BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024F08

Length=707
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46296.1|  cytochrome P450                                        132   3e-53   Ipomoea nil [qian niu]
ref|XP_009802093.1|  PREDICTED: cytochrome P450 86B1-like               121   1e-52   Nicotiana sylvestris
ref|XP_009603547.1|  PREDICTED: cytochrome P450 86B1-like               122   7e-52   Nicotiana tomentosiformis
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like               132   8e-52   
ref|XP_011095704.1|  PREDICTED: cytochrome P450 86B1-like               130   5e-51   Sesamum indicum [beniseed]
gb|EYU27552.1|  hypothetical protein MIMGU_mgv1a004751mg                134   3e-50   Erythranthe guttata [common monkey flower]
emb|CDP22261.1|  unnamed protein product                                136   8e-49   Coffea canephora [robusta coffee]
gb|EYU27551.1|  hypothetical protein MIMGU_mgv1a027070mg                124   2e-46   Erythranthe guttata [common monkey flower]
gb|AJD25225.1|  cytochrome P450 CYP96A85                                114   2e-45   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011031168.1|  PREDICTED: cytochrome P450 86B1-like               128   8e-42   Populus euphratica
ref|XP_006470474.1|  PREDICTED: cytochrome P450 86B1-like               103   1e-38   
gb|KDO37689.1|  hypothetical protein CISIN_1g047842mg                   102   2e-38   Citrus sinensis [apfelsine]
ref|XP_006446602.1|  hypothetical protein CICLE_v10014930mg             103   4e-37   Citrus clementina [clementine]
ref|XP_006370230.1|  hypothetical protein POPTR_0001s40840g             119   5e-37   Populus trichocarpa [western balsam poplar]
gb|KDO55118.1|  hypothetical protein CISIN_1g036278mg                 99.0    8e-37   Citrus sinensis [apfelsine]
ref|XP_004968446.1|  PREDICTED: cytochrome P450 86B1-like               112   2e-36   Setaria italica
ref|XP_009101866.1|  PREDICTED: cytochrome P450 86B1                    104   7e-36   Brassica rapa
ref|XP_006301857.1|  hypothetical protein CARUB_v10022327mg             111   3e-35   Capsella rubella
ref|XP_004160508.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    103   1e-34   
gb|KGN48432.1|  hypothetical protein Csa_6G487530                       103   1e-34   Cucumis sativus [cucumbers]
ref|XP_004151191.1|  PREDICTED: cytochrome P450 86B1-like               103   1e-34   
ref|XP_002322211.1|  hypothetical protein POPTR_0015s09840g             108   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004160509.1|  PREDICTED: cytochrome P450 86B1-like               107   4e-34   
ref|XP_009101865.1|  PREDICTED: cytochrome P450 86B1-like             97.4    8e-34   Brassica rapa
ref|XP_011005604.1|  PREDICTED: cytochrome P450 86B1-like               104   1e-33   Populus euphratica
ref|XP_008440138.1|  PREDICTED: cytochrome P450 86B1-like             98.6    1e-33   Cucumis melo [Oriental melon]
ref|XP_007031595.1|  Cytochrome P450, putative                          102   2e-33   
ref|XP_008440139.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    102   2e-33   
gb|EYU32453.1|  hypothetical protein MIMGU_mgv1a005630mg                135   3e-33   Erythranthe guttata [common monkey flower]
gb|KGN48434.1|  hypothetical protein Csa_6G487550                     99.4    3e-33   Cucumis sativus [cucumbers]
ref|XP_004142037.1|  PREDICTED: cytochrome P450 86B1-like             99.4    3e-33   
ref|XP_004173396.1|  PREDICTED: cytochrome P450 86B1-like             99.4    4e-33   
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...    105   4e-33   
ref|XP_006446605.1|  hypothetical protein CICLE_v10017795mg           89.4    4e-33   
emb|CDY53177.1|  BnaA06g40560D                                        94.7    2e-32   Brassica napus [oilseed rape]
ref|XP_010470317.1|  PREDICTED: cytochrome P450 86B1-like               104   2e-32   Camelina sativa [gold-of-pleasure]
gb|KDO37445.1|  hypothetical protein CISIN_1g036716mg                 89.0    3e-32   Citrus sinensis [apfelsine]
ref|XP_010653011.1|  PREDICTED: cytochrome P450 86B1-like               106   3e-32   Vitis vinifera
ref|XP_006470473.1|  PREDICTED: cytochrome P450 86B1-like             87.0    4e-32   
emb|CDM81752.1|  unnamed protein product                              97.1    4e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009589080.1|  PREDICTED: cytochrome P450 86B1-like               132   5e-32   Nicotiana tomentosiformis
emb|CDX72690.1|  BnaC07g47120D                                        92.0    8e-32   
ref|XP_009782181.1|  PREDICTED: cytochrome P450 86B1-like               130   2e-31   Nicotiana sylvestris
ref|XP_004151610.1|  PREDICTED: cytochrome P450 86B1-like               100   5e-31   Cucumis sativus [cucumbers]
ref|XP_009759324.1|  PREDICTED: cytochrome P450 86B1-like               129   5e-31   Nicotiana sylvestris
ref|XP_004160507.1|  PREDICTED: cytochrome P450 86B1-like               100   8e-31   
ref|XP_002862576.1|  hypothetical protein ARALYDRAFT_920522           92.4    1e-30   Arabidopsis lyrata subsp. lyrata
gb|EPS60789.1|  hypothetical protein M569_14012                         127   1e-30   Genlisea aurea
ref|XP_002526301.1|  heme binding protein, putative                   96.3    2e-30   
ref|XP_006280314.1|  hypothetical protein CARUB_v10026237mg           89.4    2e-30   Capsella rubella
ref|XP_004249316.1|  PREDICTED: cytochrome P450 86B1-like               127   2e-30   Solanum lycopersicum
ref|XP_006339337.1|  PREDICTED: cytochrome P450 86B1-like               127   2e-30   
ref|XP_009623637.1|  PREDICTED: cytochrome P450 86B1-like               127   3e-30   Nicotiana tomentosiformis
ref|XP_009773631.1|  PREDICTED: cytochrome P450 86B1-like             94.7    3e-30   Nicotiana sylvestris
ref|XP_004142038.1|  PREDICTED: cytochrome P450 86B1-like             90.1    4e-30   Cucumis sativus [cucumbers]
gb|AEI59774.1|  cytochrome P450                                         126   4e-30   Helianthus annuus
ref|XP_011095705.1|  PREDICTED: cytochrome P450 86B1-like               125   6e-30   Sesamum indicum [beniseed]
ref|XP_002306257.2|  hypothetical protein POPTR_0005s06540g             125   8e-30   
ref|XP_010482535.1|  PREDICTED: cytochrome P450 86B1-like             89.0    1e-29   Camelina sativa [gold-of-pleasure]
gb|KFK40984.1|  hypothetical protein AALP_AA2G070000                  97.1    2e-29   Arabis alpina [alpine rockcress]
gb|EEC74485.1|  hypothetical protein OsI_09945                        82.0    2e-29   Oryza sativa Indica Group [Indian rice]
gb|EYU33777.1|  hypothetical protein MIMGU_mgv1a004858mg                124   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_011043827.1|  PREDICTED: cytochrome P450 86B1-like               123   5e-29   Populus euphratica
ref|XP_004249313.1|  PREDICTED: cytochrome P450 86B1-like               123   6e-29   Solanum lycopersicum
gb|EYU27556.1|  hypothetical protein MIMGU_mgv1a021423mg                123   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_009622763.1|  PREDICTED: cytochrome P450 86B1-like               122   8e-29   Nicotiana tomentosiformis
ref|XP_008440140.1|  PREDICTED: cytochrome P450 86B1-like isoform X2  91.3    8e-29   Cucumis melo [Oriental melon]
ref|XP_010442700.1|  PREDICTED: cytochrome P450 86B1-like             90.1    1e-28   Camelina sativa [gold-of-pleasure]
emb|CDP18605.1|  unnamed protein product                              94.7    1e-28   Coffea canephora [robusta coffee]
gb|EPS65366.1|  hypothetical protein M569_09411                         122   1e-28   Genlisea aurea
ref|XP_004142039.1|  PREDICTED: cytochrome P450 86B1-like             87.4    1e-28   
gb|ABF93891.1|  Cytochrome P450 family protein                        79.0    1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006351377.1|  PREDICTED: cytochrome P450 86B1-like               122   1e-28   Solanum tuberosum [potatoes]
gb|EAZ25521.1|  hypothetical protein OsJ_09345                        79.0    2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006351379.1|  PREDICTED: cytochrome P450 86B1-like               122   2e-28   
emb|CDY39928.1|  BnaA09g15100D                                        98.2    2e-28   Brassica napus [oilseed rape]
ref|XP_006351378.1|  PREDICTED: cytochrome P450 86B1-like               121   2e-28   Solanum tuberosum [potatoes]
ref|XP_010444065.1|  PREDICTED: cytochrome P450 86B1-like             90.1    3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_004166589.1|  PREDICTED: cytochrome P450 86B1-like             90.9    3e-28   
ref|XP_009631751.1|  PREDICTED: cytochrome P450 86B1-like               121   3e-28   Nicotiana tomentosiformis
gb|KGN48435.1|  hypothetical protein Csa_6G487560                     90.9    3e-28   Cucumis sativus [cucumbers]
ref|XP_004142036.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  90.9    4e-28   
ref|XP_009790818.1|  PREDICTED: cytochrome P450 86B1-like             92.8    4e-28   Nicotiana sylvestris
gb|EYU41723.1|  hypothetical protein MIMGU_mgv1a021724mg                119   1e-27   Erythranthe guttata [common monkey flower]
ref|XP_009626183.1|  PREDICTED: cytochrome P450 86B1-like               120   1e-27   Nicotiana tomentosiformis
ref|XP_010652863.1|  PREDICTED: cytochrome P450 86B1                    119   2e-27   Vitis vinifera
ref|XP_002322212.1|  hypothetical protein POPTR_0015s09850g           86.3    2e-27   
ref|XP_008441106.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  89.4    3e-27   
ref|XP_002457224.1|  hypothetical protein SORBIDRAFT_03g003590          118   4e-27   
ref|XP_006427987.1|  hypothetical protein CICLE_v10025412mg             116   1e-26   
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like               116   1e-26   Nicotiana sylvestris
ref|XP_006301190.1|  hypothetical protein CARUB_v10021589mg             104   1e-26   
ref|XP_009113346.1|  PREDICTED: cytochrome P450 86B1-like             95.9    1e-26   Brassica rapa
gb|EYU27555.1|  hypothetical protein MIMGU_mgv1a020397mg                116   2e-26   Erythranthe guttata [common monkey flower]
ref|XP_009109464.1|  PREDICTED: cytochrome P450 86B1-like             82.0    3e-26   Brassica rapa
emb|CDY66735.1|  BnaC03g60620D                                        85.9    3e-26   Brassica napus [oilseed rape]
ref|XP_006427985.1|  hypothetical protein CICLE_v10025385mg           83.6    4e-26   
ref|XP_010554002.1|  PREDICTED: cytochrome P450 86B1-like               115   5e-26   Tarenaya hassleriana [spider flower]
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like               115   5e-26   Nicotiana tomentosiformis
gb|EEE54005.1|  hypothetical protein OsJ_00650                          114   8e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010681071.1|  PREDICTED: cytochrome P450 86B1-like               114   9e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|ACR38435.1|  unknown                                                 114   1e-25   Zea mays [maize]
dbj|BAA99522.1|  putative cytochrome P450                               114   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EPS60696.1|  hypothetical protein M569_14105                         113   1e-25   Genlisea aurea
ref|XP_006340071.1|  PREDICTED: cytochrome P450 86B1-like               113   2e-25   
gb|KJB75063.1|  hypothetical protein B456_012G021700                  82.0    2e-25   Gossypium raimondii
ref|XP_010109842.1|  Cytochrome P450                                    109   2e-25   
gb|EAY72807.1|  hypothetical protein OsI_00673                          113   2e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_001042228.1|  Os01g0183600                                       113   2e-25   
gb|AJD25208.1|  cytochrome P450 CYP86A92                              84.0    2e-25   Salvia miltiorrhiza [Chinese salvia]
gb|EAZ25511.1|  hypothetical protein OsJ_09335                        89.0    2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048908.1|  Os03g0138200                                     89.0    2e-25   
gb|AFW89633.1|  putative cytochrome P450 superfamily protein          83.6    3e-25   
ref|XP_004985761.1|  PREDICTED: cytochrome P450 86B1-like             79.3    3e-25   
gb|EAY88464.1|  hypothetical protein OsI_09931                        88.6    3e-25   Oryza sativa Indica Group [Indian rice]
emb|CDX76867.1|  BnaC08g34530D                                          112   3e-25   
ref|XP_010680694.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    110   4e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009117295.1|  PREDICTED: cytochrome P450 86B1                    112   4e-25   Brassica rapa
emb|CAE54308.1|  cytochrome P450-like protein                         83.2    4e-25   Gossypium hirsutum [American cotton]
emb|CDY46088.1|  BnaA09g42120D                                          112   4e-25   Brassica napus [oilseed rape]
ref|XP_004249314.1|  PREDICTED: cytochrome P450 86B1-like               112   5e-25   Solanum lycopersicum
emb|CDP04331.1|  unnamed protein product                                111   6e-25   Coffea canephora [robusta coffee]
ref|XP_006643842.1|  PREDICTED: cytochrome P450 86B1-like               112   6e-25   Oryza brachyantha
ref|XP_002878665.1|  CYP96A1                                            112   7e-25   
gb|KJB75060.1|  hypothetical protein B456_012G021500                  83.2    7e-25   Gossypium raimondii
ref|XP_009615501.1|  PREDICTED: cytochrome P450 86B1-like               111   8e-25   Nicotiana tomentosiformis
ref|NP_001031814.1|  cytochrome P450, family 96, subfamily A, pol...    111   9e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KDO45858.1|  hypothetical protein CISIN_1g047974mg                 83.6    1e-24   Citrus sinensis [apfelsine]
gb|KJB47429.1|  hypothetical protein B456_008G026100                  81.3    1e-24   Gossypium raimondii
ref|XP_010680693.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    111   1e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH40821.1|  cytochrome P450 family protein                          110   1e-24   Medicago truncatula
ref|XP_009759082.1|  PREDICTED: cytochrome P450 86B1-like               110   2e-24   Nicotiana sylvestris
gb|KJB75061.1|  hypothetical protein B456_012G021600                  83.2    2e-24   Gossypium raimondii
gb|KEH41380.1|  cytochrome P450 family protein                          110   2e-24   Medicago truncatula
gb|KJB75062.1|  hypothetical protein B456_012G021600                  83.2    2e-24   Gossypium raimondii
gb|EPS73452.1|  hypothetical protein M569_01304                         104   2e-24   Genlisea aurea
gb|KFK32767.1|  hypothetical protein AALP_AA6G286100                    110   2e-24   Arabis alpina [alpine rockcress]
ref|XP_011041669.1|  PREDICTED: cytochrome P450 86B1-like               110   2e-24   Populus euphratica
ref|XP_002468540.1|  hypothetical protein SORBIDRAFT_01g047610        80.1    3e-24   Sorghum bicolor [broomcorn]
ref|XP_009601590.1|  PREDICTED: cytochrome P450 86B1-like               110   3e-24   Nicotiana tomentosiformis
ref|XP_003564427.1|  PREDICTED: cytochrome P450 86B1-like               110   3e-24   Brachypodium distachyon [annual false brome]
gb|EMT14219.1|  Cytochrome P450 86A2                                    110   3e-24   
gb|EYU31098.1|  hypothetical protein MIMGU_mgv1a004607mg                110   3e-24   Erythranthe guttata [common monkey flower]
ref|XP_002866853.1|  CYP96A10                                           110   4e-24   Arabidopsis lyrata subsp. lyrata
ref|NP_179899.1|  cytochrome P450, family 96, subfamily A, polype...    109   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AJD25224.1|  cytochrome P450 CYP96A84                                109   4e-24   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010683407.1|  PREDICTED: cytochrome P450 86B1-like               109   4e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS62655.1|  Cytochrome P450 86B1                                    110   4e-24   Triticum urartu
gb|AHF22091.1|  CYP96A69                                              87.4    4e-24   Maesa lanceolata
ref|XP_010027332.1|  PREDICTED: cytochrome P450 86B1-like               107   5e-24   Eucalyptus grandis [rose gum]
gb|EYU24049.1|  hypothetical protein MIMGU_mgv1a004847mg                109   5e-24   Erythranthe guttata [common monkey flower]
dbj|BAJ87689.1|  predicted protein                                    90.9    5e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006346789.1|  PREDICTED: cytochrome P450 86B1-like               109   6e-24   Solanum tuberosum [potatoes]
ref|XP_006351417.1|  PREDICTED: cytochrome P450 86B1-like               109   6e-24   Solanum tuberosum [potatoes]
gb|EYU27553.1|  hypothetical protein MIMGU_mgv1a006542mg                108   7e-24   Erythranthe guttata [common monkey flower]
emb|CDY61808.1|  BnaC03g76440D                                        89.4    8e-24   Brassica napus [oilseed rape]
ref|XP_010419318.1|  PREDICTED: cytochrome P450 86B1-like               107   8e-24   
ref|XP_009101870.1|  PREDICTED: cytochrome P450 86B1                    108   9e-24   Brassica rapa
gb|KCW62190.1|  hypothetical protein EUGRSUZ_H04847                     108   9e-24   Eucalyptus grandis [rose gum]
ref|XP_009795090.1|  PREDICTED: cytochrome P450 86B1-like               108   1e-23   Nicotiana sylvestris
ref|XP_011100902.1|  PREDICTED: cytochrome P450 86B1-like               108   1e-23   Sesamum indicum [beniseed]
gb|KJB47427.1|  hypothetical protein B456_008G025900                  80.9    1e-23   Gossypium raimondii
gb|KFK33664.1|  hypothetical protein AALP_AA5G043500                    108   1e-23   Arabis alpina [alpine rockcress]
gb|EYU23445.1|  hypothetical protein MIMGU_mgv1a026937mg              80.1    1e-23   Erythranthe guttata [common monkey flower]
emb|CBI21517.3|  unnamed protein product                                104   1e-23   Vitis vinifera
emb|CDY27160.1|  BnaA08g07980D                                          108   1e-23   Brassica napus [oilseed rape]
ref|XP_006294050.1|  hypothetical protein CARUB_v10023041mg             108   1e-23   Capsella rubella
ref|XP_004237151.1|  PREDICTED: cytochrome P450 86B1                    108   1e-23   Solanum lycopersicum
ref|XP_010275494.1|  PREDICTED: cytochrome P450 86B1-like             70.1    1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009108130.1|  PREDICTED: cytochrome P450 86B1-like               108   1e-23   Brassica rapa
emb|CDY12435.1|  BnaC08g09240D                                          108   1e-23   Brassica napus [oilseed rape]
ref|XP_009375001.1|  PREDICTED: cytochrome P450 86A8                  85.1    1e-23   
ref|XP_010429263.1|  PREDICTED: cytochrome P450 86B1-like               108   2e-23   Camelina sativa [gold-of-pleasure]
emb|CDY53179.1|  BnaA06g40580D                                          108   2e-23   Brassica napus [oilseed rape]
ref|XP_008801256.1|  PREDICTED: cytochrome P450 86B1-like               108   2e-23   Phoenix dactylifera
ref|XP_010681072.1|  PREDICTED: cytochrome P450 86B1-like               108   2e-23   
dbj|BAK07250.1|  predicted protein                                      107   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011100086.1|  PREDICTED: cytochrome P450 86B1-like               107   2e-23   Sesamum indicum [beniseed]
ref|XP_006391721.1|  hypothetical protein EUTSA_v10023410mg           81.3    2e-23   Eutrema salsugineum [saltwater cress]
ref|XP_010905514.1|  PREDICTED: cytochrome P450 86B1-like             85.1    2e-23   
gb|KFK22570.1|  hypothetical protein AALP_AAs72953U000100               107   2e-23   Arabis alpina [alpine rockcress]
ref|XP_010025512.1|  PREDICTED: cytochrome P450 86B1-like               107   2e-23   Eucalyptus grandis [rose gum]
ref|XP_008796514.1|  PREDICTED: cytochrome P450 86B1-like             80.1    3e-23   Phoenix dactylifera
ref|XP_010418406.1|  PREDICTED: cytochrome P450 86A7-like             81.6    3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_003556827.2|  PREDICTED: cytochrome P450 86B1-like               107   3e-23   Glycine max [soybeans]
ref|XP_009759095.1|  PREDICTED: cytochrome P450 86B1-like               107   3e-23   Nicotiana sylvestris
ref|XP_002878579.1|  CYP96A5                                            107   3e-23   Arabidopsis lyrata subsp. lyrata
gb|KJB77357.1|  hypothetical protein B456_012G133700                  76.6    3e-23   Gossypium raimondii
ref|XP_006285710.1|  hypothetical protein CARUB_v10007181mg             107   3e-23   Capsella rubella
ref|XP_006464845.1|  PREDICTED: cytochrome P450 86B1-like             73.9    3e-23   Citrus sinensis [apfelsine]
ref|XP_010430476.1|  PREDICTED: cytochrome P450 86A7                  79.7    3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006300436.1|  hypothetical protein CARUB_v10020100mg           82.4    3e-23   Capsella rubella
ref|XP_002275806.1|  PREDICTED: cytochrome P450 86A7                  85.5    4e-23   Vitis vinifera
gb|KGN48429.1|  hypothetical protein Csa_6G487010                     68.6    4e-23   Cucumis sativus [cucumbers]
emb|CAN80040.1|  hypothetical protein VITISV_037194                   85.5    4e-23   Vitis vinifera
emb|CDY70656.1|  BnaAnng34510D                                          105   4e-23   Brassica napus [oilseed rape]
emb|CDX90338.1|  BnaA08g16460D                                        87.0    4e-23   
gb|EYU24048.1|  hypothetical protein MIMGU_mgv1a026886mg                107   4e-23   Erythranthe guttata [common monkey flower]
ref|XP_006643843.1|  PREDICTED: cytochrome P450 86B1-like               107   5e-23   Oryza brachyantha
ref|XP_002894690.1|  hypothetical protein ARALYDRAFT_474859             106   5e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_009389287.1|  PREDICTED: cytochrome P450 86B1-like               107   5e-23   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY53182.1|  BnaA06g40610D                                          106   5e-23   Brassica napus [oilseed rape]
gb|AHH81835.1|  putative cytochrome P450                              79.7    5e-23   Avicennia officinalis
tpg|DAA43291.1|  TPA: putative cytochrome P450 superfamily protein    79.3    5e-23   
ref|XP_010437069.1|  PREDICTED: cytochrome P450 86B1 isoform X1         106   6e-23   
ref|XP_002886391.1|  predicted protein                                81.3    6e-23   
ref|XP_002452782.1|  hypothetical protein SORBIDRAFT_04g032410        70.9    6e-23   Sorghum bicolor [broomcorn]
ref|NP_001141467.1|  uncharacterized protein LOC100273577             79.3    6e-23   
ref|XP_009107985.1|  PREDICTED: cytochrome P450 86B1-like               106   7e-23   Brassica rapa
ref|XP_010555337.1|  PREDICTED: cytochrome P450 86B1-like               106   7e-23   Tarenaya hassleriana [spider flower]
emb|CDY44658.1|  BnaA08g06820D                                          106   7e-23   Brassica napus [oilseed rape]
ref|XP_010446495.1|  PREDICTED: cytochrome P450 86B1-like               106   8e-23   Camelina sativa [gold-of-pleasure]
gb|EMT01938.1|  Cytochrome P450 86A2                                  72.0    8e-23   
ref|XP_010473620.1|  PREDICTED: cytochrome P450 86A7-like             80.9    8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010555338.1|  PREDICTED: cytochrome P450 86B1-like               106   9e-23   Tarenaya hassleriana [spider flower]
ref|XP_011100903.1|  PREDICTED: cytochrome P450 86B1-like               106   9e-23   Sesamum indicum [beniseed]
ref|XP_010416946.1|  PREDICTED: cytochrome P450 86B1-like               105   1e-22   Camelina sativa [gold-of-pleasure]
gb|KDP46408.1|  hypothetical protein JCGZ_10248                         105   1e-22   Jatropha curcas
gb|AAZ39642.1|  cytochrome P450 fatty acid omega-hydroxylase          83.2    1e-22   Petunia x hybrida [garden petunia]
ref|XP_002465889.1|  hypothetical protein SORBIDRAFT_01g047640        80.5    1e-22   Sorghum bicolor [broomcorn]
ref|XP_003554824.1|  PREDICTED: cytochrome P450 86B1-like               105   1e-22   Glycine max [soybeans]
ref|XP_008373994.1|  PREDICTED: cytochrome P450 86A8-like             83.2    1e-22   Malus domestica [apple tree]
ref|XP_004982787.1|  PREDICTED: cytochrome P450 86B1-like             85.5    1e-22   Setaria italica
emb|CDY32582.1|  BnaC03g15500D                                          104   1e-22   Brassica napus [oilseed rape]
ref|XP_009778171.1|  PREDICTED: cytochrome P450 86B1-like               102   1e-22   Nicotiana sylvestris
ref|XP_007019556.1|  Cytochrome P450                                    105   1e-22   
ref|XP_007040281.1|  Cytochrome P450, family 86, subfamily A, pol...  81.3    1e-22   
