLANLQNLILSGNYLTGELPKELNSL  691
              L NL  L+LS N LTG+LP  L  L
Sbjct  177  GNLINLGTLMLSSNRLTGKLPVALARL  203


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 65/145 (45%), Gaps = 29/145 (20%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVT  502
            + ++ +++L    L G LP  L +L  L    I+ +  +GTIP     W   KLE + + 
Sbjct  179  LINLGTLMLSSNRLTGKLPVALARLRNLTDFRINDNNFNGTIPDFIQNWE--KLERLEMH  236

Query  503  VNRLSGPIPK------------------------YLGNITTLVYLNLENNMFNGTVPPEL  610
             + L GPIP                          L N+T LV L L N   +G +PP +
Sbjct  237  ASGLQGPIPSNISLLSNLQELRISDIKGPQQGFPTLTNMTGLVRLVLRNCNISGEIPPYI  296

Query  611  AKLANLQNLILSGNYLTGELPKELN  685
              + NL+ L +S N L GE+P  +N
Sbjct  297  WTIQNLEMLDVSFNKLVGEVPDTIN  321



>ref|XP_003617471.1| BED finger-nbs resistance protein [Medicago truncatula]
Length=1039

 Score =   171 bits (434),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 3/192 (2%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT  301
            F + F  A +  L   E+ ALKEI +++GKKDWDF V+PC     W   + +    + + 
Sbjct  19   FISHFASAATLKLNTQEVKALKEIGNKIGKKDWDFGVDPCSGKGKWNVSDSR--KGFESA  76

Query  302  LTCNCSFPA-GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM  478
            + CNCSF     CHV SI L+ Q+L G L P   KLP LKI+D+SR+ ++G+IP +WA M
Sbjct  77   VICNCSFNHNSSCHVVSIFLKAQNLSGTLSPEFSKLPHLKILDLSRNIITGSIPQQWAKM  136

Query  479  KLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYL  658
             L  +S   NR SGP P  L NITTL  L++E N F+G +P ++ KL NL+ L+L  N  
Sbjct  137  NLVDLSFMGNRFSGPFPTVLTNITTLKNLSIEGNQFSGFIPEDIGKLINLEKLVLQSNRF  196

Query  659  TGELPKELNSLT  694
            TG LP   + LT
Sbjct  197  TGALPSAFSKLT  208



>gb|KJB57374.1| hypothetical protein B456_009G159800 [Gossypium raimondii]
Length=960

 Score =   171 bits (433),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 115/178 (65%), Gaps = 8/178 (4%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGIC  337
            LP DE+N L +IA  +G  +W+F    C +          D  A  N +TC C      C
Sbjct  30   LPQDEVNVLNQIAKTMGGNNWNFDAGSCVSEK-----VNTDTGAGKN-ITCTCQ--NDTC  81

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLS  517
            HV  I+ + Q L GVLP  LV LP+LK ID + +YL+GTIPPEWASM+LE+ISV  NRLS
Sbjct  82   HVTHIVFKLQSLPGVLPSELVNLPYLKEIDFAYNYLNGTIPPEWASMQLEFISVFGNRLS  141

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            G IP YLGNIT+L YL+LE N F+G VPPE+ KL NL+ L LS N LTG LP +L +L
Sbjct  142  GNIPTYLGNITSLTYLDLEANQFSGQVPPEIGKLVNLRTLRLSSNGLTGNLPVQLEAL  199



>gb|KJB57373.1| hypothetical protein B456_009G159800 [Gossypium raimondii]
Length=983

 Score =   171 bits (433),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 115/178 (65%), Gaps = 8/178 (4%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGIC  337
            LP DE+N L +IA  +G  +W+F    C +          D  A  N +TC C      C
Sbjct  30   LPQDEVNVLNQIAKTMGGNNWNFDAGSCVSEK-----VNTDTGAGKN-ITCTCQ--NDTC  81

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLS  517
            HV  I+ + Q L GVLP  LV LP+LK ID + +YL+GTIPPEWASM+LE+ISV  NRLS
Sbjct  82   HVTHIVFKLQSLPGVLPSELVNLPYLKEIDFAYNYLNGTIPPEWASMQLEFISVFGNRLS  141

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            G IP YLGNIT+L YL+LE N F+G VPPE+ KL NL+ L LS N LTG LP +L +L
Sbjct  142  GNIPTYLGNITSLTYLDLEANQFSGQVPPEIGKLVNLRTLRLSSNGLTGNLPVQLEAL  199



>ref|XP_009146321.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Brassica rapa]
Length=1020

 Score =   171 bits (433),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 126/187 (67%), Gaps = 7/187 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNS---NWFTPERKDMPAYNNTLTCN  313
            A S  L  DE++ L+ +A  + + +WDF V+PC+  S    W TP       + N +TCN
Sbjct  21   ASSQKLAKDEVDVLRAVAKGLHQNNWDFTVDPCDVASTVGGWRTPYTD--KNFENNVTCN  78

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS  + +CHV +I+++GQ+L G LP    +LPFL+ ID+SR++L+G+IPPEW ++ LE +
Sbjct  79   CS--SSVCHVTNIVVKGQNLNGSLPKEFAELPFLQEIDLSRNFLNGSIPPEWGALPLEKL  136

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NR++GPIPK +GNIT+L+ L LE N  +G +P EL  L+N+  ++LS NYL+G++P
Sbjct  137  SLLGNRITGPIPKEIGNITSLIILTLEFNQISGKLPSELGNLSNINRMLLSSNYLSGDIP  196

Query  674  KELNSLT  694
               + LT
Sbjct  197  STFSKLT  203


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 5/111 (5%)
 Frame = +2

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGT---IPPEWASMKLEYISVTVNRLSG  520
            +++Q   L G +P T+  L   K+ D+  S LSG     PP      LE +      L G
Sbjct  232  LVIQASGLAGPIPSTIGSLT--KLTDLRISDLSGPESPFPPLQNMKLLETLIFRNCNLPG  289

