BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024F24

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010313689.1|  PREDICTED: uncharacterized protein LOC101260...  78.6    2e-15   Solanum lycopersicum
ref|XP_009594235.1|  PREDICTED: protein PAT1 homolog 1-like           80.1    3e-15   Nicotiana tomentosiformis
ref|XP_004251557.1|  PREDICTED: uncharacterized protein LOC101260...  78.6    6e-15   Solanum lycopersicum
ref|XP_009781689.1|  PREDICTED: uncharacterized protein LOC104230555  80.9    2e-14   Nicotiana sylvestris
ref|XP_006351984.1|  PREDICTED: protein PAT1 homolog 1-like           78.6    2e-14   Solanum tuberosum [potatoes]
ref|XP_004239250.1|  PREDICTED: uncharacterized protein LOC101257075  81.6    3e-14   Solanum lycopersicum
ref|XP_011100381.1|  PREDICTED: uncharacterized protein LOC105178578  80.5    7e-14   Sesamum indicum [beniseed]
ref|XP_006354416.1|  PREDICTED: uncharacterized protein LOC102594...  79.7    1e-13   Solanum tuberosum [potatoes]
ref|XP_009757677.1|  PREDICTED: uncharacterized protein LOC104210470  79.3    2e-13   Nicotiana sylvestris
ref|XP_009797313.1|  PREDICTED: protein PAT1 homolog 1-like           78.6    3e-13   Nicotiana sylvestris
ref|XP_009602223.1|  PREDICTED: uncharacterized protein LOC104097371  78.2    4e-13   Nicotiana tomentosiformis
ref|XP_009595696.1|  PREDICTED: protein PAT1 homolog 1-like           77.0    1e-12   Nicotiana tomentosiformis
gb|EYU42843.1|  hypothetical protein MIMGU_mgv1a001457mg              76.3    2e-12   Erythranthe guttata [common monkey flower]
ref|XP_007217055.1|  hypothetical protein PRUPE_ppa001180mg           72.8    2e-12   
ref|XP_011085449.1|  PREDICTED: protein PAT1 homolog 1-like           75.9    2e-12   Sesamum indicum [beniseed]
ref|XP_002264820.1|  PREDICTED: protein PAT1 homolog 1-like           75.5    3e-12   Vitis vinifera
emb|CBI34052.3|  unnamed protein product                              73.6    9e-12   Vitis vinifera
ref|XP_008229675.1|  PREDICTED: protein PAT1 homolog 1-like           72.0    4e-11   Prunus mume [ume]
ref|XP_010112872.1|  hypothetical protein L484_017708                 70.9    1e-10   
ref|XP_009377953.1|  PREDICTED: protein PAT1 homolog 1-like           70.5    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_009375341.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  70.1    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_008342293.1|  PREDICTED: protein PAT1 homolog 1-like           70.1    2e-10   
ref|XP_008378353.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.1    2e-10   
ref|XP_004165263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  69.7    2e-10   
ref|XP_008451848.1|  PREDICTED: uncharacterized protein LOC103493011  69.7    2e-10   Cucumis melo [Oriental melon]
ref|XP_004147742.1|  PREDICTED: uncharacterized protein LOC101213130  69.7    2e-10   Cucumis sativus [cucumbers]
ref|XP_010532520.1|  PREDICTED: uncharacterized protein LOC104808528  68.9    4e-10   Tarenaya hassleriana [spider flower]
gb|EPS66560.1|  hypothetical protein M569_08215                       68.6    5e-10   Genlisea aurea
ref|XP_010525174.1|  PREDICTED: uncharacterized protein LOC104803017  68.2    6e-10   Tarenaya hassleriana [spider flower]
ref|XP_009375342.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  68.2    6e-10   
emb|CDP16041.1|  unnamed protein product                              67.4    1e-09   Coffea canephora [robusta coffee]
ref|XP_002520595.1|  hypothetical protein RCOM_0673440                67.4    1e-09   Ricinus communis
ref|XP_004303935.1|  PREDICTED: protein PAT1 homolog 1                66.6    2e-09   Fragaria vesca subsp. vesca
ref|XP_007049005.1|  Topoisomerase II-associated protein PAT1, pu...  64.7    8e-09   
gb|KHG26425.1|  Protein PAT1                                          63.2    3e-08   Gossypium arboreum [tree cotton]
gb|KJB10632.1|  hypothetical protein B456_001G212600                  63.2    3e-08   Gossypium raimondii
gb|KJB08599.1|  hypothetical protein B456_001G092700                  62.0    6e-08   Gossypium raimondii
gb|KJB08598.1|  hypothetical protein B456_001G092700                  62.0    7e-08   Gossypium raimondii
gb|KJB42926.1|  hypothetical protein B456_007G174200                  62.0    7e-08   Gossypium raimondii
gb|KJB42927.1|  hypothetical protein B456_007G174200                  62.0    7e-08   Gossypium raimondii
dbj|BAB01945.1|  unnamed protein product                              62.0    7e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00849.1|  hypothetical protein                                 61.2    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188866.1|  Topoisomerase II-associated protein PAT1            61.2    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883351.1|  hypothetical protein ARALYDRAFT_479740           60.8    2e-07   
emb|CDY50269.1|  BnaAnng10330D                                        60.5    2e-07   Brassica napus [oilseed rape]
ref|XP_009147964.1|  PREDICTED: protein PAT1 homolog 1                60.5    2e-07   Brassica rapa
ref|XP_006373646.1|  hypothetical protein POPTR_0016s02130g           60.5    2e-07   
emb|CDY39512.1|  BnaA01g24760D                                        60.5    2e-07   Brassica napus [oilseed rape]
ref|XP_011008549.1|  PREDICTED: uncharacterized protein LOC105113895  60.5    2e-07   Populus euphratica
emb|CDY54867.1|  BnaC01g22630D                                        60.5    2e-07   Brassica napus [oilseed rape]
ref|XP_009108988.1|  PREDICTED: uncharacterized protein LOC103834...  60.1    3e-07   Brassica rapa
ref|XP_009108983.1|  PREDICTED: uncharacterized protein LOC103834...  60.1    3e-07   Brassica rapa
ref|XP_007133386.1|  hypothetical protein PHAVU_011G174900g           60.1    3e-07   Phaseolus vulgaris [French bean]
ref|XP_006414611.1|  hypothetical protein EUTSA_v10024461mg           60.1    3e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006481340.1|  PREDICTED: uncharacterized protein LOC102618...  60.1    3e-07   Citrus sinensis [apfelsine]
ref|XP_006481341.1|  PREDICTED: uncharacterized protein LOC102618...  59.7    3e-07   Citrus sinensis [apfelsine]
gb|KDP44628.1|  hypothetical protein JCGZ_22047                       59.7    3e-07   Jatropha curcas