ref|XP_002523775.1|  cytochrome P450, putative                        74.3    2e-22   
ref|XP_002521474.1|  cytochrome P450, putative                          105   2e-22   Ricinus communis
ref|XP_010472325.1|  PREDICTED: cytochrome P450 86B1-like               103   2e-22   
ref|XP_010473744.1|  PREDICTED: cytochrome P450 86B1-like               105   2e-22   Camelina sativa [gold-of-pleasure]
gb|KEH40822.1|  cytochrome P450 family protein                          105   2e-22   Medicago truncatula
ref|NP_176558.1|  cytochrome P450, family 86, subfamily A, polype...  80.9    2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AHF22086.1|  CYP96A68                                              76.3    2e-22   Maesa lanceolata
gb|AAM65207.1|  putative cytochrome P450                              80.9    2e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39931.1|  BnaA09g15130D                                          104   2e-22   Brassica napus [oilseed rape]
ref|XP_007150923.1|  hypothetical protein PHAVU_004G006000g             104   2e-22   Phaseolus vulgaris [French bean]
ref|XP_010417073.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    104   2e-22   
ref|XP_007019555.1|  Cytochrome P450                                  72.4    3e-22   
ref|XP_006411749.1|  hypothetical protein EUTSA_v10026828mg             104   3e-22   Eutrema salsugineum [saltwater cress]
emb|CDY13727.1|  BnaA06g31960D                                          103   3e-22   Brassica napus [oilseed rape]
dbj|BAD94304.1|  cytochrome p450 - like protein                         104   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002275905.2|  PREDICTED: cytochrome P450 86B1                    104   3e-22   
emb|CDX72698.1|  BnaC07g47200D                                          103   3e-22   
emb|CBI34653.3|  unnamed protein product                              84.3    3e-22   Vitis vinifera
ref|XP_011070444.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  81.3    4e-22   
gb|KDP33058.1|  hypothetical protein JCGZ_13644                       75.1    4e-22   Jatropha curcas
ref|XP_004955136.1|  PREDICTED: cytochrome P450 86A2-like             69.7    4e-22   
emb|CDY38915.1|  BnaA03g12640D                                          101   4e-22   Brassica napus [oilseed rape]
ref|XP_002279531.1|  PREDICTED: cytochrome P450 86B1                    104   4e-22   Vitis vinifera
gb|KDP35260.1|  hypothetical protein JCGZ_09419                         104   4e-22   Jatropha curcas
ref|XP_007043287.1|  Cytochrome P450, family 86, subfamily B, pol...  79.0    4e-22   
ref|XP_007150921.1|  hypothetical protein PHAVU_004G005800g             104   4e-22   Phaseolus vulgaris [French bean]
dbj|BAJ88802.1|  predicted protein                                    72.0    5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010446494.1|  PREDICTED: cytochrome P450 86B1-like               103   5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_003525679.1|  PREDICTED: cytochrome P450 86B1-like               103   5e-22   Glycine max [soybeans]
ref|XP_010027344.1|  PREDICTED: cytochrome P450 86B1-like               103   5e-22   Eucalyptus grandis [rose gum]
gb|KHG09498.1|  Cytochrome P450 protein                               76.3    5e-22   Gossypium arboreum [tree cotton]
ref|XP_009151941.1|  PREDICTED: cytochrome P450 86A7-like               103   6e-22   Brassica rapa
ref|XP_010531420.1|  PREDICTED: cytochrome P450 86B1-like               103   6e-22   Tarenaya hassleriana [spider flower]
gb|KEH40839.1|  cytochrome P450 family protein                          103   6e-22   Medicago truncatula
ref|NP_179782.1|  cytochrome P450, family 96, subfamily A, polype...    103   6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027335.1|  PREDICTED: cytochrome P450 86B1-like               103   6e-22   
ref|XP_002304502.2|  cytochrome P450 family protein                   75.5    7e-22   Populus trichocarpa [western balsam poplar]
ref|XP_004306772.1|  PREDICTED: cytochrome P450 86A8-like             78.6    7e-22   Fragaria vesca subsp. vesca
emb|CDY29171.1|  BnaC09g15680D                                          102   7e-22   Brassica napus [oilseed rape]
gb|KGN48430.1|  hypothetical protein Csa_6G487020                       103   7e-22   Cucumis sativus [cucumbers]
ref|XP_011022670.1|  PREDICTED: cytochrome P450 86A7-like             75.1    8e-22   Populus euphratica
ref|XP_010522971.1|  PREDICTED: cytochrome P450 86A2-like isoform X1  81.3    8e-22   Tarenaya hassleriana [spider flower]
gb|KDP25417.1|  hypothetical protein JCGZ_20573                       85.5    8e-22   Jatropha curcas
ref|XP_006647656.1|  PREDICTED: cytochrome P450 86A2-like             71.2    8e-22   Oryza brachyantha
ref|XP_007209896.1|  hypothetical protein PRUPE_ppa004078mg           79.7    9e-22   Prunus persica
ref|XP_003525678.1|  PREDICTED: cytochrome P450 86B1-like               103   9e-22   Glycine max [soybeans]
gb|ACG38359.1|  cytochrome P450 CYP86A35                              70.1    9e-22   Zea mays [maize]
ref|NP_001183394.1|  uncharacterized protein LOC100501810             69.7    9e-22   
gb|AFW72704.1|  putative cytochrome P450 superfamily protein          69.7    1e-21   
ref|XP_010676593.1|  PREDICTED: cytochrome P450 86B1-like             77.8    1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009797448.1|  PREDICTED: cytochrome P450 86A7-like             80.5    1e-21   Nicotiana sylvestris
ref|XP_009610115.1|  PREDICTED: cytochrome P450 86A7-like             80.5    1e-21   Nicotiana tomentosiformis
ref|XP_007150917.1|  hypothetical protein PHAVU_004G005400g             102   1e-21   
ref|XP_010533650.1|  PREDICTED: cytochrome P450 86A7                  78.2    1e-21   
gb|KFK30510.1|  hypothetical protein AALP_AA7G271300                    102   1e-21   
ref|XP_010027235.1|  PREDICTED: cytochrome P450 86B1-like               100   1e-21   
ref|NP_194944.1|  cytochrome P450, family 96, subfamily A, polype...    102   1e-21   
ref|XP_006374652.1|  cytochrome P450 family protein                     102   1e-21   
ref|XP_006392373.1|  hypothetical protein EUTSA_v10023421mg             102   1e-21   
ref|XP_010053250.1|  PREDICTED: cytochrome P450 86A7                  80.1    1e-21   
ref|XP_010555325.1|  PREDICTED: cytochrome P450 86B1-like               102   1e-21   
gb|KDP46409.1|  hypothetical protein JCGZ_10249                         101   1e-21   
ref|XP_004515481.1|  PREDICTED: cytochrome P450 86B1-like               102   1e-21   
ref|XP_007150920.1|  hypothetical protein PHAVU_004G005700g             102   1e-21   
gb|EMT13313.1|  Cytochrome P450 86A1                                  89.7    1e-21   
ref|XP_008437294.1|  PREDICTED: cytochrome P450 86A7                  77.8    1e-21   
ref|XP_006418437.1|  hypothetical protein EUTSA_v10007350mg           81.6    1e-21   
ref|XP_008238919.1|  PREDICTED: cytochrome P450 86A8                  80.9    2e-21   
ref|XP_009605621.1|  PREDICTED: cytochrome P450 86B1                  97.4    2e-21   
gb|EEC73748.1|  hypothetical protein OsI_08390                        72.4    2e-21   
ref|XP_006392374.1|  hypothetical protein EUTSA_v10023421mg             102   2e-21   
gb|AIE57505.1|  MAH1                                                    102   2e-21   
ref|XP_006392376.1|  hypothetical protein EUTSA_v10023422mg             102   2e-21   
ref|NP_001047674.1|  Os02g0666500                                     72.4    2e-21   
ref|XP_010511350.1|  PREDICTED: cytochrome P450 86B1-like               102   2e-21   
gb|KDP35253.1|  hypothetical protein JCGZ_09412                         102   2e-21   
ref|XP_006826270.1|  hypothetical protein AMTR_s00004p00043150        66.6    2e-21   
ref|XP_010089087.1|  Cytochrome P450 86A2                             77.4    2e-21   
gb|KEH40826.1|  cytochrome P450 family protein                          102   2e-21   
ref|XP_002509820.1|  cytochrome P450, putative                        82.4    2e-21   
ref|XP_009400643.1|  PREDICTED: cytochrome P450 86B1-like               102   2e-21   
ref|XP_010436205.1|  PREDICTED: cytochrome P450 86B1-like               101   3e-21   
emb|CDY39927.1|  BnaA09g15090D                                          102   3e-21   
ref|XP_003524561.1|  PREDICTED: cytochrome P450 86B1-like               102   3e-21   
ref|XP_010907215.1|  PREDICTED: cytochrome P450 86A8-like             78.6    3e-21   
tpg|DAA49553.1|  TPA: putative cytochrome P450 superfamily protein    86.3    3e-21   
gb|KFK30625.1|  hypothetical protein AALP_AA6G006200                  79.3    3e-21   
ref|XP_011072860.1|  PREDICTED: cytochrome P450 86A7                  83.2    3e-21   
ref|XP_010414809.1|  PREDICTED: cytochrome P450 86B1-like               101   3e-21   
ref|XP_006343967.1|  PREDICTED: cytochrome P450 86A2-like             79.7    3e-21   
dbj|BAJ86471.1|  predicted protein                                    70.1    3e-21   
gb|KJB41354.1|  hypothetical protein B456_007G100300                  77.0    3e-21   
gb|KEH40805.1|  cytochrome P450 family protein                          101   3e-21   
gb|EAY86526.1|  hypothetical protein OsI_07906                        77.0    3e-21   
gb|KDP35254.1|  hypothetical protein JCGZ_09413                         101   4e-21   
emb|CDP11007.1|  unnamed protein product                              72.0    4e-21   
ref|XP_008804444.1|  PREDICTED: cytochrome P450 86A8-like             77.0    4e-21   
ref|XP_004515489.1|  PREDICTED: cytochrome P450 86B1-like               101   4e-21   
ref|XP_004245593.1|  PREDICTED: cytochrome P450 86A7                  79.3    4e-21   
ref|XP_010261086.1|  PREDICTED: cytochrome P450 86B1-like               101   4e-21   
dbj|BAK06287.1|  predicted protein                                    74.7    4e-21   
ref|XP_009132532.1|  PREDICTED: cytochrome P450 86B1                    101   4e-21   
ref|XP_009118821.1|  PREDICTED: cytochrome P450 86A4                  82.0    4e-21   
ref|XP_006287404.1|  hypothetical protein CARUB_v10000610mg           83.6    5e-21   
gb|KEH22136.1|  cytochrome P450 family protein                          101   5e-21   
emb|CDY58383.1|  BnaC09g51620D                                          100   5e-21   
gb|EMS66236.1|  Cytochrome P450 86B1                                  99.8    5e-21   
ref|XP_009119710.1|  PREDICTED: cytochrome P450 86A4                  82.0    5e-21   
ref|XP_004952982.1|  PREDICTED: cytochrome P450 86B1-like             80.1    5e-21   
ref|XP_006404644.1|  hypothetical protein EUTSA_v10000679mg             100   6e-21   
gb|KCW62191.1|  hypothetical protein EUGRSUZ_H04849                     100   6e-21   
emb|CDY38015.1|  BnaCnng08760D                                        81.3    7e-21   
ref|XP_010437068.1|  PREDICTED: cytochrome P450 86B1                    100   7e-21   
ref|XP_003554826.1|  PREDICTED: cytochrome P450 86B1-like               100   7e-21   
ref|XP_011022663.1|  PREDICTED: cytochrome P450 86B1-like             77.4    7e-21   
gb|EPS61958.1|  hypothetical protein M569_12832                       80.1    7e-21   
ref|XP_004298810.1|  PREDICTED: cytochrome P450 86A7                  75.9    7e-21   
gb|EYU33778.1|  hypothetical protein MIMGU_mgv1a020242mg                100   7e-21   
ref|XP_002312417.2|  cytochrome P450 family protein                   78.6    7e-21   
gb|KEH21079.1|  cytochrome P450 family 94 protein                     78.6    8e-21   
emb|CDX72691.1|  BnaC07g47130D                                        97.8    8e-21   
ref|XP_008338834.1|  PREDICTED: cytochrome P450 86A8                  78.2    8e-21   
ref|XP_006283543.1|  hypothetical protein CARUB_v10004594mg             100   8e-21   
gb|KFK31020.1|  hypothetical protein AALP_AA6G057700                    100   8e-21   
ref|XP_011092582.1|  PREDICTED: cytochrome P450 86A8-like             79.0    8e-21   
ref|NP_001117509.1|  alkane hydroxylase CYP96A15                      99.8    8e-21   
gb|ABK25134.1|  unknown                                               77.4    8e-21   
ref|XP_004503701.1|  PREDICTED: cytochrome P450 86A2-like             78.2    9e-21   
gb|KJB25882.1|  hypothetical protein B456_004G213300                  76.3    9e-21   
gb|KFK32856.1|  hypothetical protein AALP_AA6G295800                    100   9e-21   
ref|XP_003568803.1|  PREDICTED: cytochrome P450 86B1-like               100   9e-21   
ref|XP_004237624.1|  PREDICTED: cytochrome P450 86B1-like               100   9e-21   
ref|XP_007016155.1|  Cytochrome P450, family 86, subfamily A, pol...  72.8    9e-21   
ref|XP_010918585.1|  PREDICTED: cytochrome P450 86A8-like             78.6    1e-20   
emb|CDX90044.1|  BnaA10g00380D                                        81.3    1e-20   
ref|NP_195910.1|  cytochrome P450, family 96, subfamily A, polype...    100   1e-20   
ref|XP_009407623.1|  PREDICTED: cytochrome P450 86B1-like isoform X1  75.9    1e-20   
ref|XP_003570074.1|  PREDICTED: cytochrome P450 86A2-like             69.7    1e-20   
gb|KEH40835.1|  cytochrome P450 family protein                          100   1e-20   
ref|XP_008389072.1|  PREDICTED: cytochrome P450 86B1-like             72.0    1e-20   
ref|XP_009407697.1|  PREDICTED: cytochrome P450 86B1-like isoform X2  75.9    1e-20   
gb|EMT29524.1|  Cytochrome P450 86A2                                  98.6    1e-20   
ref|XP_004143898.1|  PREDICTED: cytochrome P450 86A2-like             76.6    1e-20   
ref|XP_007048137.1|  Cytochrome P450                                    100   1e-20   
ref|XP_009794122.1|  PREDICTED: cytochrome P450 86B1-like             74.7    1e-20   
ref|XP_007150922.1|  hypothetical protein PHAVU_004G005900g             100   1e-20   
pir||C96517  hypothetical protein F16N3.7 [imported] - Arabidopsi...    100   1e-20
ref|XP_009113345.1|  PREDICTED: cytochrome P450 86B1-like               100   1e-20   
emb|CDY15167.1|  BnaC05g00460D                                        80.9    1e-20   
ref|XP_004976485.1|  PREDICTED: cytochrome P450 86A2-like             69.3    1e-20   
gb|KJB52139.1|  hypothetical protein B456_008G247600                  75.9    1e-20   
ref|XP_010511352.1|  PREDICTED: cytochrome P450 86B1-like             99.8    1e-20   
ref|XP_003627566.1|  Cytochrome P450 fatty acid omega-hydroxylase     75.5    1e-20   
emb|CDY39926.1|  BnaA09g15080D                                        99.8    1e-20   
gb|KEH40830.1|  cytochrome P450 family protein                          100   1e-20   
ref|XP_007134108.1|  hypothetical protein PHAVU_010G019500g           99.8    1e-20   
gb|KHN19680.1|  Cytochrome P450 86B1                                    100   1e-20   
emb|CAB41474.1|  cytochrome P450                                      76.6    1e-20   
gb|EYU33779.1|  hypothetical protein MIMGU_mgv1a018283mg              99.4    1e-20   
ref|XP_009113344.1|  PREDICTED: cytochrome P450 86B1-like             99.8    1e-20   
ref|XP_007051775.1|  Cytochrome P450, family 86, subfamily A, pol...  77.0    1e-20   
gb|KEH21495.1|  cytochrome P450 family 94 protein                     65.9    2e-20   
gb|AAL59025.1|AC087182_8  putative cytochrome P450 protein            81.6    2e-20   
ref|XP_007218993.1|  hypothetical protein PRUPE_ppa004034mg           77.8    2e-20   
ref|XP_002869292.1|  CYP96A2                                          99.8    2e-20   
ref|NP_001064901.2|  Os10g0486100                                     81.6    2e-20   
ref|XP_004229934.1|  PREDICTED: cytochrome P450 86A8-like             79.7    2e-20   
ref|XP_010027331.1|  PREDICTED: cytochrome P450 86B1-like             99.8    2e-20   
ref|NP_176086.1|  alkane hydroxylase CYP96A15                         99.8    2e-20   
ref|XP_004489211.1|  PREDICTED: cytochrome P450 86B1-like             99.8    2e-20   
ref|XP_010027339.1|  PREDICTED: cytochrome P450 86B1-like             99.8    2e-20   
ref|XP_006652635.1|  PREDICTED: cytochrome P450 86A4-like             63.5    2e-20   
gb|KEH40842.1|  cytochrome P450 family protein                        99.8    2e-20   
ref|XP_009783405.1|  PREDICTED: cytochrome P450 86B1-like             99.8    2e-20   
ref|XP_010027329.1|  PREDICTED: cytochrome P450 86B1-like             99.4    2e-20   
gb|KCW62188.1|  hypothetical protein EUGRSUZ_H04845                   98.6    2e-20   
ref|XP_006827573.1|  hypothetical protein AMTR_s00009p00227030        75.5    2e-20   
emb|CDX76962.1|  BnaC08g35480D                                        99.4    2e-20   
ref|XP_010067001.1|  PREDICTED: cytochrome P450 86B1-like             72.8    2e-20   
ref|XP_002986290.1|  fatty acid omega-hydroxylase                     77.4    2e-20   
ref|XP_009397609.1|  PREDICTED: cytochrome P450 86B1-like             79.0    2e-20   
ref|XP_002988762.1|  hypothetical protein SELMODRAFT_128482           77.4    2e-20   
gb|KHN19669.1|  Cytochrome P450 86B1                                  98.6    2e-20   
gb|KDP35256.1|  hypothetical protein JCGZ_09415                       96.3    2e-20   
ref|XP_006339587.1|  PREDICTED: cytochrome P450 86A2-like             79.3    2e-20   
emb|CDP12889.1|  unnamed protein product                              99.0    2e-20   
ref|XP_009101871.1|  PREDICTED: cytochrome P450 86B1                  99.4    2e-20   
ref|XP_009113349.1|  PREDICTED: cytochrome P450 86B1-like             99.0    3e-20   
emb|CDY53181.1|  BnaA06g40600D                                        99.4    3e-20   
gb|EYU32135.1|  hypothetical protein MIMGU_mgv1a003916mg              79.7    3e-20   
ref|XP_004968445.1|  PREDICTED: cytochrome P450 86B1-like             99.4    3e-20   
ref|XP_006396237.1|  hypothetical protein EUTSA_v10028550mg           80.5    3e-20   
ref|XP_009397933.1|  PREDICTED: cytochrome P450 86A2-like             74.3    3e-20   
ref|XP_006339338.1|  PREDICTED: cytochrome P450 86B1-like             98.6    3e-20   
gb|AJD25207.1|  cytochrome P450 CYP86A91                              80.5    3e-20   
ref|XP_008244638.1|  PREDICTED: cytochrome P450 86A8-like             77.8    3e-20   
ref|XP_002868908.1|  hypothetical protein ARALYDRAFT_352944             100   3e-20   
gb|KDP35257.1|  hypothetical protein JCGZ_09416                       99.0    3e-20   
ref|XP_010025513.1|  PREDICTED: cytochrome P450 86B1-like             99.0    3e-20   
ref|XP_002529227.1|  cytochrome P450, putative                        99.0    3e-20   
emb|CDP12038.1|  unnamed protein product                              78.2    3e-20   
emb|CDY66201.1|  BnaA09g51710D                                        81.6    3e-20   
gb|EAY88475.1|  hypothetical protein OsI_09946                        99.0    3e-20   
ref|XP_008342161.1|  PREDICTED: cytochrome P450 86A8                  75.9    3e-20   
ref|XP_003572681.2|  PREDICTED: cytochrome P450 86B1                  73.9    3e-20   
gb|ABF93892.1|  Cytochrome P450 family protein                        98.6    3e-20   
ref|XP_009397903.1|  PREDICTED: cytochrome P450 86B1-like             99.0    4e-20   
ref|XP_011036497.1|  PREDICTED: cytochrome P450 86A8-like             72.8    4e-20   
gb|KEH40811.1|  cytochrome P450 family protein                        98.6    4e-20   
ref|XP_009351729.1|  PREDICTED: cytochrome P450 86B1-like             73.6    4e-20   
gb|EYU41727.1|  hypothetical protein MIMGU_mgv1a023193mg              97.4    4e-20   
ref|XP_009117361.1|  PREDICTED: cytochrome P450 86B1                  98.6    4e-20   
ref|XP_010556547.1|  PREDICTED: cytochrome P450 86A2-like             77.4    4e-20   
ref|XP_009128484.1|  PREDICTED: cytochrome P450 86A2                  80.1    4e-20   
gb|ABC68403.1|  cytochrome P450 monooxygenase CYP86A24                78.2    5e-20   
ref|XP_002320802.1|  cytochrome P450 family protein                   72.8    5e-20   
ref|XP_010688690.1|  PREDICTED: cytochrome P450 86B1                  77.8    5e-20   
emb|CDX72695.1|  BnaC07g47170D                                        98.2    5e-20   
ref|XP_004294257.2|  PREDICTED: cytochrome P450 86A1                  71.6    5e-20   
ref|XP_010680859.1|  PREDICTED: cytochrome P450 86B1-like             98.2    5e-20   
ref|XP_002892051.1|  CYP86A4                                          80.1    5e-20   
gb|AAY34261.1|  cytochrome P450                                       79.3    5e-20   
ref|XP_009111490.1|  PREDICTED: cytochrome P450 86A2                  80.9    5e-20   
ref|XP_003525390.1|  PREDICTED: cytochrome P450 86A8                  79.3    6e-20   
gb|KJB24757.1|  hypothetical protein B456_004G159000                  77.4    6e-20   
gb|KFK30522.1|  hypothetical protein AALP_AA7G273500                  98.2    6e-20   
ref|XP_002299820.2|  Cytochrome P450 86A1 family protein              70.9    6e-20   
ref|XP_007160078.1|  hypothetical protein PHAVU_002G290700g           79.0    6e-20   
ref|XP_006405349.1|  hypothetical protein EUTSA_v10028238mg           98.2    6e-20   
ref|XP_010520223.1|  PREDICTED: cytochrome P450 86A1                  73.2    7e-20   
ref|XP_009123569.1|  PREDICTED: cytochrome P450 86B1-like             97.8    7e-20   
gb|KEH40823.1|  cytochrome P450 family protein                        97.8    7e-20   
ref|XP_003607255.1|  Cytochrome P450                                  72.4    7e-20   
ref|XP_010432764.1|  PREDICTED: cytochrome P450 86B1-like             97.8    7e-20   
ref|XP_006828488.1|  hypothetical protein AMTR_s00060p00164420        70.1    8e-20   
ref|XP_002521476.1|  cytochrome P450, putative                        97.8    8e-20   
ref|XP_006649380.1|  PREDICTED: cytochrome P450 86B1-like             97.8    8e-20   
ref|XP_010104672.1|  Cytochrome P450 86A1                             75.5    8e-20   
ref|XP_008650864.1|  PREDICTED: cytochrome P450 86B1-like             97.8    8e-20   
ref|XP_006379954.1|  cytochrome P450 family protein                   74.3    8e-20   
ref|NP_195661.1|  cytochrome P450, family 96, subfamily A, polype...  97.8    8e-20   
ref|XP_010681074.1|  PREDICTED: cytochrome P450 86B1-like             97.8    8e-20   
ref|NP_191946.1|  cytochrome P450 86A2                                79.7    8e-20   
gb|KEH40818.1|  cytochrome P450 family protein                        97.8    8e-20   
emb|CAN80156.1|  hypothetical protein VITISV_023926                   79.0    8e-20   
ref|XP_006405739.1|  hypothetical protein EUTSA_v10028064mg           97.8    8e-20   
ref|XP_008458223.1|  PREDICTED: cytochrome P450 86A8-like             80.5    8e-20   
ref|XP_004138498.1|  PREDICTED: cytochrome P450 86A2-like             80.5    8e-20   
gb|EPS72790.1|  hypothetical protein M569_01963                       97.4    8e-20   
emb|CDY07223.1|  BnaCnng02380D                                        80.1    8e-20   
gb|AAL75903.1|  AT4g00360/A_IG005I10_21                               79.7    8e-20   
ref|XP_006405740.1|  hypothetical protein EUTSA_v10027725mg           97.8    9e-20   
gb|EAY78983.1|  hypothetical protein OsI_34090                        81.6    9e-20   
gb|KEH22137.1|  cytochrome P450 family protein                        97.4    9e-20   
ref|XP_007150924.1|  hypothetical protein PHAVU_004G006100g           97.4    9e-20   
ref|XP_004231497.1|  PREDICTED: cytochrome P450 86B1                  77.0    9e-20   
ref|XP_010541445.1|  PREDICTED: cytochrome P450 86A1-like             73.9    1e-19   
ref|XP_010087951.1|  Cytochrome P450 86A2                             76.6    1e-19   
ref|XP_011457419.1|  PREDICTED: cytochrome P450 86B1-like             75.1    1e-19   
ref|XP_009381852.1|  PREDICTED: cytochrome P450 86B1-like             97.4    1e-19   
ref|XP_002875027.1|  CYP86A2                                          79.7    1e-19   
ref|XP_006306153.1|  hypothetical protein CARUB_v10011665mg           97.4    1e-19   
ref|XP_003629932.1|  Cytochrome P450                                  97.1    1e-19   
ref|XP_010444891.1|  PREDICTED: cytochrome P450 86B1-like             94.0    1e-19   
emb|CBI21518.3|  unnamed protein product                              94.4    1e-19   
emb|CBH32607.1|  cytochrome P450, putative, expressed                 97.4    1e-19   
emb|CDM81753.1|  unnamed protein product                              97.4    1e-19   
ref|XP_004510774.1|  PREDICTED: cytochrome P450 86A2-like             76.3    1e-19   
ref|XP_010437945.1|  PREDICTED: cytochrome P450 86B1-like             97.1    1e-19   
ref|XP_008804035.1|  PREDICTED: cytochrome P450 86A8-like             74.3    1e-19   
emb|CBI40391.3|  unnamed protein product                              78.6    1e-19   
ref|XP_011025646.1|  PREDICTED: cytochrome P450 86B1-like             97.1    1e-19   
ref|XP_009631300.1|  PREDICTED: cytochrome P450 86B1-like             73.2    1e-19   