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +P YLG IT+L  L+L  N  +G VP     L+N+ N+  + N L+GE+P
Sbjct  290  ELPAYLGRITSLKLLDLSFNKLSGRVPVTYRALSNVDNIYFTSNMLSGEVP  340



>gb|KJB57375.1| hypothetical protein B456_009G159800 [Gossypium raimondii]
Length=984

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 115/178 (65%), Gaps = 8/178 (4%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAGIC  337
            LP DE+N L +IA  +G  +W+F    C +          D  A  N +TC C      C
Sbjct  30   LPQDEVNVLNQIAKTMGGNNWNFDAGSCVSEK-----VNTDTGAGKN-ITCTCQ--NDTC  81

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLS  517
            HV  I+ + Q L GVLP  LV LP+LK ID + +YL+GTIPPEWASM+LE+ISV  NRLS
Sbjct  82   HVTHIVFKLQSLPGVLPSELVNLPYLKEIDFAYNYLNGTIPPEWASMQLEFISVFGNRLS  141

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSL  691
            G IP YLGNIT+L YL+LE N F+G VPPE+ KL NL+ L LS N LTG LP +L +L
Sbjct  142  GNIPTYLGNITSLTYLDLEANQFSGQVPPEIGKLVNLRTLRLSSNGLTGNLPVQLEAL  199



>emb|CDX97606.1| BnaA05g24730D [Brassica napus]
Length=1020

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 126/187 (67%), Gaps = 7/187 (4%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNS---NWFTPERKDMPAYNNTLTCN  313
            A S  L  DE++ L+ +A  + + +WDF V+PC+  S    W TP       + N +TCN
Sbjct  21   ASSQKLAKDEVDVLRAVAKGLHQNNWDFTVDPCDVASTVGGWRTPYTD--KNFENNVTCN  78

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS  + +CHV +I+++GQ+L G LP    +LPFL+ ID+SR++L+G+IPPEW ++ LE +
Sbjct  79   CS--SSVCHVTNIVVKGQNLNGSLPKEFAELPFLQEIDLSRNFLNGSIPPEWGALPLEKL  136

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NR++GPIPK +GNIT+L+ L LE N  +G +P EL  L+N+  ++LS NYL+G++P
Sbjct  137  SLLGNRITGPIPKEIGNITSLIILTLEFNQISGKLPSELGNLSNINRMLLSSNYLSGDIP  196

Query  674  KELNSLT  694
               + LT
Sbjct  197  STFSKLT  203


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 5/111 (5%)
 Frame = +2

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGT---IPPEWASMKLEYISVTVNRLSG  520
            +++Q   L G +P T+  L   K+ D+  S LSG     PP      LE +      L G
Sbjct  232  LVIQASGLAGPIPSTIGSLT--KLTDLRISDLSGPESPFPPLQNMKLLETLIFRNCNLPG  289

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             +P YLG IT+L  L+L  N  +G VP     L+N+ N+  + N L+GE+P
Sbjct  290  ELPAYLGRITSLKLLDLSFNKLSGRVPVTYRALSNVDNIYFTSNMLSGEVP  340



>emb|CDX75791.1| BnaC03g38740D [Brassica napus]
Length=1015

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 125/187 (67%), Gaps = 6/187 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCE---NNSNWFTPERKDMPAYNNTLTCN  313
            A S  LP +E++AL+ +A  + K  W+F V+PC+   ++  W      +   + +T+TCN
Sbjct  22   ASSQTLPKEEVDALRALATALKKSSWNFNVDPCDLTSSDGGWRNLN-ANSKQFADTVTCN  80

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS  + +CHV SI+L+ Q LQG LP     LPFL+ ID+SR+YL+G+IPPEW ++ L  +
Sbjct  81   CS--STVCHVTSIVLKAQSLQGFLPKEFAGLPFLQEIDLSRNYLNGSIPPEWGTLPLVNL  138

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NR+SGPIPK +GNITTL  L LE+N  +G +PPEL  L N++ ++L  NYLTG++P
Sbjct  139  SLLANRISGPIPKEIGNITTLKTLTLESNQISGNLPPELGNLNNIEIILLGTNYLTGDIP  198

Query  674  KELNSLT  694
               + LT
Sbjct  199  STFSKLT  205


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPP---TLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVN  508
             +Q + +Q   L G +P    TLVKL  L+I D++    S   PP      +  + +  +
Sbjct  230  ELQKLTIQASGLVGPIPSAIGTLVKLTNLRISDLNGP--SSPFPPLQNMTLITSLILRNS  287

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             L+G +P YLG++TTL +L+L  N  +G +P   + L N+  +  + N L GE+P+
Sbjct  288  NLTGKLPDYLGSMTTLKHLDLSFNKLSGPIPETYSALWNVDFIYFTSNMLNGEVPR  343


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 9/124 (7%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVTVN  508
            +++ I+L    L G +P T  KL  L    IS +  +GTIP     W   +L+ +++  +
Sbjct  182  NIEIILLGTNYLTGDIPSTFSKLTTLTDFRISDNQFTGTIPDFIQNWT--ELQKLTIQAS  239

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNG-TVP-PELAKLANLQNLILSGNYLTGELPKEL  682
             L GPIP  +G +  L  L + +   NG + P P L  +  + +LIL  + LTG+LP  L
Sbjct  240  GLVGPIPSAIGTLVKLTNLRISD--LNGPSSPFPPLQNMTLITSLILRNSNLTGKLPDYL  297

Query  683  NSLT  694
             S+T
Sbjct  298  GSMT  301



>ref|XP_007132111.1| hypothetical protein PHAVU_011G067400g [Phaseolus vulgaris]
 gb|ESW04105.1| hypothetical protein PHAVU_011G067400g [Phaseolus vulgaris]
Length=992