ref|XP_010036063.1|  PREDICTED: protein PAT1 homolog 1-like           59.7    4e-07   Eucalyptus grandis [rose gum]
gb|KFK23118.1|  hypothetical protein AALP_AAs49591U000400             58.9    7e-07   Arabis alpina [alpine rockcress]
ref|XP_007049006.1|  Topoisomerase II-associated protein PAT1, pu...  58.9    7e-07   
ref|XP_002308825.2|  hypothetical protein POPTR_0006s02270g           58.2    1e-06   
ref|XP_011004464.1|  PREDICTED: uncharacterized protein LOC105110947  58.2    1e-06   Populus euphratica
ref|XP_010488248.1|  PREDICTED: uncharacterized protein LOC104766124  58.2    1e-06   Camelina sativa [gold-of-pleasure]
emb|CDY46332.1|  BnaC01g31660D                                        58.2    1e-06   Brassica napus [oilseed rape]
ref|XP_011036076.1|  PREDICTED: protein PAT1 homolog 1-like           58.2    1e-06   Populus euphratica
gb|KFK39518.1|  hypothetical protein AALP_AA3G254500                  57.8    1e-06   Arabis alpina [alpine rockcress]
ref|XP_010466506.1|  PREDICTED: uncharacterized protein LOC104746679  57.0    2e-06   Camelina sativa [gold-of-pleasure]
emb|CAB10277.1|  hypothetical protein                                 57.0    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297023.1|  hypothetical protein CARUB_v10013016mg           57.0    3e-06   Capsella rubella
ref|XP_010435003.1|  PREDICTED: protein PAT1 homolog 1-like           57.0    3e-06   Camelina sativa [gold-of-pleasure]
ref|NP_567452.2|  Topoisomerase II-associated protein PAT1            56.6    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406733.1|  PREDICTED: uncharacterized protein LOC103989...  56.6    4e-06   
ref|XP_009406732.1|  PREDICTED: uncharacterized protein LOC103989...  56.6    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006283146.1|  hypothetical protein CARUB_v10004170mg           56.6    4e-06   
ref|XP_010440363.1|  PREDICTED: protein PAT1 homolog 1-like           56.2    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010496132.1|  PREDICTED: protein PAT1 homolog 1-like           56.2    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006283147.1|  hypothetical protein CARUB_v10004170mg           56.2    4e-06   Capsella rubella
ref|NP_001044369.2|  Os01g0769000                                     56.2    5e-06   
gb|KHN16432.1|  hypothetical protein glysoja_046875                   56.2    5e-06   Glycine soja [wild soybean]
ref|XP_006597999.1|  PREDICTED: uncharacterized protein LOC100779...  56.2    6e-06   Glycine max [soybeans]
ref|XP_006406189.1|  hypothetical protein EUTSA_v10020108mg           56.2    6e-06   Eutrema salsugineum [saltwater cress]
ref|XP_006597998.1|  PREDICTED: uncharacterized protein LOC100779...  55.8    8e-06   Glycine max [soybeans]
ref|XP_010511200.1|  PREDICTED: uncharacterized protein LOC104787331  55.5    8e-06   
ref|XP_006597997.1|  PREDICTED: uncharacterized protein LOC100779...  55.5    8e-06   Glycine max [soybeans]
gb|EAZ23222.1|  hypothetical protein OsJ_06910                        55.5    9e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86044.1|  hypothetical protein OsI_07409                        55.5    9e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001046960.1|  Os02g0517300                                     55.5    1e-05   
gb|KHG07107.1|  Protein PAT1                                          54.7    2e-05   Gossypium arboreum [tree cotton]
ref|XP_002441360.1|  hypothetical protein SORBIDRAFT_09g025190        53.9    3e-05   Sorghum bicolor [broomcorn]
ref|XP_002868239.1|  hypothetical protein ARALYDRAFT_915331           53.5    4e-05   Arabidopsis lyrata subsp. lyrata
emb|CDY37402.1|  BnaC05g30280D                                        53.1    5e-05   Brassica napus [oilseed rape]
ref|XP_010923783.1|  PREDICTED: uncharacterized protein LOC105046771  52.8    8e-05   
ref|XP_006646364.1|  PREDICTED: uncharacterized protein LOC102701783  52.8    8e-05   Oryza brachyantha
ref|XP_010243929.1|  PREDICTED: protein PAT1 homolog 1-like           52.8    8e-05   Nelumbo nucifera [Indian lotus]
ref|XP_004514400.1|  PREDICTED: uncharacterized protein LOC101512706  52.8    8e-05   
ref|XP_003569904.1|  PREDICTED: uncharacterized protein LOC100838182  52.4    9e-05   Brachypodium distachyon [annual false brome]
ref|XP_010243919.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  52.0    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010243918.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  52.0    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009416760.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.6    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416762.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.6    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008649853.1|  PREDICTED: uncharacterized protein LOC103630586  51.6    2e-04   Zea mays [maize]
ref|XP_003568135.1|  PREDICTED: protein PAT1 homolog 1-like           51.6    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_010684289.1|  PREDICTED: uncharacterized protein LOC104898860  51.6    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004961543.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.2    2e-04   Setaria italica
ref|XP_004961544.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.2    2e-04   Setaria italica
ref|XP_009416761.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.2    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT17005.1|  Lipoyl synthase, mitochondrial                        50.8    3e-04   
gb|KDP25122.1|  hypothetical protein JCGZ_22657                       50.8    3e-04   Jatropha curcas
ref|XP_006648671.1|  PREDICTED: uncharacterized protein LOC102700029  50.4    5e-04   Oryza brachyantha
emb|CDP13609.1|  unnamed protein product                              50.4    5e-04   Coffea canephora [robusta coffee]
ref|XP_010926894.1|  PREDICTED: protein PAT1 homolog 1 isoform X1     49.7    8e-04   Elaeis guineensis
ref|XP_010926895.1|  PREDICTED: protein PAT1 homolog 1 isoform X2     49.7    0.001   
ref|XP_002456407.1|  hypothetical protein SORBIDRAFT_03g035750        49.3    0.001   Sorghum bicolor [broomcorn]
ref|XP_010907163.1|  PREDICTED: uncharacterized protein LOC105033889  49.3    0.001   Elaeis guineensis