>dbj|BAF46296.1| cytochrome P450 [Ipomoea nil]
Length=525

 Score =   132 bits (332),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 8/114 (7%)
 Frame = +2

Query  41   VVAILCSILCWIWARQIWKKRSRRS---VFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            +  I+ S+ C++    I K R R S   V P NWP+VGM+PALL+NA R+HE+ T++L+ 
Sbjct  13   IFIIVLSLGCYM----ILKLRCRSSDDKVVPRNWPLVGMMPALLKNAHRVHEFATDVLKH  68

Query  212  SGGTFEIKGP-WFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            SGGTFE KGP  FAN  ML T DPAN++H+L +NF NYPKGP FRKIF +LG G
Sbjct  69   SGGTFEFKGPAAFANLSMLATSDPANIHHVLSKNFSNYPKGPEFRKIFDILGDG  122


 Score =   104 bits (259),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (63%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ NVDS+LWELHRKTT   +NH  F T L+ NV  K+E G+ PVL+ +A++G   DLQ
Sbjct  121  DGIFNVDSQLWELHRKTTLSFLNHAQFYTLLQTNVWHKVEKGLLPVLDWFAEEGAEFDLQ  180

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R +FD   +  L  D  SLC+      P  +A    V+A+LYR I PE
Sbjct  181  DVFQRFTFDAISKLVLHHDPESLCLG-LPYVPCEKAFNHAVDALLYRHIFPE  231



>ref|XP_009802093.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=519

 Score =   121 bits (304),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = +2

Query  23   FKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTEL  202
            F  S +++ +  S   W +  + W K S     PTNWP+VGMLP L++NA R+H++ T +
Sbjct  6    FSLSLLIIIMCFSYSTWWYLTKGWCKSS----VPTNWPLVGMLPGLIRNAHRVHDFATSI  61

Query  203  LRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            L E+GGTFE  GP   N +ML T DPAN++H+L +NF NYPKG  F+KIF +LG G
Sbjct  62   LVETGGTFEFYGPVLTNSNMLATSDPANIHHVLSKNFSNYPKGLEFQKIFDILGNG  117


 Score =   112 bits (281),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ NVDSELWE+HRKTT  LM+H  F+T LERN+    E G+ P+L+ +A+QGT  DLQ
Sbjct  116  NGIFNVDSELWEIHRKTTMSLMSHAKFQTLLERNMWDTFEKGLQPILDTFAEQGTPFDLQ  175

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPECC  705
            +IF R +FD   +  LD D  SL +      P  +A  D V+A+LYR ILPE C
Sbjct  176  DIFQRFTFDAISKLLLDHDPKSLSIG-LPHVPCEKAFNDAVDALLYRHILPEGC  228



>ref|XP_009603547.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=512

 Score =   122 bits (306),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 79/112 (71%), Gaps = 5/112 (4%)
 Frame = +2

Query  44   VAILCSILCWIWARQIW---KKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            +++L  I+C+ ++   W    KR  +S  PTNWP+ GMLP L++NA RIH++ T +L E+
Sbjct  8    LSLLIIIVCFTYS--TWWYLTKRWCKSSTPTNWPLFGMLPGLIRNAHRIHDFATSILMET  65

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GGTFE  GP   N +MLVT DPAN++HIL +NF NYPKG  F+KIF +LG G
Sbjct  66   GGTFEFYGPVLTNLNMLVTSDPANIHHILSKNFSNYPKGLEFQKIFDILGNG  117


 Score =   109 bits (272),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ NVDSELWE+HRKTT  LM+H  F+T LERN+   +E G+ P+L+ +A+QGT  DLQ
Sbjct  116  NGIFNVDSELWEIHRKTTMSLMSHAKFQTLLERNMWDTIEKGLRPILDTFAEQGTPFDLQ  175

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPECC  705
            +IF R +FD   +  LD D  SL +      P  +A  D V+A+LYR +LP+ C
Sbjct  176  DIFQRFTFDAISKLLLDHDPKSLSIG-LPHVPCEKAFNDIVDALLYRHVLPKGC  228



>ref|XP_011095825.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=492

 Score =   132 bits (332),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  101  RSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDP  280
            R  +S  PTNWP++ M+PALL+N  R+H++ TELL +SGGT+  KGPWF+N DML T DP
Sbjct  16   RKEKSSLPTNWPILDMIPALLKNIDRLHQFKTELLEQSGGTYMFKGPWFSNTDMLFTCDP  75

Query  281  ANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            AN++H+  +NF NYPKGP FRKIF +LG G
Sbjct  76   ANIHHVFSKNFSNYPKGPEFRKIFEILGDG  105


 Score = 99.4 bits (246),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D ELWE+HR+TT  L+ H  F +SLE  V  K+E G+ PVL  + +QG  VDLQ
Sbjct  104  DGIFNADFELWEIHRRTTISLLTHSKFHSSLESTVWGKVETGLLPVLASFCKQGAEVDLQ  163

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            +IF R +FD   +  LD D  SLCV+     P  +A    V  +L R I+PE
Sbjct  164  DIFQRFTFDNICKVVLDFDPSSLCVE-LPHIPCEKAFSHSVEPLLLRHIVPE  214



>ref|XP_011095704.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=503

 Score =   130 bits (328),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  107  RRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPAN  286
            R+S  PTNWP++GMLP LL+ + RIH   T+L+ ESGGTFE KGPWF N DML+T DPAN
Sbjct  29   RKSSGPTNWPLLGMLPWLLRISRRIHSSATQLMNESGGTFEFKGPWFCNMDMLITCDPAN  88

Query  287  VNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            ++HI  RNF NYPKGP FRKIF VLG G
Sbjct  89   IHHIFSRNFSNYPKGPEFRKIFDVLGDG  116


 Score = 97.8 bits (242),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 66/112 (59%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D ELWELHR+TT    +H  F T L R V  K+E  + PVL+ + +QG  VDLQ
Sbjct  115  DGIFNADFELWELHRRTTLSFFSHARFHTLLGRAVWGKVETALLPVLDSFLEQGVAVDLQ  174

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            +IF R SFD   +  LD D  SL +D     P  +A    + A+LYR ILPE
Sbjct  175  DIFQRFSFDNICKLVLDYDPQSLSID-LPYVPCEKAFNGAIEALLYRHILPE  225



>gb|EYU27552.1| hypothetical protein MIMGU_mgv1a004751mg [Erythranthe guttata]
Length=511

 Score =   134 bits (337),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIWARQIWK-KRSRRSVFPTNWPVVGMLPALLQNAGRIHEY  190
            M IF+   + + +L +++ ++    +W+ K  +++  PTNWP+VGMLP +LQN+ RIH+Y
Sbjct  1    MAIFEYPEIFLFLLPAMILFL----VWRTKTQKKTSLPTNWPLVGMLPGILQNSHRIHDY  56

Query  191  VTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             T++L ESGGTF+ K P   N DMLVT DPAN++HI  RNF NYPKGP FRKIF +LG G
Sbjct  57   ATDILSESGGTFQFKFPGVFNMDMLVTCDPANIHHIFSRNFSNYPKGPEFRKIFEILGDG  116


 Score = 92.0 bits (227),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 6/117 (5%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHY-AQQGTH---  531
            DG+ N D ELWELHR+TT   +NH  F + LE +V  K+  G+ PVL+   A+QG +   
Sbjct  115  DGIFNADFELWELHRRTTLAFLNHTKFYSLLESSVWGKVGTGLLPVLDDLIAKQGANNSH  174

Query  532  -VDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
             VDLQ++F R++FD   +  LD D  SL VD     P  +A  D V A+LYR +LPE
Sbjct  175  EVDLQDVFQRLTFDNICKLVLDYDPCSLSVD-MPYIPSEKAFNDAVEALLYRHVLPE  230



>emb|CDP22261.1| unnamed protein product, partial [Coffea canephora]
Length=217

 Score =   136 bits (342),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = +2

Query  2    VRYTMRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRI  181
            + Y+++ + E+   +     + C+ ++   + +R R S  PTNWPV+GM+P L++N+ R+
Sbjct  1    MAYSIQSYLETLPALFCFIFLFCYYYS---FSRRWRNSSLPTNWPVIGMMPGLVRNSHRL  57

Query  182  HEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVL  361
             EY TE+L+ESGGTFE  GPWFAN  M++T DPAN+++IL +NF NYPKGP FRKIF +L
Sbjct  58   QEYGTEILKESGGTFEANGPWFANMHMVLTCDPANIHYILSKNFSNYPKGPEFRKIFDIL  117

Query  362  GMG  370
            G G
Sbjct  118  GDG  120


 Score = 85.5 bits (210),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS+LWE HR+ T  LM+H +F   LE  V  K+E G+ PVL++ A+ G+ +DLQ
Sbjct  119  DGIFNADSQLWETHRRVTLSLMHHPSFLKLLEVTVWDKVEKGLLPVLQNCAKTGSQLDLQ  178

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD  621
            +IF R +FD   +  LD D GSL +D
Sbjct  179  DIFQRFAFDSISKLVLDHDPGSLSLD  204



>gb|EYU27551.1| hypothetical protein MIMGU_mgv1a027070mg [Erythranthe guttata]
Length=508

 Score =   124 bits (310),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +2

Query  89   IWKKRS-RRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDML  265
            +W+ ++  ++  PTNWP+VGMLPA+LQN  RI  Y TE+L ESGGTF++K P   N DML
Sbjct  24   VWRTKTPAKTSLPTNWPLVGMLPAILQNCHRIQPYFTEILTESGGTFQLKFPRVFNMDML  83

Query  266  VTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +T  PAN++HI  RNF NYPKGP FRK+F +LG G
Sbjct  84   LTSHPANIHHIFSRNFSNYPKGPEFRKVFEILGDG  118


 Score = 89.7 bits (221),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 7/115 (6%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D ELWELHR+TT   +NH  F   LE +V +K+E G+ PVL+ +++     D Q
Sbjct  117  DGIFNADFELWELHRRTTLSFLNHSEFYGLLESSVWEKVETGLLPVLDDFSENRASFDFQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPIL---EAIRDGVNAILYREILPE  699
            ++F R +FD   +  LD D  SLC     D P +   +A      A+LYR +LPE
Sbjct  177  DVFQRFAFDSICRLVLDHDPRSLC----RDLPYVASEKAFNGTTQALLYRHLLPE  227



>gb|AJD25225.1| cytochrome P450 CYP96A85 [Salvia miltiorrhiza]
Length=502

 Score =   114 bits (286),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +2

Query  86   QIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDML  265
            ++  +R ++   PT+WP++GMLP ++ N  R+H+Y+T +L   GGT+  +GP F N DML
Sbjct  20   RLADRRGKKPPEPTDWPLIGMLPRVILNFHRVHDYITSVLTVCGGTYMFRGPCFFNIDML  79

Query  266  VTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             T DPAN++H+  RNF NYPKGP FRKIF +LG G
Sbjct  80   FTSDPANIHHVFSRNFSNYPKGPEFRKIFDILGDG  114


 Score = 95.5 bits (236),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+   D ELWE+HRKTT   + H +F   LER V  K+E G+ PVL+H+  +G  +DLQ
Sbjct  113  DGIFGADFELWEIHRKTTLAQLTHADFNAQLERAVWHKVETGLLPVLDHFCAEGKDLDLQ  172

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R +FD   +  LD D  SLC+D   D P  +A       +L+R ++P+
Sbjct  173  DVFQRFTFDNICKIVLDYDPCSLCLD-MPDLPCEKAFSVAAEPLLHRHVIPQ  223



>ref|XP_011031168.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=518

 Score =   128 bits (322),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 80/120 (67%), Gaps = 9/120 (8%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFP-TNWPVVGMLPALLQNAGRIHEY  190
            M I +  ++++A++C +L   W R         +V P TNWPVVGMLP LL  A  +HEY
Sbjct  1    MAILEYFHIIIALVCILLFCHWCRN--------TVSPVTNWPVVGMLPGLLFQAQNVHEY  52

Query  191  VTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             T+LL++SGGTFE KGPWFAN ++ +T DP NV HI  +NF NYPKGP ++KIF   G G
Sbjct  53   ATQLLKQSGGTFEFKGPWFANMNIFLTADPLNVRHISTKNFVNYPKGPEYKKIFEPFGDG  112


 Score = 69.7 bits (169),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG++N D E W+  RK    ++  + F+  LER++ +K+  G+ PVLEH ++Q   +D+Q
Sbjct  111  DGVLNSDFESWKSFRKLIHSMIKDNKFQVFLERSLREKIVKGLIPVLEHVSRQEIELDMQ  170

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R +FD      L  D  SL VD   +     A  D   A  YR I+PE
Sbjct  171  DVFQRFTFDNICLLVLGFDPQSLSVD-LPEIAYKTAFDDVEEAAFYRHIVPE  221



>ref|XP_006470474.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
Length=510

 Score =   103 bits (257),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 69/111 (62%), Gaps = 9/111 (8%)
 Frame = +2

Query  41   VVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVT-ELLRESG  217
            +++ L  +L W W        S R+    NWPV+GMLP LL N    HE++  ++L+++ 
Sbjct  7    LISFLIIVLHWSW--------SDRNSPMRNWPVLGMLPGLLANTWHFHEFLAHDVLKKNR  58

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GTFE  GPWFA  D+++T DP NV++I  +NF NYPKGP FR I   LG G
Sbjct  59   GTFEFTGPWFAQMDLIITSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDG  109


 Score = 84.0 bits (206),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 66/115 (57%), Gaps = 3/115 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG++N D +LW++ RK    +M H+ F ++LE+   QKME G+ PVL+H ++ GT VDLQ
Sbjct  108  DGVLNADGDLWKIQRKIIHSVMKHNKFESALEKVAHQKMETGLIPVLDHASELGTVVDLQ  167

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPECC  705
            ++  R +FD      L  D   L V+ P   +    A      A+LYR I+P+ C
Sbjct  168  DVLKRFAFDNICMLVLGIDPNYLSVEFPQTVYA--NAFNTMEQALLYRHIVPKIC  220



>gb|KDO37689.1| hypothetical protein CISIN_1g047842mg [Citrus sinensis]
Length=465

 Score =   102 bits (254),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 69/111 (62%), Gaps = 9/111 (8%)
 Frame = +2

Query  41   VVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVT-ELLRESG  217
            +++ L  +L W W        S R+    NWPV+GMLP LL N    HE++  ++L+++ 
Sbjct  7    LISFLIIVLHWSW--------SDRNSPMRNWPVLGMLPGLLANTWYFHEFLAHDVLKKNR  58

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GTFE  GPWFA  D+++T DP NV++I  +NF NYPKGP FR I   LG G
Sbjct  59   GTFEFTGPWFAQMDLIITSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDG  109


 Score = 84.3 bits (207),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 66/115 (57%), Gaps = 3/115 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG++N D +LW++ RK    +M H+ F ++LE+   QKME G+ PVL+H ++ GT VDLQ
Sbjct  108  DGVLNADGDLWKIQRKIIHSVMKHNKFESALEKVAHQKMETGLIPVLDHASELGTVVDLQ  167

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPECC  705
            ++  R +FD      L  D   L V+ P   +    A      A+LYR I+P+ C
Sbjct  168  DVLKRFAFDNICMLVLGIDPNYLSVEFPQTVYA--NAFNTMEQALLYRHIVPKIC  220



>ref|XP_006446602.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
 gb|ESR59842.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
Length=519

 Score =   103 bits (257),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (65%), Gaps = 10/111 (9%)
 Frame = +2

Query  41   VVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVT-ELLRESG  217
            +++ L  +L W W+R   ++         N PV+GMLP LL N  R+HE++T ++L+++ 
Sbjct  16   LISFLIIVLHWGWSRNSLRR---------NRPVLGMLPGLLGNTWRLHEFLTHDVLKKNR  66

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GTFE  GPWFA  D+++T DP NV++I  +NF NYPKGP FR I   LG G
Sbjct  67   GTFEFTGPWFAQMDLIITSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDG  117


 Score = 79.3 bits (194),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 64/115 (56%), Gaps = 3/115 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D +LW++ RK    +M H+ F ++LE    QK+E G+ PVL+H ++ GT VDLQ
Sbjct  116  DGVFNADGDLWKIQRKIIHSVMKHNKFESALENVAHQKLETGLIPVLDHASELGTVVDLQ  175

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPECC  705
            ++  R +FD      L  +   L V+ P   +    A      A+LYR I+P+ C
Sbjct  176  DVLKRFAFDNICMLVLGINPNYLSVEFPQTVYA--NAFNTMEQALLYRHIVPKIC  228



>ref|XP_006370230.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
 gb|ERP66799.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
Length=519

 Score =   119 bits (298),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = +2

Query  29   ESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLR  208
            E + ++A++  ++C++  R  W +  +      NWP+VGMLP LL N+  ++EY T  LR
Sbjct  2    EIFDILAVVGVLVCFLLLR-CWDQIRKLDADKRNWPIVGMLPRLLINSSNVYEYTTRTLR  60

Query  209  ESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             +GGT + KGPWFAN D ++T DP NV+HIL  NF NYPKGP ++KIF  LG G
Sbjct  61   NNGGTSKFKGPWFANMDFVITSDPKNVHHILSDNFANYPKGPVYKKIFEPLGDG  114


 Score = 62.8 bits (151),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 61/115 (53%), Gaps = 5/115 (4%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTH--VD  537
            DG++N DSE W   RK     M ++ ++  +E+ + QK+  G+FP+L+H +++     +D
Sbjct  113  DGILNSDSESWRAQRKMIQLFMKNNKYKELVEKTILQKLVQGLFPILDHVSRKEMSEIID  172

Query  538  LQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            +Q++  R  +D +    L  D   L ++ P   H   +A      A+ YR I+PE
Sbjct  173  MQDVIQRFMYDSNCMSVLGFDPNCLTIEFPEVAHA--KAFDIMEEAVFYRHIVPE  225



>gb|KDO55118.1| hypothetical protein CISIN_1g036278mg, partial [Citrus sinensis]
Length=316

 Score = 99.0 bits (245),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +2

Query  128  NWPVVGMLPALLQNAGRIHEYVT-ELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILC  304
            N PV+GMLP LL N  R+HE++T ++L++  GTFE  GPWFA  D+++T DP NV++I  
Sbjct  3    NRPVLGMLPGLLGNTWRLHEFLTHDVLKKKRGTFEFTGPWFAQMDLIITSDPMNVHYISS  62

Query  305  RNFQNYPKGPRFRKIFHVLGMG  370
            +NF NYPKGP FR I   LG G
Sbjct  63   KNFSNYPKGPDFRMIMEPLGDG  84


 Score = 82.8 bits (203),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 65/115 (57%), Gaps = 3/115 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D +LW++ RK    +M H  F +++E+   QK+E G+ PVL+H ++ GT VDLQ
Sbjct  83   DGVFNADGDLWKIQRKIIHSVMKHKKFESAVEKVAHQKLETGLIPVLDHASELGTVVDLQ  142

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPECC  705
            ++  R +FD      L  +   L V+ P   +    A      A+LYR I+P+CC
Sbjct  143  DVLKRFAFDNICMLVLGINPNYLSVEFPQTVYA--NAFNAMEQAVLYRHIVPKCC  195



>ref|XP_004968446.1| PREDICTED: cytochrome P450 86B1-like [Setaria italica]
Length=506

 Score =   112 bits (280),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 73/107 (68%), Gaps = 3/107 (3%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            ++ S+ C++    ++ + +RR   PTNWPV+G LPA+  NAGR+HE+VTE L  +G ++ 
Sbjct  17   LMVSLACFLL---LFHRLNRRDGLPTNWPVIGALPAITINAGRVHEWVTEFLCAAGLSYV  73

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            I+GPW +  D++VT DPANV H+   NF NYPKG  F  +F VLG G
Sbjct  74   IEGPWGSPVDVVVTADPANVAHVFTTNFANYPKGKEFTALFDVLGGG  120


 Score = 67.4 bits (163),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 3/111 (3%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQE  546
            G+ N D E W   R+    L++   FR ++  + ++K+  G+ P+L+  A  G  VD+Q+
Sbjct  120  GIFNADGEWWAFQRRKAHALLSDARFRAAVAASTARKLREGLVPLLDGLAASGATVDMQD  179

Query  547  IFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAIL-YREILP  696
            +F R++FD++       D G  C+ P        A  D +  +L YR + P
Sbjct  180  VFVRLTFDLTAMFVFGVDPG--CLAPGFPFVPFAAAMDTIEEVLFYRHVTP  228



>ref|XP_009101866.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=505

 Score =   104 bits (260),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 5/109 (5%)
 Frame = +2

Query  44   VAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGT  223
            +AILC ++ +     ++KK   R  FP NWPV+GMLP LL +  R+++Y  E+L  S  T
Sbjct  11   MAILCFLILFYL---LFKKPHDR--FPRNWPVLGMLPGLLVSLHRLYDYSVEILEISDLT  65

Query  224  FEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            F +KGP F   DMLVT DPAN++HI+  NF NY KGP F  +F V G G
Sbjct  66   FLLKGPRFFGMDMLVTVDPANIHHIMSSNFSNYIKGPEFHDVFDVFGDG  114


 Score = 73.6 bits (179),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 63/111 (57%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG++  DSELW   R++   +++H  F+      ++ K+++G+ P+L H+A++GT VDLQ
Sbjct  113  DGILTADSELWRNLRRSYQAMVHHQGFQKFSVSTMTSKLKDGLVPLLNHFAEEGTTVDLQ  172

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++F R +FD         D  SL ++   D  + +A+ D    + YR I P
Sbjct  173  DLFGRFTFDTILILITGSDPKSLSIEMHEDE-LAKALEDVGEGVFYRHIKP  222



>ref|XP_006301857.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
 gb|EOA34755.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
Length=497

 Score =   111 bits (278),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S + V I+  +  +++      K+SR S    NWP++GMLP LL    RI +   E+L  
Sbjct  5    SLLEVVIIAFLSFFVFQCFFLHKKSRESPLLKNWPILGMLPGLLVRIPRIFDCTAEVLEA  64