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 120/180 (67%), Gaps = 3/180 (2%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-I  334
            LP DE+ ALK+I + +GKKDWDF V+PC    NW +  +  +    N + C+CSF    I
Sbjct  28   LPEDEVQALKDIGETLGKKDWDFSVDPCSGEHNWTSHTK--VRGTENNVICDCSFENDTI  85

Query  335  CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRL  514
            CHV +I+L+ Q+L+G LP  +V+LP+L+ ID+SR+YL+GTIP EW  + + +IS++ NRL
Sbjct  86   CHVTNILLKVQNLRGTLPVAMVRLPYLQEIDLSRNYLNGTIPLEWGLLNIVHISLSANRL  145

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            +G IP  L NI+TL  L LE N  +G +P EL  L ++Q L+L+ N  TGELP     +T
Sbjct  146  TGSIPPELANISTLQSLTLEFNQLSGNLPSELGNLPSIQRLLLTSNNFTGELPATFARIT  205


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (45%), Gaps = 30/139 (22%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP---EWASMKLEYISVTVNR  511
            +Q ++L   +  G LP T  ++  L+ + +  +  SG IP     W S  L+ + +    
Sbjct  183  IQRLLLTSNNFTGELPATFARITTLQEVRLGDNQFSGKIPDFIQSWTS--LQKLVIQGTG  240

Query  512  LSGPIPK-------------------------YLGNITTLVYLNLENNMFNGTVPPELAK  616
            LSGPIP                           L N++ L  L L +   NGT+P  L  
Sbjct  241  LSGPIPSGISLLESLTDLRISDIDGSDHFPFPQLNNLSNLEILILRSCNINGTIPEYLGT  300

Query  617  LANLQNLILSGNYLTGELP  673
            +++LQ L LS N L+G++P
Sbjct  301  MSSLQTLDLSFNKLSGQIP  319



>ref|XP_009351824.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X4 [Pyrus x bretschneideri]
Length=978

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFP-AGICHVQS  349
            ++AL+EIA  +G K W F  + C   +   T ++      N    C+C+F  + +CHV +
Sbjct  14   VDALQEIATTMGAKYWTFNADACRIETVGLTKKQPKGSQANTD--CDCNFENSTVCHVAT  71

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIP  529
            + L+G  L G+LPP LVKLP+L+ ID + +YLSGT P EWAS KL YISV VNRLSG IP
Sbjct  72   LTLKGYSLPGLLPPQLVKLPYLRKIDFAYNYLSGTTPQEWASTKLTYISVLVNRLSGQIP  131

Query  530  KYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLTI  697
            K LG ITTL +LNLE N F+G VP EL  L NLQ L+LS N LTG LP+  + L I
Sbjct  132  KDLGKITTLTFLNLEGNQFSGIVPTELGNLVNLQTLMLSSNQLTGYLPESFSGLRI  187


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (46%), Gaps = 27/145 (19%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS--MKLEYISVTV  505
            + ++Q+++L    L G LP +   L  LK   I+ +  SGT+P +W     KL  + +  
Sbjct  161  LVNLQTLMLSSNQLTGYLPESFSGLRILKDFRINDNNFSGTLP-DWVQNWKKLTRLEMHS  219

Query  506  NRLSGPIPK------------------------YLGNITTLVYLNLENNMFNGTVPPELA  613
            + L GPIP                          L N+T+LV L L N   +G +P  + 
Sbjct  220  SGLEGPIPSNISLLNNLEVLRISDTNGPYQEFPLLRNMTSLVRLVLRNCNISGEIPAYIW  279

Query  614  KLANLQNLILSGNYLTGELPKELNS  688
             + NL+ L +S N L G+LP  + +
Sbjct  280  SMKNLEMLDVSFNKLAGQLPSTIGA  304



>ref|XP_010064503.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=865

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 7/184 (4%)
 Frame = +2

Query  158  LPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG--  331
            LP +E++AL+EIAD +GK++WDF  +PC   S W   ++K      N + C+C+   G  
Sbjct  23   LPDNEVDALREIADALGKRNWDFETDPCNKTSTW--SDKKLPDDTTNDVNCSCTSIGGAD  80

Query  332  ---ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVT  502
               +CHV SI+L  Q L G LP  L +LPFL+  D++R++L+GTIP EW S KL  ISV 
Sbjct  81   NTTVCHVTSIVLNEQSLSGTLPHRLSRLPFLENFDVTRNFLNGTIPTEWGSTKLVNISVL  140

Query  503  VNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKEL  682
             NRL+GPIPK LGNI+TL  L +E N  +G +PPEL  L+ L  L LS N  TGELP   
Sbjct  141  GNRLTGPIPKELGNISTLFKLVVEINQLSGHLPPELGNLSQLHILHLSSNNFTGELPPRF  200

Query  683  NSLT  694
              LT
Sbjct  201  AELT  204


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 24/139 (17%)
 Frame = +2

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASM-KLEYISVTVNRLSGPI  526
            ++++   L G LPP L  L  L I+ +S +  +G +PP +A +  L+ + ++ N  +G I
Sbjct  161  LVVEINQLSGHLPPELGNLSQLHILHLSSNNFTGELPPRFAELTALQELRLSDNNFTGQI  220

Query  527  PKYLGNITTLVYLNLENNMFNGTVPPELAKLANL-----------------------QNL  637
            P ++ N T L  L ++ +   G +P  +  L NL                       + L
Sbjct  221  PDFIQNWTNLSRLAIQASGLQGPIPSGITLLKNLFHLSISDLKGPESPVPQLSSTIIERL  280

Query  638  ILSGNYLTGELPKELNSLT  694
            IL    LTGELP  L  +T
Sbjct  281  ILRSCNLTGELPGYLAGMT  299


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLS  517
            ++  + +Q   LQG +P  +  L  L  + IS      +  P+ +S  +E + +    L+
Sbjct  229  NLSRLAIQASGLQGPIPSGITLLKNLFHLSISDLKGPESPVPQLSSTIIERLILRSCNLT  288