>ref|XP_010313689.1| PREDICTED: uncharacterized protein LOC101260608 isoform X1 [Solanum 
lycopersicum]
Length=818

 Score = 78.6 bits (192),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR VAGPRHPG+IGDRGSGSFSRESS  A+WAK+ D PD  DQH SDTECY
Sbjct  91   ATTFSKLNRNVAGPRHPGIIGDRGSGSFSRESSLAAEWAKETDFPDCFDQHLSDTECY  148


 Score = 30.4 bits (67),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 39/62 (63%), Gaps = 7/62 (11%)
 Frame = +2

Query  227  ADSGVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLF  406
            AD+ +F+ASQYAFFGRDI EE+ELGGLE          +    A   G GD   HEYHLF
Sbjct  21   ADNALFDASQYAFFGRDIGEEVELGGLE-------EEGNNCVPAVDGGFGDVDTHEYHLF  73

Query  407  EK  412
            EK
Sbjct  74   EK  75



>ref|XP_009594235.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
 ref|XP_009594236.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=822

 Score = 80.1 bits (196),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR V GPRHPGVIGDRGSGSFSRESSS A+WAK+AD  DW DQH SDTECY
Sbjct  91   ATTFSKLNRNVIGPRHPGVIGDRGSGSFSRESSSAAEWAKEADFHDWFDQHLSDTECY  148


 Score = 28.1 bits (61),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 7/59 (12%)
 Frame = +2

Query  236  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEK  412
             +F+ASQYAFFGRDI+EE+ELGGLEDE+   D +          G GDD +HEYHLFEK
Sbjct  24   ALFDASQYAFFGRDISEEVELGGLEDEQENNDLAVG-------GGLGDDEIHEYHLFEK  75



>ref|XP_004251557.1| PREDICTED: uncharacterized protein LOC101260608 isoform X2 [Solanum 
lycopersicum]
Length=817

 Score = 78.6 bits (192),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR VAGPRHPG+IGDRGSGSFSRESS  A+WAK+ D PD  DQH SDTECY
Sbjct  90   ATTFSKLNRNVAGPRHPGIIGDRGSGSFSRESSLAAEWAKETDFPDCFDQHLSDTECY  147


 Score = 28.9 bits (63),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 7/61 (11%)
 Frame = +2

Query  230  DSGVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFE  409
            D+ +F+ASQYAFFGRDI EE+ELGGLE          +    A   G GD   HEYHLFE
Sbjct  21   DNALFDASQYAFFGRDIGEEVELGGLE-------EEGNNCVPAVDGGFGDVDTHEYHLFE  73

Query  410  K  412
            K
Sbjct  74   K  74



>ref|XP_009781689.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
 ref|XP_009781690.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
Length=814

 Score = 80.9 bits (198),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR V GPRHPGVIGDRGSGSFSRESSS A+WAK+AD  DW DQH SDTECY
Sbjct  91   ATTFSKLNRNVTGPRHPGVIGDRGSGSFSRESSSAAEWAKEADFHDWFDQHLSDTECY  148


 Score = 24.6 bits (52),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 40/59 (68%), Gaps = 7/59 (12%)
 Frame = +2

Query  236  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEK  412
             +F+ASQYAFFG DIAEE+EL GLEDE+   D          G G GDD +HEYHLFEK
Sbjct  24   ALFDASQYAFFGLDIAEEVELSGLEDEQENNDL-------VVGGGLGDDEIHEYHLFEK  75



>ref|XP_006351984.1| PREDICTED: protein PAT1 homolog 1-like [Solanum tuberosum]
Length=816

 Score = 78.6 bits (192),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR VAGPRHPG+IGDRGSGSFSRESSS A+WAK+ D PD  DQH SDTECY
Sbjct  89   ATTFSKLNRNVAGPRHPGIIGDRGSGSFSRESSSAAEWAKETDFPDCFDQHLSDTECY  146


 Score = 26.9 bits (58),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 33/59 (56%), Gaps = 8/59 (14%)
 Frame = +2

Query  236  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEK  412
             +F+ASQYAFFGRD  EE+ELGGL               V    GG  D  HEYHLFEK
Sbjct  23   ALFDASQYAFFGRDSGEEVELGGL--------EEEGNNCVPVVDGGFGDDTHEYHLFEK  73



>ref|XP_004239250.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321026.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321027.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321028.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
Length=820

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR V GPRHPGVIGDRGSGSFSRESSS ADWAK+AD  DW DQH SDTECY
Sbjct  90   ATTFSKLNRNVTGPRHPGVIGDRGSGSFSRESSSAADWAKEADFHDWFDQHLSDTECY  147



>ref|XP_011100381.1| PREDICTED: uncharacterized protein LOC105178578 [Sesamum indicum]
Length=815

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNRVV+GPRHPGVIGDRGSGSFSRESSS  +WA++AD PDW D H SD+ECY
Sbjct  91   ATTFAKLNRVVSGPRHPGVIGDRGSGSFSRESSSATEWAREADFPDWPDHHMSDSECY  148



>ref|XP_006354416.1| PREDICTED: uncharacterized protein LOC102594467 isoform X1 [Solanum 
tuberosum]
 ref|XP_006354417.1| PREDICTED: uncharacterized protein LOC102594467 isoform X2 [Solanum 
tuberosum]
Length=821

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR V GPRHPGVIGDRGSGSFSRESSS A+WAK+AD  DW DQH SDTECY
Sbjct  90   ATTFSKLNRNVTGPRHPGVIGDRGSGSFSRESSSAAEWAKEADFHDWFDQHLSDTECY  147



>ref|XP_009757677.1| PREDICTED: uncharacterized protein LOC104210470 [Nicotiana sylvestris]
Length=814

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR V GPRHPGVIGDRGSGSFSRESSS A+W K+AD PDW DQ+ SD+ECY
Sbjct  86   ATTFSKLNRNVTGPRHPGVIGDRGSGSFSRESSSAAEWTKEADFPDWFDQNLSDSECY  143



>ref|XP_009797313.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana sylvestris]
Length=817

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR V GPRHPGVIGDRGSGSFSRESSS A+WAK+ D  DW DQH SDTECY
Sbjct  90   ATTFSKLNRNVTGPRHPGVIGDRGSGSFSRESSSAAEWAKETDFTDWFDQHLSDTECY  147



>ref|XP_009602223.1| PREDICTED: uncharacterized protein LOC104097371 [Nicotiana tomentosiformis]
Length=814

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR V GPRHPGVIGDRGSGSFSRESSS A+W K++D PDW DQ+ SD+ECY
Sbjct  86   ATTFSKLNRNVTGPRHPGVIGDRGSGSFSRESSSAAEWTKESDFPDWFDQNLSDSECY  143



>ref|XP_009595696.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=817

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNR V GPRHPGVIGDRGSGSFSRESSS A+W K+ D  DW DQH SDTECY
Sbjct  90   ATTFSKLNRNVTGPRHPGVIGDRGSGSFSRESSSAAEWEKETDFTDWFDQHLSDTECY  147