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            S  TF IKG W +  D+L+T DP N+NHIL  NF+NYPKGP FRKIF +LG G
Sbjct  65   SNLTFAIKGAWLSGTDLLLTADPRNINHILSSNFRNYPKGPEFRKIFDILGDG  117


 Score = 64.7 bits (156),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNH-DNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDL  540
            DG++  DSELWE  RK+   + +H D    SL  NVS K++ G+ P L++ A +   +DL
Sbjct  116  DGILAADSELWEDLRKSGHTIFHHQDILEISLSSNVS-KLKKGLIPFLDNAADKNIIIDL  174

Query  541  QEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPECC  705
            Q++  R  FD +       D  SL V+   +    EA+ DG  A+ YR I P+  
Sbjct  175  QDVLQRFMFDTASILMTGYDPMSLSVE-MPEVEFGEAVEDGEEALFYRNIKPKIL  228



>ref|XP_004160508.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
sativus]
Length=511

 Score =   103 bits (256),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S ++ A +   L +I   +IW+      + P NWP+VGM P ++ +  R H+ VTE+L++
Sbjct  7    SSILFAFIIPFLVFIILSRIWR-WDFHGIIPWNWPIVGMTPTVIAHIHRPHDRVTEVLQQ  65

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +  TF  KG WF+  D L T DP+N++HIL  NF+ YPKGP F+ IF VLG G
Sbjct  66   TAFTFFFKGIWFSGMDFLFTVDPSNIHHILSANFERYPKGPDFKYIFEVLGDG  118


 Score = 71.2 bits (173),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L+ H NF   LE+    K++ G+ P+L+   + G+ +DLQ
Sbjct  117  DGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNKVKTGLVPILDSVCENGSVLDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPECC  705
            ++F R SFD +       DL SL ++   + P  +A+ D    I  R   P+  
Sbjct  177  DLFQRFSFDSTCMMVTGFDLNSLSLE-FPEVPFSKAMDDAEEVIFVRHFFPKTI  229



>gb|KGN48432.1| hypothetical protein Csa_6G487530 [Cucumis sativus]
Length=511

 Score =   103 bits (256),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S ++ A +   L +I   +IW+      + P NWP+VGM P ++ +  R H+ VTE+L++
Sbjct  7    SSILFAFIIPFLVFIILSRIWR-WDFHGIIPWNWPIVGMTPTVIAHIHRPHDRVTEVLQQ  65

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +  TF  KG WF+  D L T DP+N++HIL  NF+ YPKGP F+ IF VLG G
Sbjct  66   TAFTFFFKGIWFSGMDFLFTVDPSNIHHILSANFERYPKGPDFKYIFEVLGDG  118


 Score = 71.2 bits (173),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L+ H NF   LE+    K++ G+ P+L+   + G+ +DLQ
Sbjct  117  DGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNKVKTGLVPILDSVCENGSVLDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPEC  702
            ++F R SFD +       DL SL ++   + P  +A+ D    I  R   P+ 
Sbjct  177  DLFQRFSFDSTCMMVTGFDLNSLSLE-FPEVPFSKAMDDAEEVIFVRHFFPKT  228



>ref|XP_004151191.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=481

 Score =   103 bits (256),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S ++ A +   L +I   +IW+      + P NWP+VGM P ++ +  R H+ VTE+L++
Sbjct  7    SSILFAFIIPFLVFIILSRIWR-WDFHGIIPWNWPIVGMTPTVIAHIHRPHDRVTEVLQQ  65

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +  TF  KG WF+  D L T DP+N++HIL  NF+ YPKGP F+ IF VLG G
Sbjct  66   TAFTFFFKGIWFSGMDFLFTVDPSNIHHILSANFERYPKGPDFKYIFEVLGDG  118


 Score = 71.2 bits (173),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L+ H NF   LE+    K++ G+ P+L+   + G+ +DLQ
Sbjct  117  DGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNKVKTGLVPILDSVCENGSVLDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R SFD +       DL SL ++   + P  +A+ D    I  R   P+
Sbjct  177  DLFQRFSFDSTCMMVTGFDLNSLSLE-FPEVPFSKAMDDAEEVIFVRHFFPK  227



>ref|XP_002322211.1| hypothetical protein POPTR_0015s09840g [Populus trichocarpa]
 gb|EEF06338.1| hypothetical protein POPTR_0015s09840g [Populus trichocarpa]
Length=508

 Score =   108 bits (270),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 4/105 (4%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            +++A LC I  W+  R  W+ RS   +   NWPVVGMLP L +N+ R+HE+VT +LR+ G
Sbjct  2    LLLAFLCIIFLWLSFRW-WRNRSSVII---NWPVVGMLPGLFRNSSRVHEFVTYVLRQCG  57

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF  352
            GTF  KGPWF   D LVT +PANV+HIL +   NY KG  F++IF
Sbjct  58   GTFVFKGPWFGGLDFLVTSNPANVHHILRKKAFNYHKGLEFKEIF  102


 Score = 64.7 bits (156),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 59/112 (53%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+   D + W+  R+T    + +  F  + ERN+ +K+ +G+F +LEH+++Q   VD+Q
Sbjct  108  NGIFCADGDRWKTQRRTIHSFIKNSKFEEAAERNIQRKVLHGIFVILEHFSEQRKEVDMQ  167

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R  FD S    L  D  SL ++     P  +A  D    IL R + P+
Sbjct  168  DVLKRFMFDYSCLLLLGFDPNSLSIE-FRQVPYKQAYYDMEEVILQRHLKPQ  218



>ref|XP_004160509.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48433.1| hypothetical protein Csa_6G487540 [Cucumis sativus]
Length=511

 Score =   107 bits (268),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 70/110 (64%), Gaps = 6/110 (5%)
 Frame = +2

Query  41   VVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGG  220
            ++  L  I C IW      +R+     P NWP+VGM P+++ +  R H+ +TE+++E G 
Sbjct  15   IILFLFIIFCRIW------RRNFHGAVPWNWPIVGMTPSVVTHIHRSHDRITEVIQEVGS  68

Query  221  TFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            TF  KG WF+  D L+T DP+N++HIL  NF+ YPKGP F+ IF VLG G
Sbjct  69   TFFFKGVWFSGMDFLLTADPSNIHHILSANFERYPKGPDFKYIFEVLGDG  118


 Score = 64.7 bits (156),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (52%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS  W+  RKT   L++ + F   LE+    K++ G+ PVL+   + G+ +DLQ
Sbjct  117  DGIFNSDSYAWKDQRKTARSLVHDEKFLQFLEKITLNKVKTGIVPVLDGVCENGSVLDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R SFD +       DL SL ++     P  +A+ D    I  R   P+
Sbjct  177  DLFQRFSFDSTCMMVTGFDLQSLSLESPAV-PFSKAMDDVEEVIFLRHFFPK  227



>ref|XP_009101865.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=518

 Score = 97.4 bits (241),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 3/107 (3%)
 Frame = +2

Query  53   LCSILCW-IWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            L +ILC+ I    ++KKR  R  F  N PV+ MLP LL    RIH++  ++L  SG TF 
Sbjct  27   LFTILCFLILHYLLFKKRYVR--FLRNLPVLRMLPGLLMTLHRIHDFTVKILEFSGMTFL  84

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             KGP FA  DML+T DP N++HI+  NF NY KGP  ++IF V G G
Sbjct  85   FKGPPFAGMDMLLTADPDNIHHIMSSNFSNYIKGPGLQEIFDVFGDG  131


 Score = 73.9 bits (180),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+   DSE+W+  RK+   +++H  F+      ++ K+++G+ P+L H+A++GT VDLQ
Sbjct  130  DGIFTTDSEMWKNLRKSIQSMLHHQEFQRFSMSTMTSKLKSGLVPLLNHFAEEGTAVDLQ  189

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++F R++FD +       D  SL ++   D  + +A+ D    IL R + P
Sbjct  190  DVFGRLTFDTTLILITGSDPRSLSIELHEDE-LAKALDDTGKGILSRHVKP  239



>ref|XP_011005604.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=508

 Score =   104 bits (259),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 4/105 (4%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            ++VA LC    W+  R  W+ +S   +   NWPVVGMLP L +N+ R+HE+VT LL++ G
Sbjct  2    LLVAFLCITFLWLSFRW-WRNKSSVII---NWPVVGMLPGLFRNSSRVHEFVTYLLQQRG  57

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF  352
            GTF  KGPWF   D LVT +PANV+HIL +   NY KG   ++IF
Sbjct  58   GTFVFKGPWFGGLDFLVTSNPANVHHILRKKAFNYHKGLELKEIF  102


 Score = 66.6 bits (161),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+   D + W+  R+T    + +  F  ++ERN+ +K+ +G+F +LEH+++Q   VD+Q
Sbjct  108  NGIFCADGDRWKTQRRTIHSFIKNSKFEEAVERNIQRKVLHGIFVILEHFSEQRKEVDMQ  167

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R  FD S    L  D  SL ++     P ++A  D    IL R + P+
Sbjct  168  DVLKRFMFDYSCLLLLGFDPNSLSIE-FPQVPYMQAYYDMEEIILQRHLKPQ  218



>ref|XP_008440138.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=511

 Score = 98.6 bits (244),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +2

Query  116  VFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNH  295
            + P NWP+VGM P ++ +  R H+ VTE+L+++  TF  KG WF+  D L T DP+N++H
Sbjct  34   IIPWNWPIVGMTPTVIAHFHRPHDRVTEVLQQTAFTFFFKGIWFSGTDFLFTVDPSNIHH  93

Query  296  ILCRNFQNYPKGPRFRKIFHVLGMG  370
            IL  NF+ YPKGP F+ IF VLG G
Sbjct  94   ILSANFERYPKGPDFKYIFEVLGDG  118


 Score = 72.0 bits (175),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 63/113 (56%), Gaps = 1/113 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L+ H++F   LE+    K++ G+ PVL+   + G+ +DLQ
Sbjct  117  DGIFNSDSDVWKSQRKTAHHLVRHESFLQFLEKITLNKVKTGLVPVLDSVCENGSVLDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPEC  702
            ++F R SFD +       DL SL ++ + + P  +A+ D    I  R   P+ 
Sbjct  177  DLFQRFSFDSTCMMVTGFDLHSLSLE-SPEVPFSKAMDDAEEVIFLRHFFPKT  228



>ref|XP_007031595.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY02521.1| Cytochrome P450, putative [Theobroma cacao]
Length=494

 Score =   102 bits (255),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +2

Query  101  RSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDP  280
            R+R+S   TNWP+VGMLP LL +A RI  ++ + +R+SGGT EI+GPWF +   ++T D 
Sbjct  24   RNRKSPPITNWPIVGMLPGLLYSARRIFAFLNDCVRQSGGTCEIRGPWFPSLYFIITADH  83

Query  281  ANVNHILCRNFQNYPKGPRFRKI-FHVLGMG  370
             N NHILC+NF NY KG  F +I F  LG G
Sbjct  84   MNANHILCKNFDNYEKGSEFNEIFFDCLGEG  114


 Score = 67.8 bits (164),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ N +S  W+  RK    LM  D F    +R + +K+E  +  VLEH+ + G  VDLQ
Sbjct  113  EGIFNSNSHSWKSQRKVMLLLMKDDKFVLHFQRILREKLEKSLIIVLEHFMKLGIEVDLQ  172

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++  R S+D+     +  D  SL V+   + PI  A       +LYR ++P
Sbjct  173  DVLQRFSYDVVCMLAVGFDPSSLSVE-LSEVPIKTAFTQAEERLLYRHLMP  222



>ref|XP_008440139.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Cucumis melo]
Length=510

 Score =   102 bits (255),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 67/101 (66%), Gaps = 6/101 (6%)
 Frame = +2

Query  68   CWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWF  247
            C IW      +R+     P NWP++GM P+++ +  R H+ +TE+++E+G TF  KG WF
Sbjct  24   CRIW------RRNFHGAVPWNWPIIGMTPSVVTHFYRSHDRITEVIQEAGSTFFFKGVWF  77

Query  248  ANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +  D L+T DP+N++HIL  NF+ YPKGP F+ IF VLG G
Sbjct  78   SGMDFLLTVDPSNIHHILSANFERYPKGPDFKYIFEVLGDG  118


 Score = 67.0 bits (162),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS  W+  RKT   L++ +NF   LE+   +K++  + PVL+   + G+ +DLQ
Sbjct  117  DGIFNSDSYAWKDQRKTARSLVHDENFLQFLEKITLKKVKTALVPVLQSVCENGSVLDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R SFD +       DL SL ++   + P  +A+ D    I  R   P+
Sbjct  177  DLFQRFSFDSTCMMVTGFDLQSLSLE-FPEVPFSKAMDDAEEVIFLRHFFPK  227



>gb|EYU32453.1| hypothetical protein MIMGU_mgv1a005630mg [Erythranthe guttata]
Length=476

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +2

Query  92   WKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVT  271
            WKK S +   PTNWP+VGMLPA++QN  RIH+Y T +L E GGTFE KGPWF + DM+VT
Sbjct  31   WKKSSSK---PTNWPLVGMLPAVVQNLHRIHDYATTVLTECGGTFEFKGPWFCHVDMVVT  87

Query  272  GDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             DPAN++HI  RNF NYPKGP FRK+F +LG G
Sbjct  88   SDPANIHHIFSRNFSNYPKGPEFRKMFEILGDG  120


 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 76/125 (61%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N D ELWELHR+TT  ++ H  F   LE NV  K++ G+ PVL
Sbjct  106  KGPEFRKMFEILGDGIFNADFELWELHRRTTLSMLTHPEFPDFLEVNVWHKVQTGLLPVL  165

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +++A+ G + DLQ++F R++FD   +  L+ D  SLCVD     P  +A  D + A+LYR
Sbjct  166  DYFAENGDYFDLQDVFQRLTFDGICKLVLNYDPCSLCVD-LPYIPSEKAFNDAIEALLYR  224

Query  685  EILPE  699
             +LPE
Sbjct  225  HVLPE  229



>gb|KGN48434.1| hypothetical protein Csa_6G487550 [Cucumis sativus]
Length=509

 Score = 99.4 bits (246),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  86   QIWKKRSR-RSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDM  262
            +IW+  S      P NWP++GM+P L+ +  R+H+ + E+L ES   F  KG WF++ D 
Sbjct  25   RIWRWNSNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDF  84

Query  263  LVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            L+T DP+NVNHIL  +F+ YPKGP F  IF +LG G
Sbjct  85   LLTADPSNVNHILSVHFERYPKGPDFNYIFDILGDG  120


 Score = 70.1 bits (170),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L+ H++F   LE+   +K++ G+ PVL+   + G+ +DLQ
Sbjct  119  DGIFNSDSDVWKNQRKTALSLVGHESFHKFLEKITLKKVKEGLVPVLQSACENGSVLDLQ  178

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R SFD +       D  SL ++     P   A+ +    IL R + P+
Sbjct  179  DLFQRFSFDSTCLFVTGFDFHSLSLE-FPQVPFSRAVDEAEEVILIRHVFPK  229



>ref|XP_004142037.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score = 99.4 bits (246),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  86   QIWKKRSR-RSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDM  262
            +IW+  S      P NWP++GM+P L+ +  R+H+ + E+L ES   F  KG WF++ D 
Sbjct  25   RIWRWNSNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDF  84

Query  263  LVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            L+T DP+NVNHIL  +F+ YPKGP F  IF +LG G
Sbjct  85   LLTADPSNVNHILSVHFERYPKGPDFNYIFDILGDG  120


 Score = 70.1 bits (170),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L+ H++F   LE+   +K++ G+ PVL+   + G+ +DLQ
Sbjct  119  DGIFNSDSDVWKNQRKTALSLVGHESFHKFLEKITLKKVKEGLVPVLQSACENGSVLDLQ  178

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R SFD +       D  SL ++     P   A+ +    IL R + P+
Sbjct  179  DLFQRFSFDSTCLFVTGFDFHSLSLE-FPQVPFSRAVDEAEEVILIRHVFPK  229



>ref|XP_004173396.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score = 99.4 bits (246),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  86   QIWKKRSR-RSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDM  262
            +IW+  S      P NWP++GM+P L+ +  R+H+ + E+L ES   F  KG WF++ D 
Sbjct  25   RIWRWNSNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDF  84

Query  263  LVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            L+T DP+NVNHIL  +F+ YPKGP F  IF +LG G
Sbjct  85   LLTADPSNVNHILSIHFERYPKGPDFNYIFDILGDG  120


 Score = 70.1 bits (170),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L+ H++F   LE+   +K++ G+ PVL+   + G+ +DLQ
Sbjct  119  DGIFNSDSDVWKNQRKTALSLVGHESFHKFLEKITLKKVKEGLVPVLQSACENGSVLDLQ  178

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R SFD +       D  SL ++     P   A+ +    IL R + P+
Sbjct  179  DLFQRFSFDSTCLFVTGFDFHSLSLE-FPQVPFSRAVDEAEEVILIRHVFPK  229



>ref|XP_007031599.1| Cytochrome P450, family 96, subfamily A, polypeptide 1, putative 
[Theobroma cacao]
 gb|EOY02525.1| Cytochrome P450, family 96, subfamily A, polypeptide 1, putative 
[Theobroma cacao]
Length=508

 Score =   105 bits (261),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = +2

Query  44   VAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGT  223
            + IL +I   ++   +++ R    +  TNWP+VGMLP +L NA RI  +  + +R+SGGT
Sbjct  7    ILILAAIFFPLFLSYLYQNRKSPPI--TNWPIVGMLPGILYNARRIFAFSNDCVRQSGGT  64

Query  224  FEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKI-FHVLGMG  370
            FEI+GP F + D +VT D  N NHILC+NF NY KG  F +I F  LG G
Sbjct  65   FEIRGPCFPSLDFIVTADHTNANHILCKNFDNYEKGSEFNEIFFDCLGEG  114


 Score = 64.3 bits (155),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ N +S  W+  RK    LM  D F     R +  K+E  +  VLEH+ + G  VDLQ
Sbjct  113  EGIFNSNSHSWKSQRKVMLLLMKDDKFVLHFHRILRGKLEKSLIVVLEHFMKLGIEVDLQ  172

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++  R S+D+     +  D  SL V+   + PI  A+      +LYR ++P
Sbjct  173  DVLQRFSYDVVCLLAVGFDPCSLSVE-LSEVPIKTALIQAEERLLYRHLMP  222



>ref|XP_006446605.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
 gb|ESR59845.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
Length=509

 Score = 89.4 bits (220),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 13/111 (12%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            ++VA L  ++  +W+     KRS R+          ML  L+ NA ++HE+ T +L++S 
Sbjct  1    MIVAFLFILIGCLWSF----KRSSRT---------RMLSTLVLNAHQLHEFATRVLQKSR  47

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GT E KGPWFA  D ++T DP NV++I  +NF NYPKGP  R I    G G
Sbjct  48   GTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDG  98


 Score = 79.7 bits (195),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+   D  LW++ RK    +M H+ F ++LE+ + QK+ENG+ PVL+H ++ G  VDLQ
Sbjct  97   DGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQ  156

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            ++F R +FD      L  D   L  + P   +    A      A+ YR I+P+
Sbjct  157  DVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYA--NAFNATEQAVFYRHIVPK  207



>emb|CDY53177.1| BnaA06g40560D [Brassica napus]
Length=518

 Score = 94.7 bits (234),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 65/105 (62%), Gaps = 3/105 (3%)
 Frame = +2

Query  59   SILCW-IWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIK  235
            +I C+ I    ++KKR  R  F  N PV+ MLP LL    RIH++  ++L  SG TF  K
Sbjct  29   TIFCFLILYYLLFKKRYVR--FLRNLPVLRMLPGLLMTLHRIHDFTVKILEFSGMTFLFK  86

Query  236  GPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GP FA  DML+T DP N++HI+  NF NY KGP  ++IF V G G
Sbjct  87   GPPFAGMDMLLTADPDNIHHIMSSNFSNYIKGPGLQEIFDVFGDG  131


 Score = 72.4 bits (176),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+   DSE+W+  RK+   +++H  F+      ++ K+++G+ P+L H+A++G  VDLQ
Sbjct  130  DGIFTTDSEMWKNLRKSIQSMLHHQEFQRFSMSTMTSKLKSGLVPLLNHFAEEGAAVDLQ  189

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++F R++FD +       D  SL ++   D  + +A+ D    IL R + P
Sbjct  190  DVFGRLTFDTTLILITGSDPRSLSIELHEDE-LAKALDDTGKGILSRHVKP  239



>ref|XP_010470317.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=497

 Score =   104 bits (259),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +2

Query  98   KRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGD  277
            K+S+ +    NWP +GMLP+LL    R+ ++ TE+L  S  TF +KG WF   D+L T D
Sbjct  27   KKSQGNPLLKNWPFLGMLPSLLHQIPRLIDWTTEVLDVSDLTFALKGAWFTGTDLLFTAD  86

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            P N++HIL  NF+NYPKGP FRKIF +LG G
Sbjct  87   PRNLHHILSSNFRNYPKGPEFRKIFDILGDG  117


 Score = 62.4 bits (150),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 60/112 (54%), Gaps = 3/112 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNF-RTSLERNVSQKMENGMFPVLEHYAQQGTHVDL  540
            DG++  DSELWE  RK+   + +H +F   S+  NVS K++ G+ P L++ A +   +DL
Sbjct  116  DGILAADSELWEDLRKSGHTIFHHQDFLEISVSSNVS-KLKKGLVPFLDNAAGENIIIDL  174

Query  541  QEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            Q++F R  FD S       D  SL ++   +    EA+  G  AI YR   P
Sbjct  175  QDLFQRFMFDTSMILMTGYDPMSLSIE-MPEVEFGEAVDHGEEAIFYRHFKP  225



>gb|KDO37445.1| hypothetical protein CISIN_1g036716mg, partial [Citrus sinensis]
Length=208

 Score = 89.0 bits (219),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (58%), Gaps = 13/111 (12%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            ++VA L   +  +W+     KRS R+          ML  L+ NA ++HE+ T +L++S 
Sbjct  1    MIVAFLFIFIGCLWSF----KRSSRT---------RMLSTLVLNAHQLHEFATRVLQKSR  47

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GT E KGPWFA  D ++T DP NV++I  +NF NYPKGP  R I    G G
Sbjct  48   GTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDG  98


 Score = 77.0 bits (188),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+   D  LW++ RK    +M H+ F ++LE+ + QK+ENG+ PVL+H ++ G  VDLQ
Sbjct  97   DGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQ  156

Query  544  EIFHRISFD  570
            ++F R +FD
Sbjct  157  DVFQRFTFD  165



>ref|XP_010653011.1| PREDICTED: cytochrome P450 86B1-like [Vitis vinifera]
Length=478

 Score =   106 bits (264),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  122  PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHIL  301
            P NWP+VGMLP +L +   +HE  T++L  S GT  IKG WFAN DML T +P NV+H+L
Sbjct  3    PRNWPIVGMLPMILLHFHCMHEKYTKILELSKGTILIKGAWFANIDMLTTSNPDNVHHVL  62

Query  302  CRNFQNYPKGPRFRKIFHVLGMG  370
              NF NYPKGP+FR+IF++LG G
Sbjct  63   STNFSNYPKGPKFRRIFNILGNG  85


 Score = 59.7 bits (143),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (51%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ N D + W   R      +NH  F   + +     +EN + PVL++ +QQ   VDLQ
Sbjct  84   NGLFNSDFDEWRKIRGLAQGFVNHKQFHRFMAKINHDFLENKLVPVLDNASQQNLVVDLQ  143

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R+  D +       +  SLC+    + P L+A+ +   AI +R ++PE
Sbjct  144  DVFQRLMLDATCITATSYNPNSLCIG-FPEVPFLKALDNAGEAIFFRHLVPE  194



>ref|XP_006470473.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|KDO37420.1| hypothetical protein CISIN_1g043945mg [Citrus sinensis]
Length=518

 Score = 87.0 bits (214),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  146  MLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYP  325
            ML  L+ N  ++HE+ T +L++S GT E KGPWFA  D ++T DP NV++I  +NF NYP
Sbjct  33   MLSTLVLNTHQLHEFATRVLKKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYP  92

Query  326  KGPRFRKIFHVLGMG  370
            KGP  R I    G G
Sbjct  93   KGPDLRMILEPFGDG  107


 Score = 79.0 bits (193),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 62/123 (50%), Gaps = 23/123 (19%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+   D  LW++ RK    +M H  F ++LE+ + QK+ENG+ PVL+H ++ G  VDLQ
Sbjct  106  DGVFAADGNLWKMQRKMIHSVMKHKKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQ  165