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            G +P YL  +T L  L+L  N   G +P   + L  + ++ L+GN LTG +P
Sbjct  289  GELPGYLAGMTQLKILDLSFNKLIGEIPRNFSSLGKVDHIYLTGNQLTGAVP  340



>emb|CDP18745.1| unnamed protein product [Coffea canephora]
Length=1022

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = +2

Query  170  ELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSF-PAGICHVQ  346
            E+  LKEIA  +GK DWDF ++PC    NW  P    +    +++TC+CSF     CH+ 
Sbjct  36   EVLVLKEIAKGLGKTDWDFSIDPCSGKGNWSLPIL--VKGIESSVTCDCSFNKNSSCHIT  93

Query  347  SIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPI  526
             I L+ Q+L G +PP   KL +L  +D+SR+ L G+IPP+WASMKL  +S+  NRLSGP 
Sbjct  94   GIALKAQNLSGTVPPGFAKLQYLAHLDLSRNNLHGSIPPQWASMKLVELSLMGNRLSGPF  153

Query  527  PKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
            P  L  ITTLV +++E N+F+G +PPE+  L NLQ +ILS N  TGELP  L+ L+
Sbjct  154  PVALTRITTLVNVSIEGNLFSGHIPPEIGNLVNLQKIILSSNSFTGELPVALSKLS  209


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMK-LEYISVTVNRLS  517
            ++ +++QG  L+G +P ++  L  L  + IS     G+  P+ ++M+ ++ +++    + 
Sbjct  235  IEKLLMQGCYLEGPIPSSISALTKLTDLRISDLKGKGSPFPDLSNMESMKTLTLRQCSIY  294

Query  518  GPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            G IPKY+G++  L  L+L  N   G +P    +L+ +  + L+GN LTG +P
Sbjct  295  GEIPKYIGDMQKLKNLDLSFNNLTGEIPATFVQLSKVDFMYLTGNRLTGPIP  346


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS-MKLEYISVTVN  508
            + ++Q IIL      G LP  L KL  L  + +S +  +G IP    S  K+E + +   
Sbjct  184  LVNLQKIILSSNSFTGELPVALSKLSNLTDLRVSDNNFTGKIPDFIGSWKKIEKLLMQGC  243

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
             L GPIP  +  +T L  L + +    G+  P+L+ + +++ L L    + GE+PK +  
Sbjct  244  YLEGPIPSSISALTKLTDLRISDLKGKGSPFPDLSNMESMKTLTLRQCSIYGEIPKYIGD  303

Query  689  L  691
            +
Sbjct  304  M  304



>ref|XP_010502195.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Camelina sativa]
Length=1018

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 119/185 (64%), Gaps = 3/185 (2%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMP-AYNNTLTCNCS  319
            A S  L  +E+ ALK +A  + K +W+F V+PC+ +S+     + + P    + + CNCS
Sbjct  22   ASSATLAPEEVEALKSVATALKKTNWNFSVDPCDESSSDGGWRKLNQPKGAEDAVACNCS  81

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
              +G CHV +I L+GQDLQG LP  L  LPFL+ ID++R+YL+G+IPPEW S  L  I +
Sbjct  82   --SGTCHVTNITLKGQDLQGTLPTDLSGLPFLQEIDLTRNYLNGSIPPEWGSSSLISIQL  139

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NR++GPIPK L N+T L  L LE N  +G +PPEL  L NLQ L LS NYLTGE+P  
Sbjct  140  LGNRITGPIPKELANLTNLFSLVLEYNQLSGKLPPELGDLPNLQRLFLSSNYLTGEIPST  199

Query  680  LNSLT  694
               LT
Sbjct  200  FAKLT  204



>ref|XP_009351806.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Pyrus x bretschneideri]
Length=1011

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFP-AGICHVQS  349
            ++AL+EIA  +G K W F  + C   +   T ++      N    C+C+F  + +CHV +
Sbjct  47   VDALQEIATTMGAKYWTFNADACRIETVGLTKKQPKGSQANTD--CDCNFENSTVCHVAT  104

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIP  529
            + L+G  L G+LPP LVKLP+L+ ID + +YLSGT P EWAS KL YISV VNRLSG IP
Sbjct  105  LTLKGYSLPGLLPPQLVKLPYLRKIDFAYNYLSGTTPQEWASTKLTYISVLVNRLSGQIP  164

Query  530  KYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLTI  697
            K LG ITTL +LNLE N F+G VP EL  L NLQ L+LS N LTG LP+  + L I
Sbjct  165  KDLGKITTLTFLNLEGNQFSGIVPTELGNLVNLQTLMLSSNQLTGYLPESFSGLRI  220


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (46%), Gaps = 27/145 (19%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS--MKLEYISVTV  505
            + ++Q+++L    L G LP +   L  LK   I+ +  SGT+P +W     KL  + +  
Sbjct  194  LVNLQTLMLSSNQLTGYLPESFSGLRILKDFRINDNNFSGTLP-DWVQNWKKLTRLEMHS  252

Query  506  NRLSGPIPK------------------------YLGNITTLVYLNLENNMFNGTVPPELA  613
            + L GPIP                          L N+T+LV L L N   +G +P  + 
Sbjct  253  SGLEGPIPSNISLLNNLEVLRISDTNGPYQEFPLLRNMTSLVRLVLRNCNISGEIPAYIW  312

Query  614  KLANLQNLILSGNYLTGELPKELNS  688
             + NL+ L +S N L G+LP  + +
Sbjct  313  SMKNLEMLDVSFNKLAGQLPSTIGA  337



>ref|XP_009351800.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Pyrus x bretschneideri]
Length=1016

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFP-AGICHVQS  349
            ++AL+EIA  +G K W F  + C   +   T ++      N    C+C+F  + +CHV +
Sbjct  52   VDALQEIATTMGAKYWTFNADACRIETVGLTKKQPKGSQANTD--CDCNFENSTVCHVAT  109