>gb|EYU42843.1| hypothetical protein MIMGU_mgv1a001457mg [Erythranthe guttata]
Length=816

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLN+VV GPRHPGVIGDRGSGSFSRESSS  +WA++AD PDW + H SD+ECY
Sbjct  91   ATTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSATEWAREADCPDWHEHHMSDSECY  148



>ref|XP_007217055.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
 gb|EMJ18254.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
Length=886

 Score = 72.8 bits (177),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS ADWA+D D  +WLDQH  DTE
Sbjct  162  ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSAADWAQDGDFSNWLDQHMFDTE  217


 Score = 26.2 bits (56),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 27/70 (39%), Gaps = 13/70 (19%)
 Frame = +2

Query  215  VGFGADSGVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHE  394
            V F  D+ +F+ASQY FFG+             + V E                    +E
Sbjct  94   VFFIRDNKLFDASQYEFFGQ-------------KSVEEVELGGLEDEEDRKPLFGPVDNE  140

Query  395  YHLFEKKRDL  424
            YHLFEK   L
Sbjct  141  YHLFEKDEGL  150



>ref|XP_011085449.1| PREDICTED: protein PAT1 homolog 1-like [Sesamum indicum]
Length=812

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLN+VV+GPRHPGVIGDRGSGSFSRESSS   W ++AD PDW DQH SD+E Y
Sbjct  88   ATTFAKLNKVVSGPRHPGVIGDRGSGSFSRESSSATQWTREADFPDWFDQHISDSEYY  145



>ref|XP_002264820.1| PREDICTED: protein PAT1 homolog 1-like [Vitis vinifera]
Length=812

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTEC  627
            A+TF KLNRVV GPR+PGVIGDRGSGSFSRESSS ADWA+D D P+WLDQH  D EC
Sbjct  81   ASTFSKLNRVVTGPRNPGVIGDRGSGSFSRESSSAADWAQDTDFPNWLDQHMFDAEC  137



>emb|CBI34052.3| unnamed protein product [Vitis vinifera]
Length=513

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTEC  627
            A+TF KLNRVV GPR+PGVIGDRGSGSFSRESSS ADWA+D D P+WLDQH  D EC
Sbjct  81   ASTFSKLNRVVTGPRNPGVIGDRGSGSFSRESSSAADWAQDTDFPNWLDQHMFDAEC  137



>ref|XP_008229675.1| PREDICTED: protein PAT1 homolog 1-like [Prunus mume]
Length=808

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS ADWA+D D  +WLDQH  DTE
Sbjct  84   ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSAADWAQDGDFSNWLDQHMFDTE  139



>ref|XP_010112872.1| hypothetical protein L484_017708 [Morus notabilis]
 gb|EXC35007.1| hypothetical protein L484_017708 [Morus notabilis]
Length=812

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS ADW +DAD  +WLDQH  DT+
Sbjct  92   ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSAADWVQDADFSNWLDQHMFDTD  147



>ref|XP_009377953.1| PREDICTED: protein PAT1 homolog 1-like [Pyrus x bretschneideri]
Length=817

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  94   ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  149



>ref|XP_009375341.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=804

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  82   ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  137



>ref|XP_008342293.1| PREDICTED: protein PAT1 homolog 1-like [Malus domestica]
Length=803

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  82   ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  137



>ref|XP_008378353.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103441447 
[Malus domestica]
Length=804

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  82   ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  137



>ref|XP_004165263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228647, 
partial [Cucumis sativus]
Length=742

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTEC  627
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS  DWA+D D  +WL+QH  D EC
Sbjct  14   ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDGDFCNWLEQHVFDPEC  70



>ref|XP_008451848.1| PREDICTED: uncharacterized protein LOC103493011 [Cucumis melo]
Length=808

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTEC  627
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS  DWA+D D  +WL+QH  D EC
Sbjct  80   ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDGDFCNWLEQHVFDPEC  136



>ref|XP_004147742.1| PREDICTED: uncharacterized protein LOC101213130 [Cucumis sativus]
 gb|KGN53503.1| hypothetical protein Csa_4G062390 [Cucumis sativus]
Length=808

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTEC  627
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS  DWA+D D  +WL+QH  D EC
Sbjct  80   ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDGDFCNWLEQHVFDPEC  136



>ref|XP_010532520.1| PREDICTED: uncharacterized protein LOC104808528 [Tarenaya hassleriana]
Length=785

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW +DA+L  WLDQH  D +
Sbjct  82   ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTQDAELSSWLDQHMLDVQ  137



>gb|EPS66560.1| hypothetical protein M569_08215, partial [Genlisea aurea]
Length=772

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF K+NR V+GPRHPGVIGDR SGSFSRESSS  DWA++AD PDWLD    D + Y
Sbjct  71   ATTFAKINRDVSGPRHPGVIGDRASGSFSRESSSATDWAREADYPDWLDHQLPDFDIY  128



>ref|XP_010525174.1| PREDICTED: uncharacterized protein LOC104803017 [Tarenaya hassleriana]
Length=784

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW +DA+L  WLDQH  D +
Sbjct  82   ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTQDAELSSWLDQHMLDEQ  137



>ref|XP_009375342.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=801

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN+VV GPRHPGVIGD         S  T DWA+D D  +WLDQH  DTE
Sbjct  82   ASTFAKLNKVVTGPRHPGVIGD---RGSGSFSRETTDWAQDGDFNNWLDQHMFDTE  134



>emb|CDP16041.1| unnamed protein product [Coffea canephora]
Length=958

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            ATTF KLNRVV GPRHPGVIGDRGSGSFSRESSS A+W +++D P+W D H SD+E Y
Sbjct  102  ATTFSKLNRVVTGPRHPGVIGDRGSGSFSRESSSAAEWVQESDFPEWRD-HMSDSEFY  158



>ref|XP_002520595.1| hypothetical protein RCOM_0673440 [Ricinus communis]
 gb|EEF41828.1| hypothetical protein RCOM_0673440 [Ricinus communis]
Length=739

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            ATTF KLNRVV GPRHPGVIGDRGSGSFSRESSS  DWA+D +L  WLDQ   D E
Sbjct  17   ATTFAKLNRVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDEELASWLDQQMFDIE  72



>ref|XP_004303935.1| PREDICTED: protein PAT1 homolog 1 [Fragaria vesca subsp. vesca]
Length=806

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            ATTF KLN+VV GPRHPGVIGDRGSGSFSRESSS  DWA+D D   WLDQ   DT+
Sbjct  85   ATTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDGDFGSWLDQQMFDTD  140



>ref|XP_007049005.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
 gb|EOX93162.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
Length=798