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHP-----------ILEAIRDGVNAILYREI  690
            ++F R +FD            ++C+   G +P              A      A+ YR I
Sbjct  166  DVFQRFTFD------------NICMSVLGINPNYLSFEFPQVAYANAFNATEQAVFYRHI  213

Query  691  LPE  699
            +P+
Sbjct  214  VPK  216



>emb|CDM81752.1| unnamed protein product [Triticum aestivum]
Length=514

 Score = 97.1 bits (240),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEI-KGPWFANRDMLVTGDPANVNH  295
             PTNWPVVG +PA+  NAGR+HE++TE LR + G   + +GPW +  D+L+T +PA+V H
Sbjct  39   LPTNWPVVGSVPAITVNAGRVHEWLTEFLRVAPGMSHVARGPWGSPVDILLTANPADVAH  98

Query  296  ILCRNFQNYPKGPRFRKIFHVLGMG  370
            +   NF NYPKG  F  +F VLG G
Sbjct  99   VFTTNFGNYPKGEEFAALFDVLGNG  123


 Score = 68.6 bits (166),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ N D + W   R+    L++   FR ++  + ++K++ G+ P+L+  A  G  VDLQ
Sbjct  122  NGIFNADGDSWAFQRRKAHALLSDARFRAAVAASTARKLDEGLVPLLDGVAAGGAVVDLQ  181

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++F R++FD++       D G L  D     P   A+ +    + YR + P
Sbjct  182  DVFMRLTFDLTAMFIFGMDPGCLAAD-FPRVPFAAAMDEAEAVLFYRHVTP  231



>ref|XP_009589080.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 83/122 (68%), Gaps = 9/122 (7%)
 Frame = +2

Query  14   MRIFKESYVVVAILCS---ILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIH  184
            M   K S +++ ILC    I C++  R  W K S     PT WP VGMLPA++ N  RIH
Sbjct  1    MDFLKYSLLILIILCFTYFITCYL--RNRWTKTSA----PTYWPFVGMLPAIILNFHRIH  54

Query  185  EYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLG  364
            +Y+T++L E+GGTFE KGP FA  DML+T DPAN++HI  +NF NYPKGP FRKIF +LG
Sbjct  55   DYITKVLIETGGTFEFKGPIFAYMDMLITCDPANIHHIFSKNFSNYPKGPEFRKIFDILG  114

Query  365  MG  370
             G
Sbjct  115  NG  116


 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 79/127 (62%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ NVDSELWELHRKTT  +M+H  F+T LERN+   +E    P+L
Sbjct  102  KGPEFRKIFDILGNGIFNVDSELWELHRKTTMSIMSHAKFQTLLERNMWNIIEKRFRPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A+QG  +DLQ+I  R+SFD   +  LD D  SL +D     P  +A  D ++A+L+R
Sbjct  162  DAFAEQGNSLDLQDILQRLSFDSITKLLLDHDPRSLSID-FPHVPCEKAFTDAIDALLFR  220

Query  685  EILPECC  705
             I+PE C
Sbjct  221  HIIPESC  227



>emb|CDX72690.1| BnaC07g47120D [Brassica napus]
Length=507

 Score = 92.0 bits (227),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 3/107 (3%)
 Frame = +2

Query  53   LCSILCW-IWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            L +I C  I    ++KKR  R +   N PV+ MLP LL    R+H++  ++L  SG TF 
Sbjct  27   LFTIFCLLILHYLLFKKRYVRLL--RNLPVLRMLPGLLMTLHRVHDFTVKILEFSGMTFL  84

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             KGP FA  DML+T DP N++HI+  NF NY KGP  ++IF V G G
Sbjct  85   FKGPPFAGMDMLLTADPDNIHHIMSSNFSNYIKGPGLQEIFDVYGDG  131


 Score = 72.8 bits (177),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+   DSE+W+  RK++  +++H  F+      ++ K++ G+ P+L H+A +GT VDLQ
Sbjct  130  DGIFTTDSEMWKNLRKSSQAMLHHQEFQRFSVSTMTSKLKCGLVPLLNHFAVEGTAVDLQ  189

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++F R++FD +       D  SL ++   D  + +A+ D    IL R + P
Sbjct  190  DVFGRLTFDTTLILITGSDPSSLSIEMHEDE-LAKALDDTGKGILSRHVKP  239



>ref|XP_009782181.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 80/120 (67%), Gaps = 5/120 (4%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIW-ARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEY  190
            M   + S +++ ILC      W  R+ W K S     P  WP VGMLPA++ N   IH+Y
Sbjct  1    MDFLEYSLLLLIILCFTYFITWYLRKRWTKTSA----PIYWPFVGMLPAIILNFHHIHDY  56

Query  191  VTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +T++L E+GGTFE KGP FAN DML+T DPAN++HI  +NF NYPKGP FRKIF +LG G
Sbjct  57   ITKVLTETGGTFEFKGPIFANMDMLITCDPANIHHIFSKNFSNYPKGPEFRKIFDILGNG  116


 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ NVDSELWELHRK T  +M+H  F+T LE N+   M+  + P+L
Sbjct  102  KGPEFRKIFDILGNGIFNVDSELWELHRKITMSIMSHAKFQTLLENNMWGIMDKRLRPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A+QG   DLQ+I  R+SFD   +  LD D  SL +D     P  +A  D ++A+L+R
Sbjct  162  DVFAEQGNSFDLQDILQRLSFDSITKLLLDHDPRSLSID-VPHVPCEKAFTDAIDALLFR  220

Query  685  EILPECC  705
             I+PE C
Sbjct  221  HIMPESC  227



>ref|XP_004151610.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48431.1| hypothetical protein Csa_6G487520 [Cucumis sativus]
Length=521

 Score =   100 bits (248),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 75/121 (62%), Gaps = 0/121 (0%)
 Frame = +2

Query  8    YTMRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHE  187
            Y+  +F  + +++  +   +  ++   I +  +  +  P NWP++GM P ++ +  R+H+
Sbjct  8    YSAIVFALTAIIIVPIFLFIFLVYHNIIMRYWNYLATVPWNWPILGMTPTVIAHIHRVHD  67

Query  188  YVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGM  367
             +TE+++E G T+  KG WF+  D+L T D +N+NHIL  NF+ YPKGP F+ IF +LG 
Sbjct  68   RLTEVIQEVGSTYLFKGVWFSGMDLLFTVDTSNINHILSVNFERYPKGPDFKYIFDILGD  127

Query  368  G  370
            G
Sbjct  128  G  128


 Score = 61.6 bits (148),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W   RKT   L++   +   LE    +K++  + P+L+  ++ G+ +D Q
Sbjct  127  DGIFNSDSDVWRALRKTAYALVHDHKYLKFLETITLKKVKEELVPILQTVSENGSVLDFQ  186

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R+SFD++       DL SL +     H   +AI D    IL R   P+
Sbjct  187  DLFQRLSFDVTCMLVTGSDLHSLSLG--FRHLFSKAIDDVEEVILLRHFYPK  236



>ref|XP_009759324.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=509

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +2

Query  29   ESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLR  208
            E Y ++ +L  IL + +   ++  R  ++  PTNWP+VGMLP L+QNA RIH++ T++L 
Sbjct  2    EVYSIIPVLI-ILGFTYFTWLFINRRSKTSEPTNWPLVGMLPGLIQNAHRIHDFFTDILL  60

Query  209  ESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            E+G  FE  GP   N +ML T DPAN++HIL RNF NYPKGP FRKIF +LG G
Sbjct  61   ETGNNFEFYGPALGNMNMLFTSDPANIHHILSRNFSNYPKGPEFRKIFEILGNG  114


 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 77/126 (61%), Gaps = 1/126 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ NVDSELWE+HRK T  LM+H  F+  L++NV   +E G+ PVL
Sbjct  100  KGPEFRKIFEILGNGIFNVDSELWEIHRKITMSLMSHAKFQILLKKNVWNTVEKGLVPVL  159

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A++GT  DLQ+IF R +FD   +  LD D  SL +D     P  +   D V+A+LYR
Sbjct  160  DAFAERGTTFDLQDIFQRFTFDNISKLLLDCDPKSLFID-LPHLPCEKGFNDMVDALLYR  218

Query  685  EILPEC  702
             ++PE 
Sbjct  219  HVVPES  224



>ref|XP_004160507.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=521

 Score =   100 bits (249),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 75/121 (62%), Gaps = 0/121 (0%)
 Frame = +2

Query  8    YTMRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHE  187
            Y+  +F  + +++  +   +  ++   I +  +  +  P NWP++GM P ++ +  R+H+
Sbjct  8    YSAIVFALTAIIIVPIFLFIFLVYHNIIMRYWNYLATVPWNWPILGMTPTVIAHIHRVHD  67

Query  188  YVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGM  367
             +TE+++E G T+  KG WF+  D+L T D +N+NHIL  NF+ YPKGP F+ IF +LG 
Sbjct  68   RLTEVIQEVGSTYLFKGVWFSGMDLLFTVDTSNINHILSVNFERYPKGPDFKYIFDILGD  127

Query  368  G  370
            G
Sbjct  128  G  128


 Score = 61.2 bits (147),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 58/112 (52%), Gaps = 2/112 (2%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W   RKT   L++   +   LE    +K+   + P+L+  ++ G+ +D Q
Sbjct  127  DGIFNSDSDVWRALRKTAYALVHDHKYLKFLETITLKKVTEELVPILQTVSENGSVLDFQ  186

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R+SFD++       DL SL +     H   +AI D    IL R   P+
Sbjct  187  DLFQRLSFDVTCMLVTGSDLHSLSLG--FRHLFSKAIDDVEEVILLRHFYPK  236



>ref|XP_002862576.1| hypothetical protein ARALYDRAFT_920522 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38834.1| hypothetical protein ARALYDRAFT_920522 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score = 92.4 bits (228),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 64/107 (60%), Gaps = 0/107 (0%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S  ++ +  +I+C++   +   K+        NWPV+GM+P L     RI+++  ELL  
Sbjct  3    STSLIGVSIAIICFLILHRFLFKKPLYQFLIINWPVLGMIPGLFLVLHRIYDFTVELLES  62

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF  352
            +  TF  KGPWFA  DML+T DPAN+ +++  NF N+ KG  F++IF
Sbjct  63   TELTFPFKGPWFAGMDMLLTADPANIYYLVNSNFSNFVKGSNFKEIF  109


 Score = 68.2 bits (165),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 12/130 (9%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS+F E      D ++  DS  W+  RK +  ++NH  F+         K+++G+ P+ 
Sbjct  101  KGSNFKEIFDAFEDALLTKDSLAWKNLRKASQAMINHQGFQRLSLTTTRSKVKDGLVPLF  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTG---DHPILE---AIRDGV  666
             H A++GT VDLQ++F R +FD +            C DP     + P++E   A+   V
Sbjct  161  NHIAREGTTVDLQDVFWRFTFDTTLVTVTG------CDDPRSLSIEMPVIESAKALDTIV  214

Query  667  NAILYREILP  696
              I+YR + P
Sbjct  215  EGIVYRHVKP  224



>gb|EPS60789.1| hypothetical protein M569_14012, partial [Genlisea aurea]
Length=489

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +2

Query  92   WKKRSR-RSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLV  268
            WK   +  +  PTNWPVVGM PA L+N  R+H+++TE+L E GGTFE KGPW  N DML 
Sbjct  11   WKSSGKFATAVPTNWPVVGMWPAALRNCHRVHDFITEVLSECGGTFEFKGPWLCNMDMLF  70

Query  269  TGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            T DPAN++H+  RNF NYPKGP F KIF VLG G
Sbjct  71   TCDPANIHHVFSRNFANYPKGPEFMKIFDVLGNG  104


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 72/128 (56%), Gaps = 7/128 (5%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ N D ELW+ HRKTT   M    F   +E  V +K+E G+FPVL
Sbjct  90   KGPEFMKIFDVLGNGIFNADFELWKFHRKTTMGFMGSLEFSGLIEGIVWRKVEKGLFPVL  149

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE---AIRDGVNAI  675
            + +A+ G  VDLQ++F R +FD   +  LD D  SL V      P ++   A  D ++A+
Sbjct  150  DLFAETGDSVDLQDVFQRFTFDGICKVVLDFDPESLSV----GFPEIQCEKAFNDVIDAL  205

Query  676  LYREILPE  699
            LYR +LPE
Sbjct  206  LYRHVLPE  213



>ref|XP_002526301.1| heme binding protein, putative [Ricinus communis]
 gb|EEF36090.1| heme binding protein, putative [Ricinus communis]
Length=469

 Score = 96.3 bits (238),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  101  RSRRSVFPTNWPVVGMLPA-LLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGD  277
            +S ++  P NWP +GM P  +L N  R+ + + ELL  + GTF +KGPWF++ DMLVT D
Sbjct  25   KSNKNGLPRNWPFLGMSPMFILINLRRLPDKIAELLERNEGTFLLKGPWFSDVDMLVTSD  84

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLG  364
            PANV+++  +NF NYPKGP  +++F  LG
Sbjct  85   PANVHYVTTKNFWNYPKGPESKQLFDFLG  113


 Score = 63.9 bits (154),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 55/111 (50%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            + + N+D + W   RK T   + H  F   +   +   +  G+ PVLEH A QG  VDLQ
Sbjct  114  NTLFNMDFDEWTSVRKITNSYLKHQQFHRFVNEVIVDNVNKGLIPVLEHVAAQGLVVDLQ  173

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++F R ++D +++        SL +D   + P + AI D   A   R +LP
Sbjct  174  DLFKRYTYDAAWKITTGYSPNSLSID-FPEVPFINAIDDACEASFNRHLLP  223



>ref|XP_006280314.1| hypothetical protein CARUB_v10026237mg [Capsella rubella]
 gb|EOA13212.1| hypothetical protein CARUB_v10026237mg [Capsella rubella]
Length=515

 Score = 89.4 bits (220),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S  ++ +  +I+C +   +   K+     F  +WPV+GM+P L     RI++ + E L  
Sbjct  3    SISLIGVSITIICLLILHRFLFKKPLYRFFRISWPVLGMVPDLFLMLHRIYDSIVERLES  62

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF  352
            +  TF  KGPWFA  DML+T DPAN+++IL  NF N+ KG  F ++F
Sbjct  63   TELTFLFKGPWFAGMDMLITADPANIHYILNSNFSNFVKGSEFIEVF  109


 Score = 71.2 bits (173),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 64/130 (49%), Gaps = 12/130 (9%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E        ++  DS  W+  RK T  ++NH  F+      +  K+++G+ PVL
Sbjct  101  KGSEFIEVFDAFECALLTKDSVAWKTQRKATQVMINHQGFQRLSMSTIRSKVKDGLVPVL  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTG---DHPILEAIR---DGV  666
             H A++GT VDLQ++F R +FD S            C DP     + P +E+ +   D V
Sbjct  161  NHIAEEGTTVDLQDVFRRFTFDTSLVTITG------CDDPRSLSIEMPEVESAKAFDDIV  214

Query  667  NAILYREILP  696
              + YR + P
Sbjct  215  EGVFYRHVKP  224



>ref|XP_004249316.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=513

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 78/114 (68%), Gaps = 8/114 (7%)
 Frame = +2

Query  35   YVVVAILCSILCWIW--ARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLR  208
            Y V+ ++  ILC+ +   +  W K S+    PTNWP+ GMLP L+ NA RIH + T++L 
Sbjct  9    YYVIPLI--ILCFTYWNLKNKWAKSSK----PTNWPIFGMLPGLVHNAHRIHSFFTDILL  62

Query  209  ESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            E+   FE +GP FAN DML T DPAN++HIL RNF NYPKGP FR+IF +LG G
Sbjct  63   ETTSNFEFRGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNG  116


 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+ NVDSELWE+HRKTT  LMNH  F+T L+RNV   ++ G+ P L
Sbjct  102  KGPEFREIFDILGNGIFNVDSELWEIHRKTTMSLMNHSKFQTLLQRNVWDTIDKGIVPTL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +  A+Q T VDLQ+IF R SFD   +  LD D  SL V+     P  +A  D V+A+LYR
Sbjct  162  DILAKQDTPVDLQDIFQRFSFDTISKLLLDHDPKSLSVN-LPHVPCEKAFNDMVDALLYR  220

Query  685  EILPE  699
             +LPE
Sbjct  221  HVLPE  225



>ref|XP_006339337.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=510

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +2

Query  35   YVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            Y V+ ++   L + + +  W K S+    P +WP++GMLP  + NA RIH + T+LL E+
Sbjct  6    YYVIPLIILCLTYWYLKNKWTKTSK----PIDWPIIGMLPGFVHNAHRIHSFFTDLLLET  61

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
               FE +GP FAN DML T DPAN++HIL RNF NYPKGP FR+IF +LG G
Sbjct  62   SSNFEFRGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNG  113


 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+ NVDSELWE+HRKTT  LMNH  F+T L+RNV   ++ G+ P L
Sbjct  99   KGPEFREIFDILGNGIFNVDSELWEIHRKTTMYLMNHAKFQTLLQRNVWDTIDKGIVPTL  158

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A+Q T VDLQ+IF R SFD   +  LD D  SL V+     P  +A  D V+A+LYR
Sbjct  159  DIFAKQDTPVDLQDIFQRFSFDTISKLLLDHDPKSLSVN-LPYVPCEKAFNDMVDALLYR  217

Query  685  EILPECC  705
             +LPE C
Sbjct  218  HVLPESC  224



>ref|XP_009623637.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=511

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S + V I+     + W   +  +RS+ S  PT+WP+ GMLP L+QNA RIHE+ T++L E
Sbjct  5    SLIPVLIILGFTYFTWF--LINRRSKSSA-PTDWPLAGMLPGLIQNAHRIHEFFTDILLE  61

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +G  FE +GP  +N +ML T DPAN++HIL RNF NYPKGP FRKIF +LG G
Sbjct  62   TGNNFEFRGPVISNMNMLFTSDPANIHHILSRNFSNYPKGPEFRKIFEILGNG  114


 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 77/126 (61%), Gaps = 1/126 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ NVDSELWE+HRK T  LM+H  F+  L++NV   +E G+ PVL
Sbjct  100  KGPEFRKIFEILGNGIFNVDSELWEIHRKITMSLMSHAKFQILLKKNVWDTVEKGLVPVL  159

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A++GT  DLQ+IF R +FD   +  LD D  SL +D     P  +   D V+A+LYR
Sbjct  160  DAFAERGTTFDLQDIFQRFTFDNISKLLLDHDPKSLSID-LPHLPCEKGFNDMVDALLYR  218

Query  685  EILPEC  702
             +LP+ 
Sbjct  219  HVLPDS  224



>ref|XP_009773631.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=510

 Score = 94.7 bits (234),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +2

Query  110  RSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANV  289
            R  F  NWP +GM P+L+ +  RIHE   E+L  + GTF +KG WF N D+L T DPANV
Sbjct  30   RGSFIWNWPFLGMFPSLVFHIHRIHERSVEVLSRTRGTFLLKGLWFTNMDILGTVDPANV  89

Query  290  NHILCRNFQNYPKGPRFRKIFHVLGMG  370
             +I+  NF N+PKG   RKIF VLG G
Sbjct  90   QYIMSANFTNFPKGRELRKIFDVLGDG  116


 Score = 64.3 bits (155),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ + D +LW+  RK    L+ H  F   L +    K++NG+ P+LE  A++   VDLQ
Sbjct  115  DGIFSSDMDLWKNQRKLARALITHQRFHKCLTKISLDKVKNGLIPILELIAKEDRIVDLQ  174

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            ++F R +FD + +  L     S C+     + P L+A+ D    +  R +LPE
Sbjct  175  DVFKRFTFDTTCK--LLTGFESCCLSLEFPEVPFLKAMDDAKYVVSIRYLLPE  225



>ref|XP_004142038.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=475

 Score = 90.1 bits (222),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +2

Query  146  MLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYP  325
            M+P ++ N  R+H+ +TE+L+++  TF   G WF N   L+T DP+N++HI+  NFQNYP
Sbjct  1    MIPTVIHNIYRVHDRITEILQQTSCTFYFNGIWFTNTGFLMTVDPSNIHHIMSTNFQNYP  60

Query  326  KGPRFRKIFHVLGMG  370
            KGP F+ IF VLG G
Sbjct  61   KGPEFKYIFDVLGDG  75


 Score = 69.3 bits (168),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS+ W+  RK    L+ H+ F   + R   +K+E G+ P+LE++ +    VDL+
Sbjct  74   DGIFNSDSDSWKSQRKIAQSLIVHEKFLEFMARAAKEKVEKGLVPILEYFCESKKVVDLK  133

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R++FD +        L SLC++   + P  +A+ D    +  R + P+
Sbjct  134  DLFLRLAFDSTCMMVTGFHLNSLCIE-FPEIPFSKAMDDVQEVLFLRHLYPK  184



>gb|AEI59774.1| cytochrome P450 [Helianthus annuus]
Length=505

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  89   IWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLV  268
            I+  ++ R V P+NWP++GM+P +L NA ++H+Y TELL +S GTF +KGPW AN DML+
Sbjct  23   IYTHKTLRHVIPSNWPILGMIPGVLVNAHQLHDYTTELLIQSRGTFMLKGPWLANMDMLL  82

Query  269  TGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            T DP +++HIL +NF NYPKG +F+KIF +LG G
Sbjct  83   TTDPLDIHHILSKNFSNYPKGDKFQKIFDILGDG  116


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 72/124 (58%), Gaps = 1/124 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG++N D ++WE+  K    ++NH  F++ +E  +  K+ENG+ P+L
Sbjct  102  KGDKFQKIFDILGDGILNADGKIWEISHKVIFSVLNHVGFQSKMETIIWDKVENGLLPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            E   ++GT +DLQ+IF R +FDI F+  LD D  SL ++   + P  EA  D   A+L R
Sbjct  162  ESICERGTEMDLQDIFQRFAFDIVFKLLLDNDQESLSLNFPYN-PYSEAFTDSEEAVLLR  220

Query  685  EILP  696
             + P
Sbjct  221  HVTP  224



>ref|XP_011095705.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 83/121 (69%), Gaps = 6/121 (5%)
 Frame = +2

Query  14   MRIFKESYVVVAILC--SILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHE  187
            M +   +  V++I+    +LC+ +A      R  +S  PTNWP++GM+PALL+N GR+H+
Sbjct  1    MEVVYNTATVISIVLYLMLLCYRYAV----GRKEKSSLPTNWPILGMIPALLKNIGRLHQ  56

Query  188  YVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGM  367
              TE+L +SGGT   KGPWFAN DM+VT D ANV++IL +NF N+ KGP F+KIF + G 
Sbjct  57   VTTEVLEQSGGTIWFKGPWFANMDMMVTSDRANVHYILTKNFPNFSKGPEFKKIFDIFGD  116

Query  368  G  370
            G
Sbjct  117  G  117


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 65/133 (49%), Gaps = 3/133 (2%)
 Frame = +1

Query  304  QKLPELSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKME  483
            +  P  S+G  F +      DG+   + E WE  R++T  LM    F+  +      K+E
Sbjct  96   KNFPNFSKGPEFKKIFDIFGDGIFAAEHESWESQRRSTKALMMQPGFQELVATTSWNKVE  155

Query  484  NGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRD  660
              + P++E  ++ GT VD+QE+F R +FD S    L  D  SL  + P   H   +   D
Sbjct  156  TSLIPIMELVSETGTEVDVQELFQRFAFDCSCILVLGHDPTSLSKELPHLPHE--KVFAD  213

Query  661  GVNAILYREILPE  699
               A+LYR ILP+
Sbjct  214  VGEAVLYRHILPQ  226



>ref|XP_002306257.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
 gb|EEE93253.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
Length=517

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 9/120 (8%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFP-TNWPVVGMLPALLQNAGRIHEY  190
            M I +  ++++A++C +L   W R         +V P TNWPVVGMLP LL  A  IHEY
Sbjct  1    MAILEYFHIIIALVCILLFCHWCRN--------TVSPVTNWPVVGMLPGLLFKAQNIHEY  52

Query  191  VTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             T LL++SGGTFE KGPWFAN ++ +T DP NV HI   NF NYPKGP ++KIF   G G
Sbjct  53   ATRLLKQSGGTFEFKGPWFANMNIFLTADPLNVRHISTTNFVNYPKGPEYKKIFEPYGDG  112


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 67/125 (54%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  + +      DG++N D E W+  RK    ++  + F+ SLER++ +K+  G+ PVL
Sbjct  98   KGPEYKKIFEPYGDGVLNSDFESWKSFRKLIHSMIKDNKFQVSLERSLREKIVEGLIPVL  157

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            EH ++Q   +D+Q++F R +FD      L  D  SL VD   +     A  D   A+ YR
Sbjct  158  EHASRQEIELDMQDVFQRFTFDNICLLVLGFDPQSLSVD-LPEIAYKTAFDDVEEAVFYR  216