Query  350  IILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGPIP  529
            + L+G  L G+LPP LVKLP+L+ ID + +YLSGT P EWAS KL YISV VNRLSG IP
Sbjct  110  LTLKGYSLPGLLPPQLVKLPYLRKIDFAYNYLSGTTPQEWASTKLTYISVLVNRLSGQIP  169

Query  530  KYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLTI  697
            K LG ITTL +LNLE N F+G VP EL  L NLQ L+LS N LTG LP+  + L I
Sbjct  170  KDLGKITTLTFLNLEGNQFSGIVPTELGNLVNLQTLMLSSNQLTGYLPESFSGLRI  225


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (46%), Gaps = 27/145 (19%)
 Frame = +2

Query  332  ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS--MKLEYISVTV  505
            + ++Q+++L    L G LP +   L  LK   I+ +  SGT+P +W     KL  + +  
Sbjct  199  LVNLQTLMLSSNQLTGYLPESFSGLRILKDFRINDNNFSGTLP-DWVQNWKKLTRLEMHS  257

Query  506  NRLSGPIPK------------------------YLGNITTLVYLNLENNMFNGTVPPELA  613
            + L GPIP                          L N+T+LV L L N   +G +P  + 
Sbjct  258  SGLEGPIPSNISLLNNLEVLRISDTNGPYQEFPLLRNMTSLVRLVLRNCNISGEIPAYIW  317

Query  614  KLANLQNLILSGNYLTGELPKELNS  688
             + NL+ L +S N L G+LP  + +
Sbjct  318  SMKNLEMLDVSFNKLAGQLPSTIGA  342



>ref|XP_008225249.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=167

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 95/143 (66%), Gaps = 23/143 (16%)
 Frame = +2

Query  137  LEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNC  316
            +EAQS  L   E+ ALKEIA +VGKKDW+F ++PC N++NW TP+  D+P YNNTL CNC
Sbjct  33   VEAQSLRLASAEVEALKEIATQVGKKDWNFSIDPCSNDTNWATPKSADLPLYNNTLICNC  92

Query  317  SFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYIS  496
            S+P G CHV SI L+GQDL GV+PP+  KLP+                       L  +S
Sbjct  93   SYPDGFCHVVSIFLKGQDLAGVVPPSAAKLPY-----------------------LTRVS  129

Query  497  VTVNRLSGPIPKYLGNITTLVYL  565
            +TVN LSGPIP YLGNI+T++Y+
Sbjct  130  ITVNNLSGPIPGYLGNISTIIYM  152



>ref|XP_008225244.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 [Prunus mume]
Length=1000

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 121/187 (65%), Gaps = 3/187 (2%)
 Frame = +2

Query  134  FLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCN  313
             LE     LP +E++AL++I   +G K W F  + C       T E+    A +NT  C 
Sbjct  20   LLELAESKLPQEEVDALQQITTTMGAKYWRFNNDACRIEMVGLT-EKPPRGAQSNT-DCE  77

Query  314  CSFPAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEY  490
            C F    +CHV  ++L+G  L G+LP  LVKLP+L+ ID + +YLSGTIPPEWAS KL Y
Sbjct  78   CYFENNTVCHVVKLVLKGYSLPGLLPLQLVKLPYLREIDFAYNYLSGTIPPEWASTKLTY  137

Query  491  ISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGEL  670
            ISV VNRLSG IPK LGNITTL YL+LE+N F+G +P EL  L NLQ L+LS N L+G L
Sbjct  138  ISVLVNRLSGQIPKELGNITTLTYLSLESNQFSGILPIELGNLINLQTLMLSSNQLSGNL  197

Query  671  PKELNSL  691
            P+  + +
Sbjct  198  PETFSGI  204



>ref|XP_007048780.1| Leucine-rich repeat transmembrane protein kinase isoform 1 [Theobroma 
cacao]
 gb|EOX92937.1| Leucine-rich repeat transmembrane protein kinase isoform 1 [Theobroma 
cacao]
Length=1029

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFP-AGICHV  343
            +E+ ALK I   +GKKDWDF V PC    NW   +  +   + + +TC+CSF     CHV
Sbjct  44   EEVKALKAIGKRLGKKDWDFGVEPCSGKGNWIV-QGDEETGFASNVTCSCSFNNYKTCHV  102

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
             SI+L   ++   LPP   K   LK++D+SR+Y +G+IP EWA+MKLE +S   NRLSGP
Sbjct  103  VSIVLTALNISATLPPEFSKFRHLKLLDLSRNYFTGSIPQEWATMKLEVLSFMGNRLSGP  162

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
             PK    IT+L  L++E N F+G +PP++ KL NLQ LILS N   GELP EL +L 
Sbjct  163  FPKVFTYITSLRNLSIEGNNFSGPIPPDIGKLINLQKLILSSNAFNGELPPELANLV  219


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 55/113 (49%), Gaps = 1/113 (1%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGT-IPPEWASMKLEYISVTVNRL  514
             +Q + +QG  L+G +P ++  L  L  + IS     G+  PP      L+ + +    +
Sbjct  244  QIQKLQIQGCSLEGPIPSSISALTSLSDLRISDLKGRGSPFPPLHNMDSLKTLILRNCLI  303

Query  515  SGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             G IP Y+G++  L  L++  N   G +P    KL     L L+GN LTG +P
Sbjct  304  YGEIPAYIGDMKKLKTLDISYNNLTGEIPGSFFKLTKTDFLYLTGNQLTGSVP  356



>ref|XP_004162114.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840-like 
[Cucumis sativus]
Length=579

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 4/178 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERK---DMPAYNNTLTCNCSF-PAGICH  340
            + ALKEI   +GK DW+F  +PC  +  W +   +   ++  + N LTC+C+F  A +CH
Sbjct  2    VEALKEIGKSLGKSDWNFSADPCNGSHGWISQPNQIPNNVAGFENNLTCDCTFLNATVCH  61