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNRVV GPR+PGVIGD  SGSFSRESSSTADWA+D +  +WLDQH  D E
Sbjct  82   ASTFAKLNRVVTGPRNPGVIGD-RSGSFSRESSSTADWAQDGEYVNWLDQHMFDAE  136



>gb|KHG26425.1| Protein PAT1 [Gossypium arboreum]
Length=795

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNRVV GPRHPGVIGDR        SS+T DWA D +  +W+DQH  +TE
Sbjct  82   ASTFAKLNRVVTGPRHPGVIGDRSCSFSRESSSAT-DWAVDGEHLNWMDQHMFETE  136



>gb|KJB10632.1| hypothetical protein B456_001G212600 [Gossypium raimondii]
Length=796

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNRVV GPRHPGVIGDR        SS+T DWA D +  +W+DQH  +TE
Sbjct  82   ASTFAKLNRVVTGPRHPGVIGDRSGSFSRESSSAT-DWAVDGEHLNWMDQHMFETE  136



>gb|KJB08599.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=792

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNRVV GPR+PGVIGD  SGSFSRESSS ADW++D D  +W+DQH  D E
Sbjct  82   ASTFAKLNRVVTGPRNPGVIGD-RSGSFSRESSSAADWSQDGDYLNWMDQHMFDVE  136



>gb|KJB08598.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=810

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNRVV GPR+PGVIGD  SGSFSRESSS ADW++D D  +W+DQH  D E
Sbjct  82   ASTFAKLNRVVTGPRNPGVIGD-RSGSFSRESSSAADWSQDGDYLNWMDQHMFDVE  136



>gb|KJB42926.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=776

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            ATTF KLNRVV GPR+PGVIGD  SGSFSRESSS ADWA+D +  +W+DQH  D +
Sbjct  83   ATTFAKLNRVVTGPRNPGVIGD-RSGSFSRESSSAADWAQDGEYVNWMDQHLFDAD  137



>gb|KJB42927.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=797

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            ATTF KLNRVV GPR+PGVIGD  SGSFSRESSS ADWA+D +  +W+DQH  D +
Sbjct  83   ATTFAKLNRVVTGPRNPGVIGD-RSGSFSRESSSAADWAQDGEYVNWMDQHLFDAD  137



>dbj|BAB01945.1| unnamed protein product [Arabidopsis thaliana]
Length=703

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  5    ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTQDAELTSWLDEQ  55



>dbj|BAF00849.1| hypothetical protein [Arabidopsis thaliana]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  84   ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTQDAELTSWLDEQ  134



>ref|NP_188866.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AEE76616.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  84   ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTQDAELTSWLDEQ  134



>ref|XP_002883351.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59610.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
Length=782

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW  DA+L  WLD+ 
Sbjct  84   ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTHDAELTSWLDEQ  134



>emb|CDY50269.1| BnaAnng10330D [Brassica napus]
Length=768

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNRVV+GP+HPGVIGDRGSGSFSRESSS  DW +D +   WLDQ 
Sbjct  85   ATTFAKLNRVVSGPKHPGVIGDRGSGSFSRESSSATDWTQDNEFTSWLDQQ  135



>ref|XP_009147964.1| PREDICTED: protein PAT1 homolog 1 [Brassica rapa]
Length=768

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNRVV+GP+HPGVIGDRGSGSFSRESSS  DW +D +   WLDQ 
Sbjct  85   ATTFAKLNRVVSGPKHPGVIGDRGSGSFSRESSSATDWTQDNEFTSWLDQQ  135



>ref|XP_006373646.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
 gb|ERP51443.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
Length=788

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNRVV GPR+PGVIGDRGSGSFSRESSS  DWA+D +   WLDQ   + E
Sbjct  79   ASTFAKLNRVVTGPRNPGVIGDRGSGSFSRESSSATDWAQDGEFTSWLDQQMFNAE  134



>emb|CDY39512.1| BnaA01g24760D [Brassica napus]
Length=774

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQ  606
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW  DA+L  WLD+
Sbjct  87   ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTHDAELTSWLDE  136



>ref|XP_011008549.1| PREDICTED: uncharacterized protein LOC105113895 [Populus euphratica]
Length=788

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNRVV GPR+PGVIGDRGSGSFSRESSS  DWA+D +   WLDQ   + E
Sbjct  79   ASTFAKLNRVVTGPRNPGVIGDRGSGSFSRESSSATDWAQDGEFTSWLDQQMLNAE  134



>emb|CDY54867.1| BnaC01g22630D [Brassica napus]
Length=764

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNRVV+GP+HPGVIGDRGSGSFSRESSS  DW +D +   WLDQ 
Sbjct  86   ATTFAKLNRVVSGPKHPGVIGDRGSGSFSRESSSATDWTQDNEFTSWLDQQ  136



>ref|XP_009108988.1| PREDICTED: uncharacterized protein LOC103834665 isoform X2 [Brassica 
rapa]
Length=773

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQ  606
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW  DA+L  WLD+
Sbjct  86   ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTHDAELTSWLDE  135



>ref|XP_009108983.1| PREDICTED: uncharacterized protein LOC103834665 isoform X1 [Brassica 
rapa]
Length=774

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQ  606
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW  DA+L  WLD+
Sbjct  87   ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTHDAELTSWLDE  136



>ref|XP_007133386.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
 gb|ESW05380.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
Length=882

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = +1

Query  400  FI*KEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKD  579
            F+ KEE   + SLSD+DDL TTFLKLN+VV GPR PGVIG+      SRE+SS ++W++ 
Sbjct  68   FLNKEEAEDIRSLSDIDDLTTTFLKLNKVVTGPRSPGVIGE----RGSRENSSASEWSQR  123

Query  580  ADLPDWLDQHFSDTE  624
             D+P W DQH  D+E
Sbjct  124  DDIPYWFDQHSYDSE  138



>ref|XP_006414611.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 ref|XP_006414612.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56064.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56065.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
Length=784

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            ATTF KLNRVV GP+HPGVIG RGSGSFSRESS+  DW +D +   WLDQH  + +
Sbjct  82   ATTFAKLNRVVTGPKHPGVIGVRGSGSFSRESSTATDWTQDNEFTSWLDQHMLEEQ  137



>ref|XP_006481340.1| PREDICTED: uncharacterized protein LOC102618153 isoform X1 [Citrus 
sinensis]
Length=793

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            TTF KLNRVV GPR+PGVIGDR        S++T DWA+D +  +WLDQ   D E
Sbjct  84   TTFAKLNRVVTGPRNPGVIGDRSGSFSRESSTAT-DWAQDGEFGNWLDQQMLDLE  137



>ref|XP_006481341.1| PREDICTED: uncharacterized protein LOC102618153 isoform X2 [Citrus 
sinensis]
Length=768