Query  685  EILPE  699
             I+PE
Sbjct  217  HIVPE  221



>ref|XP_010482535.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=520

 Score = 89.0 bits (219),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +2

Query  38   VVVAILCSIL--CWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            V +AI+C ++  C+ + + +++       F  +WPVVGM+P L+    R++++  EL   
Sbjct  9    VSIAIICFLILHCFPFKKHLYR------FFIISWPVVGMIPGLVLVLHRVYDFTVELFES  62

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF  352
            +  TF  KGPWF   DML+T DPAN+++I+  NF N+ KG  F+++F
Sbjct  63   TELTFLFKGPWFVGMDMLLTADPANIHYIVNSNFSNFVKGSDFKEVF  109


 Score = 68.9 bits (167),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 12/130 (9%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E        ++  DS  W+  RK T  ++NH  F+      +  K+++G+ P  
Sbjct  101  KGSDFKEVFDAFEYALLTKDSVAWKNLRKATHVMINHQGFQRLSMSTMRGKLKDGLVPFF  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTG---DHPILE---AIRDGV  666
             H A++GT VDLQE+F R +FDI+          + C DP     D P +E   A+ D V
Sbjct  161  NHTAEEGTTVDLQEVFRRFTFDITLVTV------TGCDDPRSLSIDMPEVESAKALDDIV  214

Query  667  NAILYREILP  696
              I YR + P
Sbjct  215  EGIKYRHVKP  224



>gb|KFK40984.1| hypothetical protein AALP_AA2G070000 [Arabis alpina]
Length=493

 Score = 97.1 bits (240),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +2

Query  125  TNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILC  304
            TNWPV+GMLP L+    RI++++TE+L  +  TF  KGPW +  D+L T DPAN+ +IL 
Sbjct  24   TNWPVLGMLPGLILQVPRIYDWITEVLEATDMTFCFKGPWLSGTDILATVDPANIQYILS  83

Query  305  RNFQNYPKGPRFRKIFHVLG  364
             NF NYPKG   +KIF VLG
Sbjct  84   SNFVNYPKGIESKKIFEVLG  103


 Score = 60.1 bits (144),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 56/114 (49%), Gaps = 7/114 (6%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            D + NVDSELWE  R ++  + +H  F+         K++ G+ P+LE+  ++   VDLQ
Sbjct  104  DSIFNVDSELWEDMRSSSHAIFSHQEFQKISVSTTISKLKQGLVPILENAIKKNILVDLQ  163

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE---AIRDGVNAILYREILP  696
            ++F R  FD S       D   L +    + P +E   A+    + I YR + P
Sbjct  164  DLFRRFMFDTSSILMTGYDPKCLSI----EMPKVEFGDAVDGAADGIFYRYVKP  213



>gb|EEC74485.1| hypothetical protein OsI_09945 [Oryza sativa Indica Group]
Length=504

 Score = 82.0 bits (201),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 60/115 (52%), Gaps = 2/115 (2%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S ++   LC +   ++     K + +    P  WP+VGMLP LL N  ++H+++T  L  
Sbjct  4    SSILQLTLCFLCFSVFYYYHIKSKRKNPAIPVCWPLVGMLPDLLVNRHQLHDWITSFLTA  63

Query  212  SGGTFEIKGPWFA-NRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF-HVLGMG  370
            S   F   GP  + N     T DPANV HI   NF NYPKGP F +IF   LG G
Sbjct  64   SQLNFRFIGPTMSSNMRFFFTCDPANVRHIFTSNFANYPKGPDFAEIFDDTLGDG  118


 Score = 75.1 bits (183),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ NVD + W   R  T  LM +  F++ + R  S K+EN + P+L H+A  G   +LQ
Sbjct  117  DGIFNVDGDSWRRQRAKTQLLMYNHRFQSFVSRCSSDKVENALLPLLSHFAGTGERCNLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILP  696
            ++F R++FD+S      +D G L +  P    P + A+      +L R I+P
Sbjct  177  DVFMRLTFDMSTMLASGEDPGCLAISLPMPKVPFVRAVDYTTRVLLVRHIIP  228



>gb|EYU33777.1| hypothetical protein MIMGU_mgv1a004858mg [Erythranthe guttata]
Length=507

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +2

Query  107  RRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPAN  286
            R+   PTNWPVVGMLP L+ NA RIH+Y+TE+LRE+G TF  KGP F N DM+ T DP N
Sbjct  28   RKGSTPTNWPVVGMLPGLVGNAHRIHDYITEILRENGATFVFKGPLFTNMDMVFTCDPIN  87

Query  287  VNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +NHI  + F NYPKGP F+KIF ++G G
Sbjct  88   INHIFNKRFSNYPKGPEFQKIFEIMGDG  115


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (50%), Gaps = 3/133 (2%)
 Frame = +1

Query  304  QKLPELSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKME  483
            ++     +G  F +      DG+   D E+WEL R+ T  ++N   F TS+E+     + 
Sbjct  94   KRFSNYPKGPEFQKIFEIMGDGIFRSDFEMWELQRRLTLSIVNQVGFYTSVEKTTWGTVR  153

Query  484  NGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE-AIRD  660
              + PVL+H+ Q+G  +++Q+I  R +FD       + +  SL  D    H   E A+ D
Sbjct  154  TELVPVLDHFLQRGIEMEMQDILERFAFDNICHLLFNHNPCSLSTD--FPHVRCEKALGD  211

Query  661  GVNAILYREILPE  699
             +  +L+R I PE
Sbjct  212  ALEPLLHRHIWPE  224



>ref|XP_011043827.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=520

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 100/174 (57%), Gaps = 9/174 (5%)
 Frame = +2

Query  29   ESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLR  208
            E + ++A++  ++C++  R  W +  +      NWPVVGMLP LL N+  ++EY T+ LR
Sbjct  2    EIFDILAVVGVLVCFLLLR-CWDQIRKLDADKANWPVVGMLPRLLINSSNVYEYTTQALR  60

Query  209  ESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG**TWTR  388
             +GGT + KGPWFAN D ++T DP NV+HIL  NF NYPKGP ++KIF  LG G      
Sbjct  61   NNGGTSKFKGPWFANMDFVITSDPRNVHHILSDNFANYPKGPVYKKIFEPLGDG----IL  116

Query  389  SYGSFTGRPRRRL*TMTTSALPWRG----TCRRRWRMGCFRFLNITLNKEPTSI  538
            +  S + R +R++  +      ++G    T  ++   G F  L+    KE + I
Sbjct  117  NSDSESWRAQRKMIQLFMKNNKYKGLVEKTILQKLVQGLFPILDHVSRKEMSEI  170


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 61/115 (53%), Gaps = 5/115 (4%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTH--VD  537
            DG++N DSE W   RK     M ++ ++  +E+ + QK+  G+FP+L+H +++     +D
Sbjct  113  DGILNSDSESWRAQRKMIQLFMKNNKYKGLVEKTILQKLVQGLFPILDHVSRKEMSEIID  172

Query  538  LQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            +Q++  R  +D +    L  D   L ++ P   H   +A      AI YR I+PE
Sbjct  173  MQDVIQRFMYDSNCMSVLGFDPNCLTIEFPEVAHA--KAFDIMEEAIFYRHIVPE  225



>ref|XP_004249313.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=515

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 79/114 (69%), Gaps = 8/114 (7%)
 Frame = +2

Query  44   VAILCSILCWIWARQ-----IWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLR  208
            + +L  ++C+ ++ +     IW K S     PTNWP+VGMLP L+QN  R+HE+VT+ L 
Sbjct  8    LPLLVIVMCFTYSTRWYLSNIWWKSSSA---PTNWPLVGMLPGLIQNTHRVHEFVTDALV  64

Query  209  ESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            ES GTFE  GP  AN +ML+T DPAN++HIL +NF NYPKG  FRKIF ++G G
Sbjct  65   ESKGTFEFHGPVLANLNMLLTSDPANIHHILSKNFSNYPKGVEFRKIFDMIGNG  118


 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 78/127 (61%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ NVD ELWE+HRKTT  LMNH  F+T LERN+   +ENG++P+L
Sbjct  104  KGVEFRKIFDMIGNGIFNVDYELWEMHRKTTMSLMNHPKFQTMLERNMWSIIENGLWPIL  163

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A+QGT  DLQ+IF R +FD   +  LD D  SL +      P   A  D ++A +YR
Sbjct  164  DGFAEQGTLFDLQDIFQRFTFDAITKLLLDHDPKSLSIG-LPHVPCENAFNDSLDAFMYR  222

Query  685  EILPECC  705
              LPE C
Sbjct  223  HFLPESC  229



>gb|EYU27556.1| hypothetical protein MIMGU_mgv1a021423mg [Erythranthe guttata]
Length=507

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +2

Query  95   KKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTG  274
             K+S  +  PT+WP+ GMLP LL N GR+H ++TELL  SGGTF +KG WFAN  ML+T 
Sbjct  28   DKKSSPAPPPTDWPIFGMLPGLLLNCGRVHTFMTELLESSGGTFYLKGAWFANMSMLITS  87

Query  275  DPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            DPANV++IL +NF N+ KGP+F+K+F VLG G
Sbjct  88   DPANVHYILAKNFPNFEKGPQFKKMFDVLGDG  119


 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 1/132 (1%)
 Frame = +1

Query  304  QKLPELSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKME  483
            +  P   +G  F +      DG+ N +SE WE+ ++T   LM++ +F   + R    K+E
Sbjct  98   KNFPNFEKGPQFKKMFDVLGDGIFNAESESWEIQKRTAKSLMHNTSFPDFIARTSWSKVE  157

Query  484  NGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDG  663
            N + P+LE  ++ GT VDLQE+F R +FD S    L  D  SLC +     P  +A  D 
Sbjct  158  NALIPILELASETGTEVDLQELFQRFAFDCSCITVLGHDPVSLCKE-LPHLPHEKAFADA  216

Query  664  VNAILYREILPE  699
              A+LYR +LPE
Sbjct  217  EQAVLYRHMLPE  228



>ref|XP_009622763.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIW-ARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEY  190
            M + + S +++ I       +W  R  W K S     PTNWP + MLPA++ N  RIHEY
Sbjct  1    MNLLEYSPLLLIIFGFTYFIVWYLRHRWTKTSSE---PTNWPFIRMLPAVIMNLHRIHEY  57

Query  191  VTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +TE+L + GGT+E +GP FAN DM VT D AN++HI  +NF NYPKGP FRKIF +LG G
Sbjct  58   MTEVLIDVGGTYEFEGPMFANLDMFVTCDSANIHHIFSKNFSNYPKGPEFRKIFDILGNG  117


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ NVD ELWE+HRKTT  +M+H  F+T LERN+   +E G+ P+L
Sbjct  103  KGPEFRKIFDILGNGIFNVDHELWEIHRKTTLSIMSHAKFQTLLERNLWDTVEKGLRPIL  162

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + + +Q   +DLQ++  R +FD   +  LD D  SL +D     P  +A  D ++A+L+R
Sbjct  163  DAFTEQDKTLDLQDVLQRFTFDSITKLLLDHDPRSLSID-LPYLPYEKAFGDALDALLHR  221

Query  685  EILPECC  705
             I PE C
Sbjct  222  HITPENC  228



>ref|XP_008440140.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Cucumis melo]
Length=507

 Score = 91.3 bits (225),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 62/111 (56%), Gaps = 4/111 (4%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            +++  +  +L  I+    WK        P N P  GM   +L N  RI ++ T +LR S 
Sbjct  9    ILLPFIPFLLVLIFLSVKWKYNE----LPWNLPFFGMTLTILCNLHRIQDHFTHILRLSS  64

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             TF  KG WFA+ D   T DP+N++HIL  NF+ YPKGP F+ IF +LG G
Sbjct  65   STFFFKGAWFADLDFFFTSDPSNIHHILSTNFERYPKGPDFKYIFEILGDG  115


 Score = 63.5 bits (153),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 63/112 (56%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L++   +   +E+   +K+++G+ PVL+   + G+ +DLQ
Sbjct  114  DGIFNSDSDVWKNLRKTAHSLVHDHKYLQFVEKITLKKVKSGLVPVLQTACENGSVLDLQ  173

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R SFD +       DL SL ++   + P  +A+ D    I  R  +P+
Sbjct  174  DLFQRFSFDSTCMFVTGFDLQSLSLE-LPEVPFSKAMDDAEEVIFLRHFIPK  224



>ref|XP_010442700.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=419

 Score = 90.1 bits (222),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (64%), Gaps = 8/107 (7%)
 Frame = +2

Query  38   VVVAILCSIL--CWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            V +AI+C ++  C+++ + +++       F  +WPVVGM+P L+    R++E+  ELL  
Sbjct  9    VSIAIICFLILHCFLFKKHLYR------FFIISWPVVGMIPGLVLVLHRVYEFTVELLDS  62

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF  352
            +      KGPWFA  DML+T DPAN+++I+  NF N+ KG  F+++F
Sbjct  63   TELKILFKGPWFAGMDMLLTADPANIHYIVNSNFSNFVKGSDFKEVF  109


 Score = 63.9 bits (154),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 63/130 (48%), Gaps = 12/130 (9%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E        ++  DS  W+  RK T  ++NH  F+      +  K+++G+ P  
Sbjct  101  KGSDFKEVFDAFVYALLTKDSVAWKNLRKATHVMINHQGFQRLSMCTMRGKLKDGLVPFF  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTG---DHPILE---AIRDGV  666
             H  + GT VDLQE+F R +FDI+          + C DP     + P +E   A+ D V
Sbjct  161  NHIVKDGTTVDLQEVFRRFTFDITLVTV------TGCDDPRSLSIEMPEVESAKALDDIV  214

Query  667  NAILYREILP  696
            + I YR + P
Sbjct  215  DGIKYRHVKP  224



>emb|CDP18605.1| unnamed protein product [Coffea canephora]
Length=432

 Score = 94.7 bits (234),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS+LWE HR+ T  LM+H +F   LE  V  K+E G+ PVL++ A+ G+ +DLQ
Sbjct  38   DGIFNADSQLWETHRRVTLSLMHHPSFLKVLEVTVWDKVEKGLLPVLQNCAKTGSQLDLQ  97

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            +IF R +FD   +  LD D GSL +D   + P  +A  D    +L+R ILPE
Sbjct  98   DIFQRFAFDSISKLVLDHDPGSLSLD-LPNIPCEKAFNDLALVLLHRHILPE  148


 Score = 59.3 bits (142),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  260  MLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            M++T DPAN+++IL +NF NYPKGP FRKIF +LG G
Sbjct  3    MVLTCDPANIHYILSKNFSNYPKGPEFRKIFDILGDG  39



>gb|EPS65366.1| hypothetical protein M569_09411 [Genlisea aurea]
Length=503

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = +2

Query  35   YVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            +++++ + + L  +  R + K     +  PTN+P+VGMLPALL N+ R+H+++T++L E 
Sbjct  6    FLLLSSIAAALFLLLRRNLKKP----TAIPTNFPIVGMLPALLLNSHRVHDFITDILSEV  61

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GGTFE KGP F+N DM++T DP+NV+H+  R+F  YPKGP FRK+F VLG G
Sbjct  62   GGTFEFKGPTFSNLDMVLTSDPSNVHHVFSRSFLKYPKGPDFRKMFGVLGDG  113


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N D  +WE+HRK T   +    F   +E  V  K+E G+FPVL
Sbjct  99   KGPDFRKMFGVLGDGIFNTDFAVWEVHRKATLGFVGDREFNGLVEGVVWGKVEKGVFPVL  158

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + + + G  VDLQ++F R+SFD   +  L  D  SL V    +    +A  D   A+ YR
Sbjct  159  DSFVESGGFVDLQDVFQRMSFDGICRLVLGFDPESLAVG-LPEIQCEKAFNDAFQAVFYR  217

Query  685  EILPECC  705
             +LPE  
Sbjct  218  HLLPETV  224



>ref|XP_004142039.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=467

 Score = 87.4 bits (215),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  158  LLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPR  337
            ++Q+  RIH+ +TE+L+++  TF  +G WF N  +L+T DP+N++HI+  NFQNYPKGP 
Sbjct  2    VIQHIDRIHDRITEILQQTSCTFFFEGIWFTNTSLLITVDPSNIHHIMTSNFQNYPKGPD  61

Query  338  FRKIFHVLGMG  370
            F+ IF VLG G
Sbjct  62   FKYIFDVLGDG  72


 Score = 66.6 bits (161),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 59/112 (53%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS+ W+  RK    L+ H+ F   +     +K+E G+ P+LE++ +    VDL+
Sbjct  71   DGIFNSDSDSWKNQRKIAQSLIVHEKFFEFMCGVAKEKVEKGLVPILEYFCESKKVVDLK  130

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R+ FD +       D  SL +D   D P  +A+ D    I +R + P+
Sbjct  131  DLFLRLMFDTTCTMVAGFDFNSLSID-FPDIPFTKAMDDIQEVIFFRHLYPK  181



>gb|ABF93891.1| Cytochrome P450 family protein [Oryza sativa Japonica Group]
Length=536

 Score = 79.0 bits (193),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 59/115 (51%), Gaps = 2/115 (2%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S ++   LC +   ++     K + +    P  WP+VGMLP LL N  ++H+++T  L  
Sbjct  4    SSILQLTLCFLCFSVFYYYHIKSKRKNPAIPVCWPLVGMLPDLLVNRHQLHDWITSFLTA  63

Query  212  SGGTFEIKGPWF-ANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF-HVLGMG  370
            S   F   GP   +N     T D ANV HI   NF NYPKGP F +IF   LG G
Sbjct  64   SQLNFRFIGPTMSSNMRFFFTCDSANVRHIFTSNFANYPKGPDFAEIFDDTLGDG  118


 Score = 75.1 bits (183),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ NVD + W   R  T  LM +  F++ + R  S K+EN + P+L H+A  G   +LQ
Sbjct  117  DGIFNVDGDSWRRQRAKTQLLMYNHRFQSFVSRCSSDKVENALLPLLSHFAGTGERCNLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILP  696
            ++F R++FD+S      +D G L +  P    P + A+      +L R I+P
Sbjct  177  DVFMRLTFDMSTMLASGEDPGCLAISLPMPKVPFVRAVDYTTRVLLVRHIIP  228



>ref|XP_006351377.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=524

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 78/113 (69%), Gaps = 6/113 (5%)
 Frame = +2

Query  38   VVVAILCSILC--WIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            +++ I+C      W  + + WK  S     PTNWP+VGMLP L+QNA R+HE+ T++L E
Sbjct  10   LLIIIMCFTYSTWWYLSNRWWKSSS----VPTNWPLVGMLPGLIQNAHRVHEFATDILVE  65

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            + GTF+  GP  AN +ML+T DPAN+++IL +NF NYPKG  FRKIF +LG G
Sbjct  66   TKGTFKFHGPVLANLNMLITSDPANIHYILSKNFSNYPKGVEFRKIFDILGNG  118


 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +GM NVD ELWE+HRKTT  LMNH  F+T LERN+   +EN + P+L
Sbjct  104  KGVEFRKIFDILGNGMFNVDYELWEMHRKTTMSLMNHAKFQTLLERNMWNIIENRLRPIL  163

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A+Q    D+Q+IF R +FD   +  LD D  SL +      P  +A  D V+A+LYR
Sbjct  164  DAFAEQDILFDMQDIFQRFTFDAISKLLLDHDPKSLSIG-LPHVPCEKAFNDTVDALLYR  222

Query  685  EILPECC  705
             +LPE C
Sbjct  223  HLLPESC  229



>gb|EAZ25521.1| hypothetical protein OsJ_09345 [Oryza sativa Japonica Group]
Length=504

 Score = 79.0 bits (193),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 59/115 (51%), Gaps = 2/115 (2%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S ++   LC +   ++     K + +    P  WP+VGMLP LL N  ++H+++T  L  
Sbjct  4    SSILQLTLCFLCFSVFYYYHIKSKRKNPAIPVCWPLVGMLPDLLVNRHQLHDWITSFLTA  63

Query  212  SGGTFEIKGPWF-ANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF-HVLGMG  370
            S   F   GP   +N     T D ANV HI   NF NYPKGP F +IF   LG G
Sbjct  64   SQLNFRFIGPTMSSNMRFFFTCDSANVRHIFTSNFANYPKGPDFAEIFDDTLGDG  118


 Score = 75.1 bits (183),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ NVD + W   R  T  LM +  F++ + R  S K+EN + P+L H+A  G   +LQ
Sbjct  117  DGIFNVDGDSWRRQRAKTQLLMYNHRFQSFVSRCSSDKVENALLPLLSHFAGTGERCNLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILP  696
            ++F R++FD+S      +D G L +  P    P + A+      +L R I+P
Sbjct  177  DVFMRLTFDMSTMLASGEDPGCLAISLPMPKVPFVRAVDYTTRVLLVRHIIP  228



>ref|XP_006351379.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=501

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +2

Query  71   WIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFA  250
            W  + + WK  S     PTNWP+VGMLP L++NA R+HE+VT+ L E+ GTFE  GP  A
Sbjct  9    WYLSNRWWKSSS----VPTNWPLVGMLPGLIRNAHRVHEFVTDALIETKGTFEFHGPVLA  64

Query  251  NRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            N +ML+T DPAN++HIL +NF NYPKG  FRKIF +LG G
Sbjct  65   NLNMLLTSDPANIHHILSKNFSNYPKGVEFRKIFDMLGNG  104


 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 78/127 (61%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +GM NVD ELWE+HRKTT  LMNH  F+T LERN+   +ENG+ PVL
Sbjct  90   KGVEFRKIFDMLGNGMFNVDYELWEMHRKTTMSLMNHAKFQTLLERNMWSIIENGLQPVL  149

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A+QGT  DLQ+IF R +FD   +  LD D  SL +      P   A  D ++A++YR
Sbjct  150  DGFAEQGTLFDLQDIFQRFTFDAISKLLLDHDPKSLSIG-LPHVPCENAFNDSLDALMYR  208

Query  685  EILPECC  705
              LPE C
Sbjct  209  HFLPESC  215



>emb|CDY39928.1| BnaA09g15100D [Brassica napus]
Length=496

 Score = 98.2 bits (243),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 57/91 (63%), Gaps = 0/91 (0%)
 Frame = +2

Query  98   KRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGD  277
            K+S+      NWP  GMLP +L +  RI ++  E+L  +  TF  KGPW +  DML T D
Sbjct  26   KKSQSQPILKNWPFFGMLPGMLAHIPRIFDFSVEVLEATNLTFSFKGPWLSGTDMLFTAD  85

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            P N++HIL  NF NYPKGP  +KIF+ LG G
Sbjct  86   PWNIHHILSLNFGNYPKGPEAKKIFNALGDG  116


 Score = 55.5 bits (132),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 59/112 (53%), Gaps = 3/112 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNF-RTSLERNVSQKMENGMFPVLEHYAQQGTHVDL  540
            DG+++ D ELWE  RK+   + +H +F + S+  N + K++  + P L++ A +   +DL
Sbjct  115  DGILSADMELWENLRKSNHAIFHHPDFLKLSVSSN-TIKLKESLIPFLDNAAHEKIIIDL  173

Query  541  QEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            Q++F R  FD S       D  SL ++   +    EA+  G  AI YR   P
Sbjct  174  QDVFKRFMFDTSSILMTGYDPMSLSIE-MPEVLFDEAVETGEEAIYYRYFKP  224



>ref|XP_006351378.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=517

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 4/121 (3%)
 Frame = +2

Query  8    YTMRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHE  187
            Y +  F    V++        W  + + WK  S     PTNWP+VGMLP L++N  R+HE
Sbjct  2    YVLEYFLSLLVIIMCFTYSTWWYLSNRWWKSSS----VPTNWPLVGMLPGLIRNVHRVHE  57

Query  188  YVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGM  367
            + T++L E+ GTFE  GP  AN +ML T DPAN++HIL +NF NYPKG  FRK F +LG 
Sbjct  58   FATDVLVETKGTFEFHGPVLANLNMLATSDPANIHHILSKNFSNYPKGVEFRKFFDILGN  117

Query  368  G  370
            G
Sbjct  118  G  118


 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 80/127 (63%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ NVD ELWE+HRKTT  LM+H  F+T LERN+   +ENG+ P+L
Sbjct  104  KGVEFRKFFDILGNGIFNVDYELWEIHRKTTMSLMSHAKFQTFLERNLWDIIENGLRPIL  163

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A+Q T  DLQ+IF R +FD   +  LD D  SL +D     P  +A  D V+A++YR
Sbjct  164  DTFAEQDTLFDLQDIFQRFTFDAISKLLLDYDPKSLSID-LPHVPCEKAFNDVVDALMYR  222