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            V SI+L+ Q LQG LPP LV+LPFL+ ID++R+YLSG IPPEW S  L  I +  NRL+G
Sbjct  62   VISIVLKSQSLQGTLPPHLVRLPFLQQIDLTRNYLSGQIPPEWGSTNLVSIYLLGNRLTG  121

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
             IP+ +GNITTL  L LE N  +G++P  L  L  +Q L L+ N  +GELP  L  LT
Sbjct  122  LIPEEIGNITTLENLVLEINQLSGSIPQALGNLPQIQRLHLTSNNFSGELPMSLGKLT  179



>ref|XP_010475530.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Camelina sativa]
 ref|XP_010475532.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Camelina sativa]
Length=1014

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 124/196 (63%), Gaps = 11/196 (6%)
 Frame = +2

Query  122  FNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNW----FTPERKDMPA  289
            F+ R   + +  L   E+ ALKEI  ++GKKDW+F  +PC    NW    FT +      
Sbjct  18   FHGRLGFSDNTKLHEAEVRALKEIGKKLGKKDWNFNKDPCSGEGNWVDTSFTTKE-----  72

Query  290  YNNTLTCNCSFPA--GICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPP  463
            + + LTC+CS+P     CHV  I L+ Q+L G++PP   KL  LK++D+SR+ L+G+IP 
Sbjct  73   FESNLTCDCSYPPPNSSCHVIRIALKSQNLSGIVPPEFSKLRHLKVLDLSRNSLTGSIPK  132

Query  464  EWASMKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLIL  643
            EWASM+LE +S   NRLSGP PK +  +TTL  L+LE N F+G +PPE+AKL +L+ L L
Sbjct  133  EWASMRLEDLSFMGNRLSGPFPKVITRLTTLRNLSLEGNQFSGPIPPEIAKLTHLEKLHL  192

Query  644  SGNYLTGELPKELNSL  691
              N  TG LP++L  L
Sbjct  193  PSNAFTGPLPEKLGLL  208



>gb|KEH19464.1| LRR receptor-like kinase [Medicago truncatula]
Length=727

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 115/175 (66%), Gaps = 3/175 (2%)
 Frame = +2

Query  167  DELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNTLTCNCSFPAG-ICHV  343
            DE+ ALK+I   +GKKDWDF V+PC   +NW +  +  +    N +TCNCSF    +CHV
Sbjct  31   DEVEALKDIGKTLGKKDWDFSVDPCSGRNNWISSTQ--LHGSENAVTCNCSFQNNTLCHV  88

Query  344  QSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSGP  523
             S++++ Q+L G LPP LV+LPFL+ ID++ +YL+GTIP +WA++KL  +S   NRLSGP
Sbjct  89   VSVVIKAQNLSGTLPPDLVRLPFLQEIDLTLNYLNGTIPKQWATLKLVNVSFYGNRLSGP  148

Query  524  IPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNS  688
            IPK  GNITTL  L L +N F G +P   AKL  L+   +  +  +G +P  + S
Sbjct  149  IPKEFGNITTLKSLLLSSNNFTGLLPATFAKLTALKQFRIGDSGFSGAIPNFIQS  203


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 74/148 (50%), Gaps = 2/148 (1%)
 Frame = +2

Query  257  WFTPERKDMPAYNNTLTCNCSFPAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDIS  433
            W T +  ++  Y N L+       G I  ++S++L   +  G+LP T  KL  LK   I 
Sbjct  130  WATLKLVNVSFYGNRLSGPIPKEFGNITTLKSLLLSSNNFTGLLPATFAKLTALKQFRIG  189

Query  434  RSYLSGTIPPEWAS-MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPEL  610
             S  SG IP    S + LE +++  + LSGPIP  +  +  L  L + +   + +  P+L
Sbjct  190  DSGFSGAIPNFIQSWINLEMLTIQGSGLSGPIPSGISLLKNLTDLTITDLNGSDSPFPQL  249

Query  611  AKLANLQNLILSGNYLTGELPKELNSLT  694
              ++NL  L+L    ++G LP+ L  LT
Sbjct  250  QNMSNLSKLVLRSCNISGALPEYLGKLT  277



>ref|XP_010053001.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Eucalyptus grandis]
Length=1034

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 118/193 (61%), Gaps = 9/193 (5%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPA--------YNN  298
            + S  L L E+ AL+EI  ++GK DW+F  +PC    NW   +  +             +
Sbjct  32   SDSATLHLTEVKALREIGRKLGKTDWNFEEDPCSGRDNWIKAQDDEDGVGGGGAKAGIES  91

Query  299  TLTCNCSFPAGI-CHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
             +TC+CSF     CHV +I L+ Q+L G +PP   +L +LK +D+SR+ L+GTIP EWAS
Sbjct  92   NVTCDCSFNDNTTCHVIAIALKAQNLTGTVPPEFSRLHYLKSLDLSRNCLTGTIPAEWAS  151

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
            M+LE  S+  NRLSGP PK L  IT+L  L +E N F+G +PPE+  L  LQ LILS N 
Sbjct  152  MRLEEFSLMGNRLSGPFPKALTRITSLRNLTIEGNRFSGPIPPEIGNLIKLQKLILSSNA  211

Query  656  LTGELPKELNSLT  694
             TGELP EL+ LT
Sbjct  212  FTGELPVELSKLT  224



>emb|CDX82465.1| BnaA03g33560D [Brassica napus]
Length=1015

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 123/187 (66%), Gaps = 6/187 (3%)
 Frame = +2

Query  143  AQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSN---WFTPERKDMPAYNNTLTCN  313
            A S  LP +E++AL+ +A  + K +W+F V+PC+  S+   W          + +T+TCN
Sbjct  22   ASSQTLPKEEVDALRAVATALKKSNWNFNVDPCDLTSSEGGWRNLNATS-KQFADTVTCN  80