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            TTF KLNRVV GPR+PGVIGDR        S++T DWA+D +  +WLDQ   D E
Sbjct  84   TTFAKLNRVVTGPRNPGVIGDRSGSFSRESSTAT-DWAQDGEFGNWLDQQMLDLE  137



>gb|KDP44628.1| hypothetical protein JCGZ_22047 [Jatropha curcas]
Length=737

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNRVV GPR+ GVIGDRGSGSFSRESSS  DWA+D D   WLDQ   D E
Sbjct  24   ASTFAKLNRVVTGPRNVGVIGDRGSGSFSRESSSATDWAQDEDFSSWLDQQMFDIE  79



>ref|XP_010036063.1| PREDICTED: protein PAT1 homolog 1-like [Eucalyptus grandis]
 gb|KCW47590.1| hypothetical protein EUGRSUZ_K01336 [Eucalyptus grandis]
Length=806

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            ATTF KLNRVV GPR+PGVIGDRGSGSFSRESSS  DWA+D D   W D +  D E
Sbjct  80   ATTFAKLNRVVTGPRNPGVIGDRGSGSFSRESSSATDWAQDGDFSTWPDPYSFDAE  135



>gb|KFK23118.1| hypothetical protein AALP_AAs49591U000400 [Arabis alpina]
Length=788

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            ATTF KLNRVV GP+H GVIGDRGSGSFSRESSS  DW +D +   WLDQH  + +
Sbjct  86   ATTFAKLNRVVTGPKHLGVIGDRGSGSFSRESSSATDWTQDNEFTSWLDQHMIEEQ  141



>ref|XP_007049006.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
 gb|EOX93163.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
Length=724

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +1

Query  472  KLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            KLNRVV GPR+PGVIGD  SGSFSRESSSTADWA+D +  +WLDQH  D E
Sbjct  13   KLNRVVTGPRNPGVIGD-RSGSFSRESSSTADWAQDGEYVNWLDQHMFDAE  62



>ref|XP_002308825.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
 gb|EEE92348.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
Length=789

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            A+TF KLNRVV GPR+PGVIGDRGSGSFSRESSS  DWA+D +   WLDQ 
Sbjct  79   ASTFAKLNRVVTGPRNPGVIGDRGSGSFSRESSSATDWAQDGEFAGWLDQQ  129



>ref|XP_011004464.1| PREDICTED: uncharacterized protein LOC105110947 [Populus euphratica]
Length=789

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            A+TF KLNRVV GPR+PGVIGDRGSGSFSRESSS  DWA+D +   WLDQ 
Sbjct  79   ASTFAKLNRVVTGPRNPGVIGDRGSGSFSRESSSATDWAQDGEFAGWLDQQ  129



>ref|XP_010488248.1| PREDICTED: uncharacterized protein LOC104766124 [Camelina sativa]
Length=784

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF K+NR V GP+HPGVIGDRGSGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  84   ATTFAKINRNVTGPKHPGVIGDRGSGSFSRESSSATDWTQDAELTSWLDEQ  134



>emb|CDY46332.1| BnaC01g31660D [Brassica napus]
Length=774

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW  D +L  WLD+ 
Sbjct  87   ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTYDPELTSWLDEQ  137



>ref|XP_011036076.1| PREDICTED: protein PAT1 homolog 1-like [Populus euphratica]
Length=789

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            A+TF KLNRVV GPR+PGVIGDRGSGSFSRESSS  DWA+D +   WLDQ 
Sbjct  79   ASTFAKLNRVVTGPRNPGVIGDRGSGSFSRESSSATDWAQDGEFAGWLDQQ  129



>gb|KFK39518.1| hypothetical protein AALP_AA3G254500 [Arabis alpina]
Length=781

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  618
            ATTF K+NRVV GP+HPGVIGDRGSGSFSRESSS  DW  DA+   W+D+   D
Sbjct  83   ATTFAKINRVVTGPKHPGVIGDRGSGSFSRESSSATDWTHDAEATSWMDEQDQD  136



>ref|XP_010466506.1| PREDICTED: uncharacterized protein LOC104746679 [Camelina sativa]
Length=782

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF K+NR V GP+HPGVIGDRGSGSFSRESSS  DW  DA+L  WLD+ 
Sbjct  84   ATTFAKINRNVTGPKHPGVIGDRGSGSFSRESSSATDWTHDAELTSWLDEQ  134



>emb|CAB10277.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78541.1| hypothetical protein [Arabidopsis thaliana]
Length=679

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   WLDQH
Sbjct  5    ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSWLDQH  55



>ref|XP_006297023.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 ref|XP_006297024.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29921.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29922.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
Length=784

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF K+NRVV GP+HPGVIGDRGSGSFSRESSS  +W  DA+L  WLD  
Sbjct  85   ATTFAKINRVVPGPKHPGVIGDRGSGSFSRESSSATEWTHDAELTSWLDDQ  135



>ref|XP_010435003.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   WLDQH
Sbjct  81   ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSWLDQH  131



>ref|NP_567452.2| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AAK59544.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83534.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=787

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   WLDQH
Sbjct  80   ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSWLDQH  130



>ref|XP_009406733.1| PREDICTED: uncharacterized protein LOC103989576 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=793

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            +TF KLNRVV+ PR  GVIGDRGS S    S  TADWA++AD P W+DQ   D E
Sbjct  93   STFRKLNRVVSEPRSVGVIGDRGSFSRESSS--TADWAQEADFPSWIDQEILDAE  145



>ref|XP_009406732.1| PREDICTED: uncharacterized protein LOC103989576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=811

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            +TF KLNRVV+ PR  GVIGDRGS S    S  TADWA++AD P W+DQ   D E
Sbjct  93   STFRKLNRVVSEPRSVGVIGDRGSFSRESSS--TADWAQEADFPSWIDQEILDAE  145



>ref|XP_006283146.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16044.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=781

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   WLDQH
Sbjct  69   ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSWLDQH  119



>ref|XP_010440363.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   WLDQH
Sbjct  81   ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSWLDQH  131



>ref|XP_010496132.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=796

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   WLDQH
Sbjct  81   ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSWLDQH  131



>ref|XP_006283147.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16045.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=792

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   WLDQH
Sbjct  80   ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSWLDQH  130



>ref|NP_001044369.2| Os01g0769000 [Oryza sativa Japonica Group]
 dbj|BAD52714.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD53338.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94608.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06283.2| Os01g0769000 [Oryza sativa Japonica Group]
Length=809

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+DA+ P+W+DQ   + E
Sbjct  87   ASTFAKLNRSISGTRNPGVIGD--RRSISRGSSLTVDWAEDAEFPNWVDQDILEGE  140