Query  685  EILPECC  705
             ILPE C
Sbjct  223  HILPEGC  229



>ref|XP_010444065.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=516

 Score = 90.1 bits (222),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 8/107 (7%)
 Frame = +2

Query  38   VVVAILCSIL--CWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            V +AI+C ++  C+++ + +++       F  +WPVVGM+P L+    R++++  +LL  
Sbjct  9    VSIAIICFLILHCFLFKKHLYR------FFIISWPVVGMIPGLVLVLHRVYDFAVDLLES  62

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF  352
            +  TF  KGPWF   D+L+T DPAN+++I+  NF N+ KG  F+++F
Sbjct  63   TELTFLFKGPWFTGMDLLLTADPANIHYIVNSNFSNFVKGSDFKEVF  109


 Score = 62.8 bits (151),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 63/130 (48%), Gaps = 12/130 (9%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E        ++  DS  W+  RK T  ++NH  F+      +  K+++G+ P  
Sbjct  101  KGSDFKEVFDAFEYALLTKDSVAWKNLRKATHVMINHQGFQRLSMSTMRGKLKDGLVPFF  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTG---DHPILE---AIRDGV  666
             H  ++GT VDLQE+F R++ DI+          + C DP     + P +E   A+ D +
Sbjct  161  NHIVKEGTTVDLQEVFRRLTLDITLVTV------TGCDDPRSLSIEMPEVESAKALDDIL  214

Query  667  NAILYREILP  696
              I YR + P
Sbjct  215  EGIKYRHVKP  224



>ref|XP_004166589.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=507

 Score = 90.9 bits (224),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  122  PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHIL  301
            P N P  GM   +L+N  RI ++ T +LR S  TF  KG WFA+ D   T DP+N++HIL
Sbjct  33   PWNLPFFGMTLTILRNLHRIQDHFTHILRLSSFTFFFKGAWFADLDFYFTSDPSNIHHIL  92

Query  302  CRNFQNYPKGPRFRKIFHVLGMG  370
              NF+ YPKGP F+ IF +LG G
Sbjct  93   STNFERYPKGPDFKYIFEILGDG  115


 Score = 61.6 bits (148),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L++   +   +E+   +K++ G+ PVL+   + G+ +DLQ
Sbjct  114  DGIFNSDSDVWKSLRKTAHSLVHDHKYVQFVEKITLKKVKAGLVPVLDSVCENGSVLDLQ  173

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R SFD +       DL SL ++   + P  +A+ +    I  R  +P+
Sbjct  174  DLFQRFSFDSTCMFVTGFDLQSLSLE-LPEVPFSKAMDEAEEVIFLRHFIPK  224



>ref|XP_009631751.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIW-ARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEY  190
            M + + S +++ I       +W  R  W K S     PTNWP + MLPA++ N  RIH+Y
Sbjct  1    MNLLEYSPLLLIIFGFTYFIVWYLRHRWTKTSSE---PTNWPFIRMLPAVIMNLHRIHKY  57

Query  191  VTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +TE+L + GGT+E +GP FAN DM VT D AN++HI  +NF NYPKGP FRKIF +LG G
Sbjct  58   MTEVLIDVGGTYEFEGPMFANLDMFVTCDSANIHHIFSKNFSNYPKGPEFRKIFDILGNG  117


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ NVD ELWE+HRKTT  +M+H  F+T LERN+   +E G+ P+L
Sbjct  103  KGPEFRKIFDILGNGIFNVDHELWEIHRKTTLSIMSHAKFQTLLERNLWDTVEKGLRPIL  162

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + + +Q   +DLQ++  R +FD   +  LD D  SL +D     P  +A  D ++A+L+R
Sbjct  163  DAFTEQDKTLDLQDVLQRFTFDSITKLLLDHDPRSLSID-LPYLPYEKAFGDALDALLHR  221

Query  685  EILPECC  705
             I PE C
Sbjct  222  HITPENC  228



>gb|KGN48435.1| hypothetical protein Csa_6G487560 [Cucumis sativus]
Length=507

 Score = 90.9 bits (224),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  122  PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHIL  301
            P N P  GM   +L+N  RI ++ T +LR S  TF  KG WFA+ D   T DP+N++HIL
Sbjct  33   PWNLPFFGMTLTILRNLHRIQDHFTHILRLSSFTFFFKGAWFADLDFYFTSDPSNIHHIL  92

Query  302  CRNFQNYPKGPRFRKIFHVLGMG  370
              NF+ YPKGP F+ IF +LG G
Sbjct  93   STNFERYPKGPDFKYIFEILGDG  115


 Score = 61.6 bits (148),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L++   +   +E+   +K++ G+ PVL+   + G+ +DLQ
Sbjct  114  DGIFNSDSDVWKSLRKTAHSLVHDHKYVQFVEKITLKKVKAGLVPVLDSVCENGSVLDLQ  173

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R SFD +       DL SL ++   + P  +A+ +    I  R  +P+
Sbjct  174  DLFQRFSFDSTCMFVTGFDLQSLSLE-FPEVPFSKAMDEAEEVIFLRHFIPK  224



>ref|XP_004142036.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
sativus]
Length=483

 Score = 90.9 bits (224),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  122  PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHIL  301
            P N P  GM   +L+N  RI ++ T +LR S  TF  KG WFA+ D   T DP+N++HIL
Sbjct  33   PWNLPFFGMTLTILRNLHRIQDHFTHILRLSSFTFFFKGAWFADLDFYFTSDPSNIHHIL  92

Query  302  CRNFQNYPKGPRFRKIFHVLGMG  370
              NF+ YPKGP F+ IF +LG G
Sbjct  93   STNFERYPKGPDFKYIFEILGDG  115


 Score = 61.6 bits (148),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS++W+  RKT   L++   +   +E+   +K++ G+ PVL+   + G+ +DLQ
Sbjct  114  DGIFNSDSDVWKSLRKTAHSLVHDHKYVQFVEKITLKKVKAGLVPVLDSVCENGSVLDLQ  173

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R SFD +       DL SL ++   + P  +A+ +    I  R  +P+
Sbjct  174  DLFQRFSFDSTCMFVTGFDLQSLSLE-FPEVPFSKAMDEAEEVIFLRHFIPK  224



>ref|XP_009790818.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=512

 Score = 92.8 bits (229),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +2

Query  128  NWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCR  307
            NWP +GM P+L+ +  RIHE   E+L  + GTF IKG WF N D+L T DP NV++I+  
Sbjct  36   NWPFLGMFPSLILHIHRIHERSVEILSITKGTFLIKGLWFTNMDILGTVDPPNVHYIMSA  95

Query  308  NFQNYPKGPRFRKIFHVLGMG  370
            NF N+PKG   +KIF VLG G
Sbjct  96   NFTNFPKGQELKKIFDVLGDG  116


 Score = 59.7 bits (143),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 60/113 (53%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ + D ++W+  RK    L+ ++ F     +    K++NG+ P+LE  A++   VDLQ
Sbjct  115  DGIFSSDMDMWKNQRKLARALIINERFHKCSAKISMNKVKNGLIPILEFIAKEDRIVDLQ  174

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            ++F R +FD + +  L     S C+     + P L+A+ D    +  R +LPE
Sbjct  175  DVFKRFTFDTTCK--LLTGFESCCLSLEFPEVPFLKAMDDAKYVVTIRYLLPE  225



>gb|EYU41723.1| hypothetical protein MIMGU_mgv1a021724mg [Erythranthe guttata]
Length=518

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = +2

Query  14   MRIFK--ESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHE  187
            M IFK  E ++    +  I+  +W     K   +++  PTNWP+VGMLPA+ +N  R+ +
Sbjct  1    MTIFKYPEIFLFFIPVNVIILCVWRICNRKSYGKKTSLPTNWPLVGMLPAIQRNRHRMQD  60

Query  188  YVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLG  364
            Y+TE+L ESGGTF+ K P F N D L+T +P N+NHI  +NF NYPKGP F+KIF  LG
Sbjct  61   YITEILIESGGTFQFKFPHFLNMDTLITSNPDNINHIFTKNFSNYPKGPEFKKIFEELG  119


 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 72/125 (58%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      D + +VD+ELWE  R+TT   M H  F + LE  V QK+ENG+ PVL
Sbjct  107  KGPEFKKIFEELGDSIFSVDNELWEFQRRTTHSFMTHPEFNSLLEGVVWQKVENGLLPVL  166

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H+ Q     DLQ++F R +FD   +  LD D  SLCVD     P ++A  D + A+ +R
Sbjct  167  DHFLQGNIDFDLQDVFQRFTFDSICKLVLDFDPKSLCVD-LPVIPSMKAFCDSIEAVFHR  225

Query  685  EILPE  699
             ILPE
Sbjct  226  HILPE  230



>ref|XP_009626183.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=534

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 85/124 (69%), Gaps = 4/124 (3%)
 Frame = +2

Query  2    VRYTMRIFKESYVVVAILCSILCWIWARQI-WKKRSRRSVFPTNWPVVGMLPALLQNAGR  178
            + Y++ +     V++  L   +  I+ R I W   S++ V PTNWP++GMLP LL+N  R
Sbjct  4    LEYSLTLVIIYIVLILYLTYSIQLIYLRGITW---SKKPVTPTNWPLIGMLPGLLRNTHR  60

Query  179  IHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHV  358
            +HE+VTE+L E+ G FE KGP F+N +ML + DPAN++H+L +NF NYPKG  ++K+F +
Sbjct  61   LHEFVTEILIENEGIFEFKGPVFSNLNMLFSSDPANLHHMLSKNFNNYPKGSEYKKMFDI  120

Query  359  LGMG  370
            +G G
Sbjct  121  MGDG  124


 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 80/127 (63%), Gaps = 0/127 (0%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS + +      DG+ NVD+ELWE+ RK T  +M+H  F + LERNV  K+  G+ PVL
Sbjct  110  KGSEYKKMFDIMGDGIFNVDNELWEVQRKITISIMSHPKFLSCLERNVWDKVVKGLQPVL  169

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +++A+QG+  DLQ+IF R +FD   +  LD D GSL +D   D     A +D  +AILYR
Sbjct  170  DNFAKQGSCFDLQDIFQRFTFDTISKLLLDHDPGSLSIDLPTDSLFKNAFQDAGDAILYR  229

Query  685  EILPECC  705
             I+PE C
Sbjct  230  HIMPESC  236



>ref|XP_010652863.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=502

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            IL +++C++   ++    S  ++ P NWP+VGMLP + +N  +I +  TE+L +S GTF 
Sbjct  9    ILLAVICFLLLHRL----SNSNMLPWNWPLVGMLPWIFRNIQQIQDRCTEVLEQSSGTFL  64

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +KGPWFAN DML+T DPANV++I+  NF N+PKGP F KIF VLG G
Sbjct  65   LKGPWFANMDMLITSDPANVHYIMSTNFSNFPKGPEFLKIFDVLGEG  111


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 66/128 (52%), Gaps = 7/128 (5%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ N DS+LW   RK    L+N   F+  L +    K++ G+ PVL
Sbjct  97   KGPEFLKIFDVLGEGIFNSDSDLWRKQRKLAQVLINDRQFQQFLVKTTENKVDEGLIPVL  156

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHP---ILEAIRDGVNAI  675
            EH ++QG  VDLQ++F R +FD + +     D   L +    + P     +A+ D   AI
Sbjct  157  EHVSKQGLLVDLQDLFQRFTFDTTCKLITGFDTKCLSI----EFPRVLFAKAMDDVEEAI  212

Query  676  LYREILPE  699
             +R ++PE
Sbjct  213  FFRHVVPE  220



>ref|XP_002322212.1| hypothetical protein POPTR_0015s09850g [Populus trichocarpa]
 gb|EEF06339.1| hypothetical protein POPTR_0015s09850g [Populus trichocarpa]
Length=419

 Score = 86.3 bits (212),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +2

Query  146  MLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYP  325
            M P LL NA R HE+ T+LL+++ GTF  KGPWFA  D ++T +  NV HIL +NF NY 
Sbjct  1    MFPGLLLNASRAHEFATDLLQKNDGTFVFKGPWFAGFDFMITSNSMNVQHILSKNFTNYH  60

Query  326  KGPRFRKIFHVLGMG  370
            +   F++IF  LG G
Sbjct  61   RNLEFKQIFEPLGDG  75


 Score = 63.9 bits (154),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W+  R+     + H  F  +LE+ + QK+  G+F VL+H +  G  VDLQ
Sbjct  74   DGIFNSDGDWWKTQRRIIHTSLKHRKFELALEKIIQQKILQGLFMVLDHVSVLGVEVDLQ  133

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD  621
            ++ HR++FD +    L  D   L +D
Sbjct  134  DVLHRLTFDNARALVLGFDPNCLSID  159



>ref|XP_008441106.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
melo]
Length=513

 Score = 89.4 bits (220),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +2

Query  122  PTNWPVVGMLPALLQNAGRIHEYVTELLRESG-GTFEIKGPWFANRDMLVTGDPANVNHI  298
            P NWPV+GMLP ++ +  RI++  TE+L ++   TF I G WF+  D  +T +P+N++HI
Sbjct  33   PWNWPVLGMLPTVVFHMNRINDRATEILHQAARSTFFINGVWFSGTDFFLTANPSNIHHI  92

Query  299  LCRNFQNYPKGPRFRKIFHVLGMG  370
            L  NF+ YPKGP F+ IF   G G
Sbjct  93   LSANFEQYPKGPDFKYIFDFFGDG  116


 Score = 60.1 bits (144),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D   W+  R  +    N   F   LE+ +S+K++ G+FPVL+ + + G+ +DLQ
Sbjct  115  DGIFNSDFASWKSQRDCSCFFRNQ-KFLQFLEKIISKKVKAGLFPVLQSFCENGSVLDLQ  173

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R+SFD +       DL SL ++     P  +A+ D  +    R   P+
Sbjct  174  DLFQRLSFDSTCMFVTGFDLQSLSLE-FPQIPFSKAMDDIKDVAFLRHFFPK  224



>ref|XP_002457224.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
 gb|EES02344.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
Length=511

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            ++ S+ C++    ++ +  RR   PTNWPVVG+LPA+  NAGRIHE++TE LR +G ++ 
Sbjct  17   LMVSLACFLL---LFHRLKRRDGLPTNWPVVGVLPAITINAGRIHEWLTEFLRAAGLSYV  73

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            IKGPW +  D++VT DPANV H+   NF NYPKG  F ++F VLG G
Sbjct  74   IKGPWGSPVDVIVTADPANVAHVFTANFGNYPKGEEFAELFDVLGDG  120


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 5/130 (4%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      DG+ N D + W   R+    L++   FR  +  + ++K+ +G+ P+L
Sbjct  106  KGEEFAELFDVLGDGIFNADGDSWAFQRRKAHALLSDARFRAGVAASTARKLRDGLVPLL  165

Query  505  EHYAQQGT--HVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAIL  678
            +  A  G+   VDLQ++F R++FD++       D G L  D    H    A  D +  +L
Sbjct  166  DGLAASGSGAAVDLQDVFVRLTFDLTAMFVFGFDPGCLAAD--FPHVPFAAAMDTIEEVL  223

Query  679  -YREILPECC  705
             YR + P  C
Sbjct  224  FYRHVTPVPC  233



>ref|XP_006427987.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
 ref|XP_006464489.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 ref|XP_006495173.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|ESR41227.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
Length=508

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 75/110 (68%), Gaps = 3/110 (3%)
 Frame = +2

Query  41   VVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGG  220
            ++ I  +I+C++  R  +   S  +  P N+PVVG LP LL N  RIH+Y TE+L ++  
Sbjct  6    LLDIFLAIICFLILRYCF---SNNNGIPKNFPVVGTLPHLLLNVHRIHDYSTEVLEKTQC  62

Query  221  TFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            TF  KGPWFAN D+L T DPANV+HI+  NF N+PKGP F++IF +LG G
Sbjct  63   TFLFKGPWFANMDILATVDPANVHHIMSSNFSNFPKGPEFKRIFDILGDG  112


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = +1

Query  322  SQGSSFPENISRPR------DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKME  483
            S  S+FP+     R      DG+ N DS+LW+  R+    LMN  +F   L ++   K+E
Sbjct  91   SNFSNFPKGPEFKRIFDILGDGIFNSDSDLWKNQRRFAQALMNRHSFYKFLVKSNQAKLE  150

Query  484  NGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDG  663
             G+ P+L+H ++QGT VDLQ++F R +FD +       D G L ++   +  +L A+ D 
Sbjct  151  KGLIPILDHMSKQGTTVDLQDLFQRFTFDSTSLFVTGYDPGCLSIE-FPEVRLLMALEDA  209

Query  664  VNAILYREILPE  699
              +I YR ++PE
Sbjct  210  EESIFYRHVVPE  221



>ref|XP_009795100.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=505

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 73/111 (66%), Gaps = 9/111 (8%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            + +A+LC  L + +         R S +P NWP+ GMLP  L +  +IHE  T  +R SG
Sbjct  11   IFLAMLCFFLFYYY---------RDSKYPINWPIFGMLPGALYHIQQIHERCTMTMRASG  61

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GTF  KGPWFAN DML T DPANV++I+  NF N+PKGP+F+++F VLG G
Sbjct  62   GTFLFKGPWFANMDMLSTVDPANVHYIMSANFMNFPKGPKFKEMFDVLGNG  112


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 69/125 (55%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+ N D ++W++ RKTT  L+ H  F   L +   +K+E G+ PVL
Sbjct  98   KGPKFKEMFDVLGNGIFNADLDMWKIQRKTTRALITHLQFYKFLVKTSREKVEKGLIPVL  157

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            ++   +G+ VDLQ++F R +FD +       D G + +D   D P  +A+ D   AIL+R
Sbjct  158  DYICDKGSIVDLQDLFQRFTFDTTCILVTGYDPGCVSID-FPDVPFSKAMDDAEEAILFR  216

Query  685  EILPE  699
              LPE
Sbjct  217  HALPE  221



>ref|XP_006301190.1| hypothetical protein CARUB_v10021589mg [Capsella rubella]
 gb|EOA34088.1| hypothetical protein CARUB_v10021589mg [Capsella rubella]
Length=406

 Score =   104 bits (260),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +2

Query  95   KKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTG  274
            +K+S RS    NWP +GM+P L+    RI +++ E L  S   F  KG WF+  D+L+T 
Sbjct  25   QKKSHRSPLFKNWPFLGMVPGLVVTLPRIFDWMVEALEASDLNFVFKGAWFSGTDLLLTA  84

Query  275  DPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            DP N++HIL  NFQNYPKGP F+KIF VLG G
Sbjct  85   DPRNIHHILSSNFQNYPKGPEFKKIFDVLGDG  116


 Score = 42.4 bits (98),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query  454  LERNVSQKMENGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGD  633
            L  N+S K++  +FP+L+   ++   +DLQ++F R  FDIS       D  SL ++   +
Sbjct  122  LSSNIS-KVKKDLFPILDKAIEENIILDLQDVFQRYMFDISSILMTGYDPMSLSIE-MPE  179

Query  634  HPILEAIRDGVNAILYREILP  696
                EA+  G  AI YR + P
Sbjct  180  VEFAEAVDLGEEAIFYRHLQP  200



>ref|XP_009113346.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score = 95.9 bits (237),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +2

Query  98   KRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGD  277
            K+S+      NWP  GMLP +L +  RI ++  E+L  +   F  KGPW +  DML T D
Sbjct  26   KKSQSQPILKNWPFFGMLPGMLAHIPRIFDFSVEVLEATNLIFSFKGPWLSGTDMLFTAD  85

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            P N++HIL  NF NYPKGP  +KIF+ LG G
Sbjct  86   PWNIHHILSLNFGNYPKGPEAKKIFNALGDG  116


 Score = 51.2 bits (121),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 58/112 (52%), Gaps = 3/112 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNF-RTSLERNVSQKMENGMFPVLEHYAQQGTHVDL  540
            DG+++ D ELWE  RK+   + +H +F + S+  N + K++  +   L++ A +   +DL
Sbjct  115  DGILSADMELWENLRKSNHAIFHHPDFLKLSVSSN-TIKLKESLILFLDNAAHEKIIIDL  173

Query  541  QEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            Q++F R  FD S       D  SL ++   +    EA+  G  AI YR   P
Sbjct  174  QDVFKRFMFDTSSILMTGYDPMSLSIE-MPEVLFDEAVETGEEAIYYRYFKP  224



>gb|EYU27555.1| hypothetical protein MIMGU_mgv1a020397mg [Erythranthe guttata]
Length=503

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            +VV  L   LC+   +    ++ +R+  PTNWPV+GMLP  L N GR HEY+TE+L+++G
Sbjct  1    MVVMHLTLFLCY--GKIFHARKEKRT--PTNWPVLGMLPGALANIGRPHEYITEVLQQNG  56

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GTF  KGPWF N +++ T DP NV++I  +NF N+ KGP F+K+F ++G G
Sbjct  57   GTFYHKGPWFTNLNIMFTCDPVNVHYIQAKNFSNFQKGPEFKKMFDIMGEG  107


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 68/133 (51%), Gaps = 3/133 (2%)
 Frame = +1

Query  304  QKLPELSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKME  483
            +      +G  F +      +G++  +SE WE  R++   L+N+ +F   +    S KME
Sbjct  86   KNFSNFQKGPEFKKMFDIMGEGILTAESESWENQRRSAKSLINNTSFLEFVATTTSNKME  145

Query  484  NGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRD  660
              + P+LE  ++ G  VD+QE+F R++FD S    L  D  SLC + P   H   +A  D
Sbjct  146  TALIPILEVASETGLEVDMQELFERLTFDSSCILVLGHDPVSLCKELPYLPHE--KAFVD  203

Query  661  GVNAILYREILPE  699
               AI YR +LPE
Sbjct  204  AEEAIFYRHVLPE  216



>ref|XP_009109464.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=524

 Score = 82.0 bits (201),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
            +P NWPV+GMLP ++    RI + +  +L +S  TF  KGPW    D+L T DPAN+ HI
Sbjct  37   YPWNWPVLGMLPTIILWYKRI-DVLIWVLEKSNLTFLFKGPWLTRMDLLFTVDPANIQHI  95

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  NF NY KGP  ++IF V G
Sbjct  96   LSSNFTNYIKGPEMKEIFDVYG  117


 Score = 63.9 bits (154),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 59/111 (53%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            D +   D ELW   R ++  + NH  F+  L    + K+++ + P+  HY+++GT VDLQ
Sbjct  118  DAIFTADGELWRNIRMSSMVMFNHQGFQNFLMSITTSKLKDVLVPLFNHYSEEGTVVDLQ  177

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++F R   D +       D  SL ++   +    +A+ +  ++++YR ++P
Sbjct  178  DVFGRFMLDTTLVVITGSDPQSLSIE-MPEVEFAKALENAGDSVVYRHVIP  227



>emb|CDY66735.1| BnaC03g60620D [Brassica napus]
Length=502

 Score = 85.9 bits (211),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
            +P NWPV+GMLPA++    RI + +  +L +S  TF  KGPWF   D+L T DPAN+ HI
Sbjct  37   YPWNWPVLGMLPAIILWYKRI-DVLIWVLEKSNLTFLFKGPWFTRMDLLFTVDPANIQHI  95

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  NF NY KGP  ++IF V G
Sbjct  96   LSSNFTNYIKGPEMKEIFDVYG  117


 Score = 60.1 bits (144),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 56/111 (50%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            D +   D ELW   R ++  + NH  F+       + K+++ + P+  HY+++G  VDLQ
Sbjct  118  DAIFTADGELWRNIRMSSMVMFNHQGFQNFSMSITTSKLKDVLLPLFSHYSEEGAVVDLQ  177

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++F R   D +       D  SL  +   +    +A+ +  ++++YR ++P
Sbjct  178  DVFGRFMLDTTLVAITGSDPQSLSTE-MPEVEFAKALENAGDSVVYRHVIP  227



>ref|XP_006427985.1| hypothetical protein CICLE_v10025385mg [Citrus clementina]
 gb|ESR41225.1| hypothetical protein CICLE_v10025385mg [Citrus clementina]
Length=513

 Score = 83.6 bits (205),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +2

Query  110  RSVFPTNW--PVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPA  283
            R + PT W  P++GML +++ N  ++H+ V ++L ++ G+F IKG W A  DM +T DPA
Sbjct  25   RKINPTPWNLPLLGMLASVILNINQLHDKVAQILEKTKGSFMIKGSWVAQYDMFLTSDPA  84

Query  284  NVNHILCRNFQNYPKGPRFRKIFHVLG  364
            NV HI+  NF  Y KG   RK F + G
Sbjct  85   NVQHIMSTNFSKYHKGSEGRKRFDIFG  111