Query  314  CSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYI  493
            CS  + +CHV SI+L+ Q LQG LP     LPFL+ ID+SR+YL+G+IPPEW ++ L  I
Sbjct  81   CS--STVCHVTSIVLKAQSLQGSLPKEFAGLPFLQEIDLSRNYLNGSIPPEWGTLPLVNI  138

Query  494  SVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            S+  NR+ GPIPK +GNITTL  L LE+N  +G +PPEL  L N+  ++L  NYLTG++P
Sbjct  139  SLLANRIRGPIPKEIGNITTLKTLVLESNQISGNLPPELGNLQNIDKILLGTNYLTGDIP  198

Query  674  KELNSLT  694
               + LT
Sbjct  199  STFSKLT  205


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 5/112 (4%)
 Frame = +2

Query  350  IILQGQDLQGVLPPT---LVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            + +Q   L G +P T   LVKL  L+I D++        PP      L+ + +  + L+G
Sbjct  234  LAIQASGLVGPIPSTIGTLVKLTDLRISDLNGP--GSPFPPIQNMTSLKTLILRNSNLTG  291

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPK  676
             +P YLG+ITTL  L+L  N  +G +P   + L N+ N+  + N L GE+P+
Sbjct  292  ELPAYLGSITTLKLLDLSFNKLSGPIPATYSNLWNVDNIYFTSNMLNGEVPR  343



>ref|XP_008225246.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Prunus mume]
Length=1010

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 9/189 (5%)
 Frame = +2

Query  128  ARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNNT-L  304
             RF+E++   +P DE++AL+EI   +G K W F  + C+      T    D P  + T +
Sbjct  23   VRFVESK---VPQDEIDALQEITSTMGAKFWKFNGDSCKIEMVGVTA---DPPKGSETGI  76

Query  305  TCNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKL  484
            +C+C+  + +CHV +++L+G  L G+LPP LVKLP+L+ ID++ +YL+GTIP EW +M+L
Sbjct  77   SCDCN--STVCHVVTLVLKGYSLPGMLPPQLVKLPYLEEIDLALNYLNGTIPGEWGAMQL  134

Query  485  EYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTG  664
              IS+ VNRLSG IPK LGNITTL YL LE N F+G VPPEL  L NL  L+LS N LTG
Sbjct  135  TKISLLVNRLSGEIPKELGNITTLTYLTLEANQFSGVVPPELGNLINLGTLMLSSNRLTG  194

Query  665  ELPKELNSL  691
            +LP  L  L
Sbjct  195  KLPVALARL  203



>ref|XP_007214198.1| hypothetical protein PRUPE_ppa022208mg [Prunus persica]
 gb|EMJ15397.1| hypothetical protein PRUPE_ppa022208mg [Prunus persica]
Length=326

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 117/183 (64%), Gaps = 5/183 (3%)
 Frame = +2

Query  155  HLPLDELNALKEIADEVGKKDWDFR--VNPCENNSNWFTPERKDMPAYNNTLTCNCSFP-  325
             LP DE+  L +IA  +GK  WDF    +PC N   W   +      +   +TCNCSF  
Sbjct  26   RLPRDEVQTLADIAKTLGKTKWDFSGDADPCNNQKPW--TDTNPAKGFEYGVTCNCSFAN  83

Query  326  AGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTV  505
            + +CH+ SI+++ QDL G LP  + +L +L+ ID++R+YLSGTIPPEW S+ L  IS+  
Sbjct  84   STVCHITSIVMKAQDLPGTLPKEMARLSYLEEIDLTRNYLSGTIPPEWGSLSLVNISLLG  143

Query  506  NRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELN  685
            NRL+GPIPK LG+ITTL  L++  N F+G +P EL  L  +++++L+ N  TGELP    
Sbjct  144  NRLTGPIPKELGDITTLKRLDISMNNFSGELPRELGNLTLIESMLLNSNNFTGELPDTFG  203

Query  686  SLT  694
            +LT
Sbjct  204  NLT  206


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 60/137 (44%), Gaps = 27/137 (20%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            ++S++L   +  G LP T   L  LK + I  S L+G IP    S+  +   + +  LSG
Sbjct  184  IESMLLNSNNFTGELPDTFGNLTTLKDLMIQASGLTGPIP-SGISLLTKLTDLRITDLSG  242

Query  521  P--------------------------IPKYLGNITTLVYLNLENNMFNGTVPPELAKLA  622
            P                          +P+YL N+  L  L+L  N   G +P     LA
Sbjct  243  PEAPFPPLENMEGMKTLILRSCNITGQLPQYLENMKNLKTLDLSFNKLTGEIPSRFVALA  302

Query  623  NLQNLILSGNYLTGELP  673
             ++ + L+GN LTG +P
Sbjct  303  EVKYIFLTGNLLTGPVP  319



>ref|XP_004146079.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cucumis sativus]
Length=984

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 116/178 (65%), Gaps = 4/178 (2%)
 Frame = +2

Query  173  LNALKEIADEVGKKDWDFRVNPCENNSNWFTPERK---DMPAYNNTLTCNCSF-PAGICH  340
            + ALKEI   +GK+DW+F  +PC  +  W +   +   ++  + N LTC+C+F  A +CH
Sbjct  2    VEALKEIGKSLGKRDWNFSADPCNGSHGWISQPNQIPNNVAGFENNLTCDCTFLNATVCH  61

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISVTVNRLSG  520
            V SI+L+ Q LQG LPP LV+LPFL+ ID++R+YLSG IPPEW S  L  I +  NRL+G
Sbjct  62   VISIVLKSQSLQGTLPPHLVRLPFLQQIDLTRNYLSGQIPPEWGSTNLVSIYLLGNRLTG  121

Query  521  PIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKELNSLT  694
             IP+ +GNITTL  L LE N  +G++P  L  L  +Q L L+ N  +GELP  L  LT
Sbjct  122  LIPEEIGNITTLENLVLEINQLSGSIPQALGNLPQIQRLHLTSNNFSGELPMSLGKLT  179