>gb|KHN16432.1| hypothetical protein glysoja_046875 [Glycine soja]
Length=823

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 51/72 (71%), Gaps = 4/72 (6%)
 Frame = +1

Query  409  KEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADL  588
            KEE   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      SRE+SS ++W++  D+
Sbjct  15   KEEAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE----RGSRENSSASEWSQRDDI  70

Query  589  PDWLDQHFSDTE  624
            P W DQH  D E
Sbjct  71   PYWFDQHAYDPE  82



>ref|XP_006597999.1| PREDICTED: uncharacterized protein LOC100779096 isoform X3 [Glycine 
max]
Length=826

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +1

Query  409  KEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADL  588
            KEE   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      +   SS ++W++  D+
Sbjct  15   KEEAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE-RGSRENFTDSSASEWSQRDDI  73

Query  589  PDWLDQHFSDTE  624
            P W DQH  D E
Sbjct  74   PYWFDQHAYDPE  85



>ref|XP_006406189.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
 gb|ESQ47642.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
Length=784

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTA-DWAKDADLPDWLDQH  609
            ATTF KLNRVV GP+HPGVIGDRG        SS+A DW  D +L  WLD+ 
Sbjct  83   ATTFAKLNRVVTGPKHPGVIGDRGGSGSFSRESSSATDWTHDTELTSWLDEQ  134



>ref|XP_006597998.1| PREDICTED: uncharacterized protein LOC100779096 isoform X2 [Glycine 
max]
Length=878

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 51/72 (71%), Gaps = 4/72 (6%)
 Frame = +1

Query  409  KEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADL  588
            KEE   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      SRE+SS ++W++  D+
Sbjct  70   KEEAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE----RGSRENSSASEWSQRDDI  125

Query  589  PDWLDQHFSDTE  624
            P W DQH  D E
Sbjct  126  PYWFDQHAYDPE  137



>ref|XP_010511200.1| PREDICTED: uncharacterized protein LOC104787331 [Camelina sativa]
Length=782

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF K+NR V GP+HPGVIGDRGSGSFSRESSS  DW  D +L  WLD+ 
Sbjct  84   ATTFAKINRNVTGPKHPGVIGDRGSGSFSRESSSATDWTHDVELTSWLDEQ  134



>ref|XP_006597997.1| PREDICTED: uncharacterized protein LOC100779096 isoform X1 [Glycine 
max]
Length=881

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +1

Query  409  KEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADL  588
            KEE   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      +   SS ++W++  D+
Sbjct  70   KEEAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE-RGSRENFTDSSASEWSQRDDI  128

Query  589  PDWLDQHFSDTE  624
            P W DQH  D E
Sbjct  129  PYWFDQHAYDPE  140



>gb|EAZ23222.1| hypothetical protein OsJ_06910 [Oryza sativa Japonica Group]
Length=825

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+D + P+W+DQ   + E
Sbjct  103  ASTFAKLNRTISGTRNPGVIGD--RRSISRGSSLTVDWAEDVEFPNWVDQDILEDE  156



>gb|EAY86044.1| hypothetical protein OsI_07409 [Oryza sativa Indica Group]
Length=825

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+D + P+W+DQ   + E
Sbjct  103  ASTFAKLNRTISGTRNPGVIGD--RRSISRGSSLTVDWAEDVEFPNWVDQDILEDE  156



>ref|NP_001046960.1| Os02g0517300 [Oryza sativa Japonica Group]
 dbj|BAD46717.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD46150.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08874.1| Os02g0517300 [Oryza sativa Japonica Group]
Length=815

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+D + P+W+DQ   + E
Sbjct  93   ASTFAKLNRTISGTRNPGVIGD--RRSISRGSSLTVDWAEDVEFPNWVDQDILEDE  146



>gb|KHG07107.1| Protein PAT1 [Gossypium arboreum]
Length=716

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  472  KLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            KLNRVV GPR+PGVIGD  SGSFSRESSS ADWA+D +  +W+DQH  D +
Sbjct  7    KLNRVVTGPRNPGVIGD-RSGSFSRESSSAADWAQDGEYVNWMDQHLFDAD  56



>ref|XP_002441360.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
 gb|EES19790.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
Length=802

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  618
            A+TF  LNR ++G R+PGVIGD    S SRESS TADWA+DAD  +W+DQ   D
Sbjct  92   ASTFAMLNRSISGTRNPGVIGD--RRSISRESSLTADWAQDADFSNWVDQDILD  143



>ref|XP_002868239.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44498.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
Length=788

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   WLDQ+
Sbjct  80   ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSWLDQN  130



>emb|CDY37402.1| BnaC05g30280D [Brassica napus]
Length=785

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            ATTF KLNR V GP+H GVIGDRGSGSFSRESSS  DW  D +L +WLD+ 
Sbjct  85   ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSSATDWTHDTELTNWLDEQ  135



>ref|XP_010923783.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923784.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923785.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
Length=814

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  630
            +TF KLNR ++ PR+ GVIGDRGS S    S  TADW ++AD  +W+DQ+  D E Y
Sbjct  93   STFEKLNRTISDPRNAGVIGDRGSFSRESSS--TADWTQEADSSNWIDQNILDAENY  147



>ref|XP_006646364.1| PREDICTED: uncharacterized protein LOC102701783 [Oryza brachyantha]
Length=808

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNR ++G R+PGVIGD    S SR SS T DW +D + P+W+DQ   + E
Sbjct  86   ASTFAKLNRSISGTRNPGVIGD--RRSISRGSSLTVDWPEDVEFPNWVDQDILEDE  139



>ref|XP_010243929.1| PREDICTED: protein PAT1 homolog 1-like [Nelumbo nucifera]
Length=826

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN  V+ PR  GVIG+ GS S    S    DWA+D+D P+WLD H  +TE
Sbjct  93   ASTFSKLNSAVSKPRTAGVIGEMGSFSRESSS--ATDWAQDSDFPNWLDTHIFETE  146



>ref|XP_004514400.1| PREDICTED: uncharacterized protein LOC101512706 [Cicer arietinum]
Length=880

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 4/55 (7%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            TTFLKLN+VV+GPR  GVIGD      SRE+SS ++W++  ++P W+D H  D+E
Sbjct  91   TTFLKLNKVVSGPRSAGVIGD----RVSRENSSASEWSQRDEIPYWVDHHTYDSE  141



>ref|XP_003569904.1| PREDICTED: uncharacterized protein LOC100838182 [Brachypodium 
distachyon]
Length=805

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNR V+G R+PGVIGD    S SR SS T DW +D + P+W DQ   + E
Sbjct  84   ASTFAKLNRTVSGTRNPGVIGD--RRSISRGSSFTVDWDEDVEFPNWQDQDILENE  137



>ref|XP_010243919.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Nelumbo nucifera]
Length=824

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            +TF KLN+ V+ PR  GVIGDRGS S    S  T +WA+++D P+WLD H  D+E
Sbjct  93   STFSKLNKAVSEPRTAGVIGDRGSFSRESSS--TTEWAQESDFPNWLDPHIFDSE  145



>ref|XP_010243918.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Nelumbo nucifera]
Length=825

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            +TF KLN+ V+ PR  GVIGDRGS S    S  T +WA+++D P+WLD H  D+E
Sbjct  94   STFSKLNKAVSEPRTAGVIGDRGSFSRESSS--TTEWAQESDFPNWLDPHIFDSE  146



>ref|XP_009416760.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=836

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            +TF KLNRVV+ PR  G+IGD   GSFSRESSS A+W ++AD P W+DQ   D E
Sbjct  120  STFRKLNRVVSEPRSVGIIGD--RGSFSRESSSAAEWTQEADFPSWIDQEIFDAE  172



>ref|XP_009416762.1| PREDICTED: protein PAT1 homolog 1-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=742

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            +TF KLNRVV+ PR  G+IGD   GSFSRESSS A+W ++AD P W+DQ   D E
Sbjct  26   STFRKLNRVVSEPRSVGIIGD--RGSFSRESSSAAEWTQEADFPSWIDQEIFDAE  78



>ref|XP_008649853.1| PREDICTED: uncharacterized protein LOC103630586 [Zea mays]
 gb|AFW78649.1| hypothetical protein ZEAMMB73_732523 [Zea mays]
Length=797

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  618
            A+TF  LNR ++G R+PG+IGD    S SRESS TADW +DAD  +W+DQ   D
Sbjct  86   ASTFAMLNRNISGTRNPGIIGD--RRSISRESSLTADWVQDADFSNWVDQDILD  137



>ref|XP_003568135.1| PREDICTED: protein PAT1 homolog 1-like [Brachypodium distachyon]
Length=806

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLD  603
            A+TF KLNR ++G R+PGVIGD    S SRESS T DW  +AD P+W+D
Sbjct  90   ASTFAKLNRTISGTRNPGVIGD--RRSISRESSLTNDWVPEADFPNWVD  136



>ref|XP_010684289.1| PREDICTED: uncharacterized protein LOC104898860 [Beta vulgaris 
subsp. vulgaris]
Length=844

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 4/55 (7%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            TT+LKLNR V GPR+PGVIGDRGSGS SRESSS ADW++D     WLD    D +
Sbjct  114  TTYLKLNRAVTGPRNPGVIGDRGSGSLSRESSSAADWSRDG----WLDHGVGDVD  164



>ref|XP_004961543.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Setaria italica]
Length=813

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  618
            A+TF KLNR ++G R+PGVIGD    S SRESS T DW +DAD   W+DQ   D
Sbjct  93   ASTFAKLNRSISGTRNPGVIGD--RRSISRESSLTTDWVQDADFHSWVDQGMLD  144



>ref|XP_004961544.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Setaria italica]
Length=731

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  618
            A+TF KLNR ++G R+PGVIGD    S SRESS T DW +DAD   W+DQ   D
Sbjct  11   ASTFAKLNRSISGTRNPGVIGD--RRSISRESSLTTDWVQDADFHSWVDQGMLD  62



>ref|XP_009416761.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=808

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            +TF KLNRVV+ PR  G+IGD   GSFSRESSS A+W ++AD P W+DQ   D E
Sbjct  92   STFRKLNRVVSEPRSVGIIGD--RGSFSRESSSAAEWTQEADFPSWIDQEIFDAE  144



>gb|EMT17005.1| Lipoyl synthase, mitochondrial [Aegilops tauschii]
Length=1181

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNR + G R+PGVIGD    S SRESS T DWA++A+  +W+D    D++
Sbjct  93   ASTFAKLNRSIGGTRNPGVIGD--RRSISRESSLTTDWAQEAEFSNWVDHDILDSD  146



>gb|KDP25122.1| hypothetical protein JCGZ_22657 [Jatropha curcas]
Length=805

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 4/51 (8%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  609
            A+TF KLN+VV+GPR  GVIGD      SRESSS A+WA+  D P+W DQ 
Sbjct  90   ASTFSKLNKVVSGPRGAGVIGD----RGSRESSSAAEWAQGDDFPNWFDQQ  136



>ref|XP_006648671.1| PREDICTED: uncharacterized protein LOC102700029 [Oryza brachyantha]
Length=782

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNR ++G  +PGVIGD    S SR SS T DW +D + P+W+DQ   + E
Sbjct  61   ASTFAKLNRSISGTHNPGVIGD--RRSISRGSSLTVDWPEDVEFPNWVDQDILEDE  114



>emb|CDP13609.1| unnamed protein product [Coffea canephora]
Length=817

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A TF KLN+VV+GPR  G IGD      SRESSS A+W ++ D P W DQ+  DTE
Sbjct  90   ARTFSKLNKVVSGPRDAGAIGD----MGSRESSSAAEWVREEDFPSWADQNAFDTE  141



>ref|XP_010926894.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Elaeis guineensis]
Length=822

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN+VV  PR  G IG+RGS S    S  TADWA++ D   WLDQ+  D E
Sbjct  96   ASTFSKLNKVVGEPRRSGAIGNRGSFSRESSS--TADWAQEQDFTKWLDQNILDNE  149



>ref|XP_010926895.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Elaeis guineensis]
Length=794

 Score = 49.7 bits (117),  Expect = 0.001, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLN+VV  PR  G IG+RGS S    S  TADWA++ D   WLDQ+  D E
Sbjct  96   ASTFSKLNKVVGEPRRSGAIGNRGSFSRESSS--TADWAQEQDFTKWLDQNILDNE  149



>ref|XP_002456407.1| hypothetical protein SORBIDRAFT_03g035750 [Sorghum bicolor]
 gb|EES01527.1| hypothetical protein SORBIDRAFT_03g035750 [Sorghum bicolor]
Length=810

 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +1

Query  457  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+D +  +W DQ   + E
Sbjct  85   ASTFAKLNRSISGTRNPGVIGD--RRSISRGSSLTVDWAEDVEFSNWGDQDVFENE  138



>ref|XP_010907163.1| PREDICTED: uncharacterized protein LOC105033889 [Elaeis guineensis]
Length=821

 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  460  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  624
            +TF KLNR ++ PR  GVIGD    SFSRESSSTADW ++AD  +W+D++  D E
Sbjct  98   STFAKLNRTISDPRSAGVIGD--RRSFSRESSSTADWMQEADFSNWIDENILDAE  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875