>ref|XP_006407040.1| hypothetical protein EUTSA_v10019958mg [Eutrema salsugineum]
 gb|ESQ48493.1| hypothetical protein EUTSA_v10019958mg [Eutrema salsugineum]
Length=1072

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 123/185 (66%), Gaps = 8/185 (4%)
 Frame = +2

Query  149  SGHLPLDELNALKEIADEVGKKDWDFRVNPCE---NNSNWFTPERKDMPAYNNTLTCNCS  319
            S  LP +E++AL+ +A  + K +W+F V+PC+   ++  W  P       + + +TCNCS
Sbjct  75   SQTLPKEEVDALRAVAKALKKTNWNFNVDPCDQTLSDGGWRNPNAGK--NFEDAVTCNCS  132

Query  320  FPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLEYISV  499
                +CHV SIIL+ Q LQG LP  LV LPFL+  D+SR+YL+G+IPPEW ++ L  +S+
Sbjct  133  ---TVCHVTSIILKSQSLQGSLPKELVGLPFLQEFDLSRNYLNGSIPPEWGALPLVNVSL  189

Query  500  TVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELPKE  679
              NR++GPIPK + NITTL  L LE N  +G +PPEL  L N+Q L+LS N+L+GE+P  
Sbjct  190  LGNRINGPIPKEIANITTLSSLVLEYNQISGELPPELGNLPNIQRLLLSSNFLSGEIPST  249

Query  680  LNSLT  694
             + LT
Sbjct  250  FSKLT  254


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 60/114 (53%), Gaps = 5/114 (4%)
 Frame = +2

Query  341  VQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGT---IPPEWASMKLEYISVTVNR  511
            ++ +++Q   L G +P T+   P   + D+  S LSG     PP      ++ + +    
Sbjct  280  LEKLVIQASGLVGPIPSTIS--PLRNLTDLRISDLSGPESPFPPLQNMTSMKNLVLRNCN  337

Query  512  LSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
            L+G +P YLG ITTL  L++  N  +G VP E + L+N+ N+  + N L G +P
Sbjct  338  LTGELPAYLGPITTLKLLDVSFNKLSGPVPVEYSALSNVDNIYFTSNMLNGSVP  391



>ref|XP_011002767.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
 ref|XP_011002768.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
 ref|XP_011002769.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=1007

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 121/193 (63%), Gaps = 3/193 (2%)
 Frame = +2

Query  119  SFNARFLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYNN  298
            +F+     + +  LP DE+ AL++IA  +GK +W+F  +PC     W  P    +    N
Sbjct  13   AFSLAAFASGATRLPDDEVEALRDIAKTIGKTNWNFSADPCGGQWGWVDP--NPVKGNEN  70

Query  299  TLTCNCSFPAG-ICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWAS  475
             ++CNC+F  G ICHV SI+L+ Q+L+G LP  L + P+L+ ID+SR+YL+GTIP EW +
Sbjct  71   AVSCNCTFSNGTICHVISIVLKTQNLEGSLPRDLGRFPYLQEIDLSRNYLNGTIPAEWGA  130

Query  476  MKLEYISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNY  655
              L  IS+  NRL+GPIPK +GNI+TL    +E N  +G +PP+L  L  ++ + LS N 
Sbjct  131  TPLATISIIGNRLTGPIPKEIGNISTLANFTVEFNQLSGVLPPQLGNLTRIEKMHLSSNN  190

Query  656  LTGELPKELNSLT  694
             TG+LP+    LT
Sbjct  191  FTGQLPETFEKLT  203


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 57/115 (50%), Gaps = 3/115 (3%)
 Frame = +2

Query  338  HVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGT---IPPEWASMKLEYISVTVN  508
            +++ +++QG  L G +P  +  L  +  + IS    +GT    PP     KL+ + +   
Sbjct  228  NLEKLVIQGSGLSGPIPSGIALLEMMADLRISDLQGNGTEAPFPPLTNMKKLKTLILRSC  287

Query  509  RLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGELP  673
             + GP+P ++G +  L  L+L  N   G +P   + L  +  + L+GN L G +P
Sbjct  288  NIIGPLPDFVGELPKLTTLDLSFNKLIGEIPSSYSGLRKVDYIYLTGNQLNGTVP  342



>gb|KJB66878.1| hypothetical protein B456_010G162800 [Gossypium raimondii]
Length=833

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 116/182 (64%), Gaps = 6/182 (3%)
 Frame = +2

Query  134  FLEAQSGHLPLDELNALKEIADEVGKKDWDFRVNPCENNSNWFTPERKDMPAYN--NTLT  307
             L      +P +E++AL+EI   +G   W F  + CE      T     +P  N  + ++
Sbjct  19   LLRYSESKVPEEEVDALEEITTAMGSTYWKFIGDSCEIEMVGVTL----VPPKNSEHEIS  74

Query  308  CNCSFPAGICHVQSIILQGQDLQGVLPPTLVKLPFLKIIDISRSYLSGTIPPEWASMKLE  487
            C C     +CHV  I ++G +L G+LPP LVKLP+L+ ID + +YL+GTIP EWASMKL 
Sbjct  75   CECEADGTVCHVVRIAIKGYNLPGILPPQLVKLPYLREIDFAYNYLNGTIPIEWASMKLT  134

Query  488  YISVTVNRLSGPIPKYLGNITTLVYLNLENNMFNGTVPPELAKLANLQNLILSGNYLTGE  667
             IS+ VNRLSG IPKYLGNITTL YL+LE N F+G VPPEL  L NL  L+LS N LTG 
Sbjct  135  SISLLVNRLSGEIPKYLGNITTLTYLSLEANQFSGPVPPELGNLVNLTTLMLSSNQLTGN  194

Query  668  LP  673
            LP
Sbjct  195  LP  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320