 Score = 62.0 bits (149),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 58/113 (51%), Gaps = 3/113 (3%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQE  546
            G+ N D + W+  RK     +NH  F+  + + V + +E G+ PVL+H +++   VD Q+
Sbjct  114  GLFNSDFDEWKHQRKLARAFINHQKFQQLMAKIVPEMIERGLIPVLDHVSEEKMLVDFQD  173

Query  547  IFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPEC  702
            +  R +FD +       +  SL V  P    P  +A+ D   AIL R ++PE 
Sbjct  174  LLKRTTFDFACLIATGHNPNSLSVGFPEMGFP--DAVDDACEAILIRHLVPES  224



>ref|XP_010554002.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=525

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 5/110 (5%)
 Frame = +2

Query  41   VVAILCSIL--CWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            VV  L S+L  C+ +    +  +   +VFPTNWP +GMLPALLQ   +I++Y  +LL  S
Sbjct  23   VVFFLISLLAICFFF---FFINKKTHAVFPTNWPFLGMLPALLQMLHQIYDYSADLLESS  79

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLG  364
              TF +KGPWFA  DML+T DPAN++HI+  NF NY KGP F ++F V G
Sbjct  80   NMTFLLKGPWFAGIDMLITVDPANIHHIMSSNFLNYTKGPEFNEVFEVFG  129


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 1/126 (1%)
 Frame = +1

Query  322  SQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPV  501
            ++G  F E      + + N DS+LW+  RK+   ++NH  F+         K++ G+ P+
Sbjct  116  TKGPEFNEVFEVFGEAIFNTDSDLWKDKRKSAQVMLNHHGFQRFTLSTTVNKIKKGLVPL  175

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILY  681
            L+H A+    +DLQ++F R +FD +F      D  SL ++   +  +  A+ D   AI+Y
Sbjct  176  LDHAAKLNVALDLQDVFQRFAFDTTFFLVSGFDAKSLSIE-MPEVELARALDDAEEAIVY  234

Query  682  REILPE  699
            R + P+
Sbjct  235  RHVKPK  240



>ref|XP_009614166.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=505

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 72/111 (65%), Gaps = 9/111 (8%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            + + +LC  L + +         R S +P NWP+ GMLP  L +  +IHE  T  +R SG
Sbjct  11   IFLTMLCFFLFYFF---------RDSKYPINWPIFGMLPGALYHIQQIHERCTMTMRASG  61

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GTF  KGPWFAN DML T DPANV++I+  NF N+PKGP+F+++F VLG G
Sbjct  62   GTFLFKGPWFANMDMLSTVDPANVHYIMSANFMNFPKGPKFKEMFDVLGNG  112


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 68/125 (54%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+ N D ++W++ RKTT  L+ H  F   L +    K+E G+ PVL
Sbjct  98   KGPKFKEMFDVLGNGIFNADLDMWKIQRKTTRALITHQQFYKFLVKTSRDKVEKGLIPVL  157

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            ++   +G+ VDLQ++F R +FD +       D G + +D   D P  +A+ D   AIL+R
Sbjct  158  DYICDKGSIVDLQDLFQRFTFDTTCILVTGYDPGCVSID-FPDVPFSKAMDDAEEAILFR  216

Query  685  EILPE  699
              LPE
Sbjct  217  HALPE  221



>gb|EEE54005.1| hypothetical protein OsJ_00650 [Oryza sativa Japonica Group]
Length=477

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I+ S  C++     +++RS+R   PTNWPVVG LPA++ NAGR+H++VTE LR +  +  
Sbjct  17   IMASAACFLLLFCRFRRRSKR--IPTNWPVVGALPAIVANAGRVHDWVTEFLRAAAMSHV  74

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            ++GPW +  D+L+T DPANV H+   NF NYPKG  F  +F VLG G
Sbjct  75   VEGPWGSPGDVLITADPANVAHMFTANFGNYPKGEEFAAMFDVLGGG  121


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F         G+ N D E W   R+    L++   FR ++  + S+K+  G+ P+L
Sbjct  107  KGEEFAAMFDVLGGGIFNADGESWSFQRRKAHALLSDARFRAAVAASTSRKLGGGLVPLL  166

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +  A  G  VDLQ++F R++FD++       D G L  D PT   P   A+ D    + Y
Sbjct  167  DGVAASGAAVDLQDVFMRLTFDLTAMFVFGVDPGCLAADFPT--VPFAAAMDDAEEVLFY  224

Query  682  REILP  696
            R + P
Sbjct  225  RHVAP  229



>ref|XP_010681071.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=486

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +2

Query  92   WKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVT  271
            W     +S  PTNWP+VGML  LL+N  RIH++V+E+L  S  +F  KGPWF N +MLVT
Sbjct  17   WNIFRNKSGTPTNWPLVGMLLPLLRNVNRIHDWVSEILETSQLSFLFKGPWFTNMEMLVT  76

Query  272  GDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             DPAN++HI+ +NF NYPKG +F +IF V+G G
Sbjct  77   VDPANIHHIMTKNFSNYPKGTKFNEIFDVMGDG  109


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 67/124 (54%), Gaps = 1/124 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G+ F E      DG+ NVD +LW+ HR      + H  FR  L   + +K+E G+ PVL
Sbjct  95   KGTKFNEIFDVMGDGIFNVDFDLWKYHRSMAHTFIAHPRFRHFLVVKIQEKVEKGLIPVL  154

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H A +   VDLQ+IF R +FD      +  D+GSL +D     P  +A+ D    ILYR
Sbjct  155  DHAANERLVVDLQDIFARFTFDNICTLVMGHDVGSLSID-WPHVPFSKALDDVEEVILYR  213

Query  685  EILP  696
             ++P
Sbjct  214  HVVP  217



>gb|ACR38435.1| unknown [Zea mays]
 gb|AFW80290.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=511

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            ++ S+ C++    ++++ ++R   PTNWPVVG LPA+  NAGR+HE+VTE LR +G ++ 
Sbjct  17   LMVSLACFLL---LFRRLNQRDGLPTNWPVVGALPAITVNAGRMHEWVTEFLRAAGLSYV  73

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +KGPW +  D+++T DPANV H+   NF NYPKG  F  +F VLG G
Sbjct  74   MKGPWGSPVDVIMTADPANVAHVFTSNFGNYPKGQEFAALFDVLGDG  120


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 60/125 (48%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F        DG+ N D E W   R+    L++   FR  +  + ++K+ + + P+L
Sbjct  106  KGQEFAALFDVLGDGIFNADGESWAFQRRKAHALLSDARFRAGVAASTARKLRDALVPLL  165

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAIL-Y  681
            +  A  G  VDLQ++F R++FD++       D G  C+ P   +    A  D V  +L Y
Sbjct  166  DGIAASGAVVDLQDVFVRLTFDLTAMFVFGIDPG--CLAPDFPYVPFAAAMDTVEEVLFY  223

Query  682  REILP  696
            R + P
Sbjct  224  RHVAP  228



>dbj|BAA99522.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 gb|EAZ10814.1| hypothetical protein OsJ_00649 [Oryza sativa Japonica Group]
Length=510

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 1/108 (1%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSR-RSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTF  226
            I  +I+C+ W       R R +S  P NWPV GMLP L+QN   IH+ V ++LRE+G TF
Sbjct  14   IFLAIICFFWFSLFRPIRQRQKSNLPVNWPVFGMLPFLVQNLHYIHDKVADVLREAGCTF  73

Query  227  EIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             + GPWF N + L+T DPA VNH    NF+NYPKG  F ++F +LG G
Sbjct  74   MVSGPWFLNMNFLITCDPATVNHCFNANFKNYPKGSEFAEMFDILGDG  121


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 65/125 (52%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E      DG++  DSE WE  R+    +     FR+     +++K  + + P L
Sbjct  107  KGSEFAEMFDILGDGLLVADSESWEYQRRMAMYIFAARTFRSFAMSTITRKTGSVLLPYL  166

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPIL-EAIRDGVNAILY  681
            +H A+ G+ V+L+ +F R S D+++      DL   C+  +   P+  +A ++   A+L+
Sbjct  167  DHMAKFGSEVELEGVFMRFSLDVTYSTVFAADLD--CLSVSSPIPVFGQATKEAEEAVLF  224

Query  682  REILP  696
            R ++P
Sbjct  225  RHVIP  229



>gb|EPS60696.1| hypothetical protein M569_14105, partial [Genlisea aurea]
Length=468

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  101  RSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDP  280
            RSR S    +WP+V MLP L +N  R+H+++ E+L ESGGTF  +GP F N DMLVT DP
Sbjct  1    RSRNSKI-ADWPIVAMLPGLARNVHRVHDFIAEVLAESGGTFVFRGPVFGNTDMLVTSDP  59

Query  281  ANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            ANV++IL +NF N+ KGP F+KIF +LG G
Sbjct  60   ANVHYILSKNFHNFGKGPDFKKIFDILGDG  89


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 3/130 (2%)
 Frame = +1

Query  319  LSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFP  498
              +G  F +      DG+   + E WE  R+     + +  F   + R V  K+   + P
Sbjct  73   FGKGPDFKKIFDILGDGIFAAEFESWEKQRRAAKAAVGNLAFHQFVARTVWGKVSETLVP  132

Query  499  VLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAI  675
            +L   ++    +DLQ  F R++FD +  Q L  D  SL  + P   H    A  D   AI
Sbjct  133  MLRSASENEETIDLQTTFERLAFDTTCMQVLGHDPCSLSEEMPHLGHE--RAFSDAEEAI  190

Query  676  LYREILPECC  705
            LYR  +PE  
Sbjct  191  LYRHFIPEVV  200



>ref|XP_006340071.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=499

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +2

Query  107  RRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPAN  286
            + S  PTNWP+VGMLP L++N  R+HE  TE+L ES GTFE  GP FAN +ML T DP N
Sbjct  17   KLSSLPTNWPIVGMLPELIRNLHRVHEKTTEVLIESNGTFEFHGPVFANFNMLGTSDPEN  76

Query  287  VNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +++IL +NF NYPKG  FRK F + G G
Sbjct  77   IHYILSKNFSNYPKGVEFRKYFDIFGNG  104


 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 80/127 (63%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ +VD ELWE+HRKTT  LM H  F T LERN+ + +ENG+ P+L
Sbjct  90   KGVEFRKYFDIFGNGIFSVDYELWEIHRKTTMYLMGHAKFHTLLERNIWEIIENGLRPIL  149

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A+  T  DLQ+IFHR +FD+  +  LD D  SL +      P  +A  D V+A+LYR
Sbjct  150  DDFAELDTLFDLQDIFHRFTFDVICKLLLDHDPKSLSIG-LPHVPCEKAFNDTVDALLYR  208

Query  685  EILPECC  705
             ILPECC
Sbjct  209  YILPECC  215



>gb|KJB75063.1| hypothetical protein B456_012G021700 [Gossypium raimondii]
Length=511

 Score = 82.0 bits (201),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             P NWP VGM+P LL N  R H+ V ++LR S GTF  +G WF N   L T DP NV +I
Sbjct  31   LPRNWPFVGMIPTLLLNIHRPHDKVAQVLRRSNGTFFYRGLWFTNTSFLGTSDPENVRYI  90

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  N   Y KGP + K F + G
Sbjct  91   LSSNSSVYLKGPEWLKQFDIFG  112


 Score = 61.2 bits (147),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            + + N D E W+ HR+     +NH  +R SL + + Q++E  +  VLE+++ +   V+LQ
Sbjct  113  EALFNSDGEAWKCHRRVFHAFLNHPQYRQSLSKVLHQRIEEALVKVLEYFSGREMVVNLQ  172

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R +FDI     +  + G L ++   ++   +A+ D + A  YR ++P+
Sbjct  173  DLLVRHAFDIGCITGVGFNPGLLSIE-FPENRFQKAMSDTLEAAFYRYVVPD  223



>ref|XP_010109842.1| Cytochrome P450 [Morus notabilis]
 gb|EXC24785.1| Cytochrome P450 [Morus notabilis]
Length=191

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            +VV IL  IL   + R+I KK    S    +WP VGMLP LL+    IH+  TE L ++G
Sbjct  9    LVVVILNFILLRKYRRKIIKKNGAFS----SWPAVGMLPDLLKRLESIHDSGTEFLMQNG  64

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHV-LGMG  370
            GTFEI+GPW AN D L T DP NV +IL + F NYPKGP FR IF   LG G
Sbjct  65   GTFEIEGPWLANMDFLATCDPVNVQYILAKKFANYPKGPEFRDIFEEHLGDG  116



>gb|EAY72807.1| hypothetical protein OsI_00673 [Oryza sativa Indica Group]
Length=505

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I+ S  C++     +++RS+R   PTNWPVVG LPA++ NAGR+H++VTE LR +  +  
Sbjct  17   IMASAACFLLLFCRFRRRSKR--IPTNWPVVGALPAIVANAGRVHDWVTEFLRAAAMSHV  74

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            ++GPW +  D+L+T DPANV H+   NF NYPKG  F  +F VLG G
Sbjct  75   VEGPWGSPGDVLITADPANVAHMFTANFGNYPKGEEFAAMFDVLGGG  121


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F         G+ N D E W   R+    L++   FR ++  + S+K+  G+ P+L
Sbjct  107  KGEEFAAMFDVLGGGIFNADGESWSFQRRKAHALLSDARFRAAVAASTSRKLGGGLVPLL  166

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +  A  G  VDLQ++F R++FD++       D G L  D PT   P   A+ D    + Y
Sbjct  167  DGVAASGAAVDLQDVFMRLTFDLTAMFVFGVDPGCLADDFPT--VPFGAAMDDAEEVLFY  224

Query  682  REILP  696
            R + P
Sbjct  225  RHVAP  229



>ref|NP_001042228.1| Os01g0183600 [Oryza sativa Japonica Group]
 dbj|BAA99523.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF04142.1| Os01g0183600 [Oryza sativa Japonica Group]
 dbj|BAG99058.1| unnamed protein product [Oryza sativa Japonica Group]
Length=505

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I+ S  C++     +++RS+R   PTNWPVVG LPA++ NAGR+H++VTE LR +  +  
Sbjct  17   IMASAACFLLLFCRFRRRSKR--IPTNWPVVGALPAIVANAGRVHDWVTEFLRAAAMSHV  74

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            ++GPW +  D+L+T DPANV H+   NF NYPKG  F  +F VLG G
Sbjct  75   VEGPWGSPGDVLITADPANVAHMFTANFGNYPKGEEFAAMFDVLGGG  121


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F         G+ N D E W   R+    L++   FR ++  + S+K+  G+ P+L
Sbjct  107  KGEEFAAMFDVLGGGIFNADGESWSFQRRKAHALLSDARFRAAVAASTSRKLGGGLVPLL  166

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +  A  G  VDLQ++F R++FD++       D G L  D PT   P   A+ D    + Y
Sbjct  167  DGVAASGAAVDLQDVFMRLTFDLTAMFVFGVDPGCLAADFPT--VPFAAAMDDAEEVLFY  224

Query  682  REILP  696
            R + P
Sbjct  225  RHVAP  229



>gb|AJD25208.1| cytochrome P450 CYP86A92 [Salvia miltiorrhiza]
Length=525

 Score = 84.0 bits (206),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 68/113 (60%), Gaps = 10/113 (9%)
 Frame = +2

Query  62   ILCWIWARQIWKKRSRRSVF----PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            IL  + A  +W + + RS+     P  WPV+G LP L+QN GR+HE++ + LR  GGT++
Sbjct  9    ILALVSAYLLWFRSTTRSLKGPKGPRLWPVLGSLPGLIQNNGRMHEWIADNLRACGGTYQ  68

Query  230  ---IKGPWFANRDML--VTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
                  P+ A +  L  VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  69   TCIFAIPFLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGDG  121


 Score = 59.3 bits (142),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R VS+ ++N   P+LE   ++G  VDLQ
Sbjct  120  DGIFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVSRAIKNRFCPILESAQREGKPVDLQ  179

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L  D   ++    A      A L+R ILPE
Sbjct  180  DLLLRLTFDNICGLAFGKDPQTLAPD-LPENSFASAFDAATEASLHRFILPE  230



>gb|EAZ25511.1| hypothetical protein OsJ_09335 [Oryza sativa Japonica Group]
Length=518

 Score = 89.0 bits (219),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +2

Query  71   WIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFA  250
            +I+ R     ++  S+ PT WP+VGMLP+L+ N   + +Y T LL  SG +FE +GP  +
Sbjct  23   YIYLRYSRSAKANPSL-PTEWPLVGMLPSLVANIHNLFDYATALLAASGNSFEARGPPMS  81

Query  251  NRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLG  364
            +    VT DP NV HI   NF NYPKG  F   F V+G
Sbjct  82   SLRFFVTCDPDNVRHIFINNFANYPKGEEFASFFDVMG  119


 Score = 54.3 bits (129),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 9/118 (8%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            D   N D E W   R     +M++     S+      K+E G+ P+L+  A  G   DLQ
Sbjct  120  DSFFNADGESWRRQRARVQHVMSNPRLLASMAACCRGKVEKGLLPILDRMASAGAPFDLQ  179

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAIL----YREILPECC  705
             +  R +FD++       D   L +    D P L+ + + ++A++    +R  +P  C
Sbjct  180  RLLTRFAFDVTAMAVFGVDTCRLSI----DMPPLD-VANAMDAVMEVGFFRHTVPVSC  232



>ref|NP_001048908.1| Os03g0138200 [Oryza sativa Japonica Group]
 gb|ABF93878.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10822.1| Os03g0138200 [Oryza sativa Japonica Group]
 dbj|BAG97395.1| unnamed protein product [Oryza sativa Japonica Group]
Length=522

 Score = 89.0 bits (219),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +2

Query  71   WIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFA  250
            +I+ R     ++  S+ PT WP+VGMLP+L+ N   + +Y T LL  SG +FE +GP  +
Sbjct  27   YIYLRYSRSAKANPSL-PTEWPLVGMLPSLVANIHNLFDYATALLAASGNSFEARGPPMS  85

Query  251  NRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLG  364
            +    VT DP NV HI   NF NYPKG  F   F V+G
Sbjct  86   SLRFFVTCDPDNVRHIFINNFANYPKGEEFASFFDVMG  123


 Score = 54.3 bits (129),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 9/118 (8%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            D   N D E W   R     +M++     S+      K+E G+ P+L+  A  G   DLQ
Sbjct  124  DSFFNADGESWRRQRARVQHVMSNPRLLASMAACCRGKVEKGLLPILDRMASAGAPFDLQ  183

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAIL----YREILPECC  705
             +  R +FD++       D   L +    D P L+ + + ++A++    +R  +P  C
Sbjct  184  RLLTRFAFDVTAMAVFGVDTCRLSI----DMPPLD-VANAMDAVMEVGFFRHTVPVSC  236



>gb|AFW89633.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=543

 Score = 83.6 bits (205),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 64/116 (55%), Gaps = 4/116 (3%)
 Frame = +2

Query  29   ESYVVVAILCSILCWI--WARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTEL  202
            E + +   L  +LC+I  + R +  K++   + PT WPVVG LP L+ N  R H++ T +
Sbjct  2    EPFFLFIELALVLCFITLYYRHLQSKKTS-PLEPTEWPVVGHLPGLVANIHRFHDWATGV  60

Query  203  LRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            L   G  FE +G     R   +T DP+NV HI   NF NYPKG  +  IF VLG G
Sbjct  61   LAGVGCNFEARGGRTGLR-YFITCDPSNVRHIFTSNFANYPKGEEYAAIFDVLGGG  115


 Score = 59.3 bits (142),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 50/118 (42%), Gaps = 6/118 (5%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQ-----QGTH  531
            G+ N D E W   R     LM    FR    R    K+E  + P L H+A      + T 
Sbjct  115  GIFNADGESWRRQRVKAQMLMTGPRFRAFTARCSRDKVERSLLPFLAHHAAADDEGRPTP  174

Query  532  VDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPECC  705
             DL ++F R++FD++       D G L +   G  P   A+ D +  +  R I P  C
Sbjct  175  CDLHDVFLRLTFDMTCALVFGVDPGCLALGLPGV-PFARAMDDALETLFLRHITPTAC  231



>ref|XP_004985761.1| PREDICTED: cytochrome P450 86B1-like [Setaria italica]
Length=503

 Score = 79.3 bits (194),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +2

Query  53   LCSILCWI--WARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTF  226
            L  +LC++  +   +  K++   + PT WP+VG LP L+ N    H++ T +LR +   F
Sbjct  10   LLPVLCFLTLYYHHLQSKKTS-PLEPTEWPIVGQLPGLVANIHHFHDWATGVLRGASYNF  68

Query  227  EIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            E +G     R   +T DP+NV HI   NF NYPKG  F  IF VLG G
Sbjct  69   EARGGRTGLR-YFITCDPSNVRHIFTSNFANYPKGDEFAVIFDVLGGG  115


 Score = 63.5 bits (153),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 49/114 (43%), Gaps = 3/114 (3%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQE  546
            G+ N D E W   R     LM    FRT   R    K+E  + P L H A +G   DL  
Sbjct  115  GIFNADGESWRRQRVKAQMLMTGSRFRTFTARCSRDKVERSLLPFLAHAADEGAPCDLHN  174

Query  547  IFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPECC  705
            +F R++FD++       D G L +  P    P   A+ D +  +  R I P  C
Sbjct  175  VFLRLTFDMTCTLVFGVDPGCLAIGLPV--VPFARAMDDALETLFLRHITPMPC  226



>gb|EAY88464.1| hypothetical protein OsI_09931 [Oryza sativa Indica Group]
Length=518

 Score = 88.6 bits (218),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 57/98 (58%), Gaps = 1/98 (1%)
 Frame = +2

Query  71   WIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFA  250
            +I+ R     ++  S+ PT WP+VGMLP+L+ N   + +Y T LL  SG +FE +GP  +
Sbjct  23   YIYLRYSRSAKANPSL-PTEWPLVGMLPSLVANIHNLFDYATALLAASGNSFEARGPPMS  81

Query  251  NRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLG  364
                 VT DP NV HI   NF NYPKG  F   F V+G
Sbjct  82   GLRFFVTCDPDNVRHIFINNFANYPKGEEFASFFDVMG  119


 Score = 54.3 bits (129),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 9/118 (8%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            D   N D E W   R     +M++     S+      K+E G+ P+L+  A  G   DLQ
Sbjct  120  DSFFNADGESWRRQRARVQHVMSNPRLLASMAACCRGKVEKGLLPILDRMASAGAPFDLQ  179

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAIL----YREILPECC  705
             +  R +FD++       D   L +    D P L+ + + ++A++    +R  +P  C
Sbjct  180  RLLTRFAFDVTAMAVFGVDTCRLSI----DMPPLD-VANAMDAVMEVGFFRHTVPVSC  232



>emb|CDX76867.1| BnaC08g34530D [Brassica napus]
Length=516

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 70/111 (63%), Gaps = 3/111 (3%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            + V+ LC    + +   +  K+  RS FPTNWP +GMLP LL    R+++YVTE L  S 
Sbjct  9    ITVSFLC--FSFFFGYFLIMKKPHRS-FPTNWPFLGMLPGLLVEIPRVYDYVTEFLEASN  65

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             TF  KGP F   DML T DPAN++HI+  NF NYPKG  F+K+F VLG G
Sbjct  66   LTFPFKGPCFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFSVLGDG  116


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNF-RTSLERNVSQKMENGMFPV  501
            +GS F +  S   DG+ N DS+LW+  RK+   +M+   F R +L  N+S K+E G+ P+
Sbjct  102  KGSEFKKLFSVLGDGIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNMS-KLEKGLVPI  160

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE---AIRDGVNA  672
            L+H+A++    DLQ++F   +FD +F      D G L +    + P +E   A+ +   A
Sbjct  161  LDHFAEKKLVFDLQDVFQSFTFDTTFVLATGIDPGCLSI----EMPKIEFAKALDEAEEA  216

Query  673  ILYREILPE  699
            I +R   PE
Sbjct  217  IFFRHFKPE  225



>ref|XP_010680694.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=290

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 75/111 (68%), Gaps = 8/111 (7%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            + V I   + C+++       R++  + PTNWP++GMLPALL+NA RIHE++ EL+  S 
Sbjct  4    ITVLIFFVLFCYLF-------RNKNGI-PTNWPLLGMLPALLKNAYRIHEFLIELMERSN  55

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             TF  KGPWF+N ++L+T DP N++H+L + F+NY KGP+  +I   LG G
Sbjct  56   LTFHFKGPWFSNMNLLLTIDPTNIHHVLSKRFENYVKGPKLYEILEPLGDG  106


 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 64/124 (52%), Gaps = 1/124 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G    E +    DG++  DS LW  HR       NH  F  SL     +K++NG+ PVL
Sbjct  92   KGPKLYEILEPLGDGILTTDSTLWLYHRNVAHSFFNHPKFHQSLVDVTWKKVKNGLIPVL  151

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            EH ++    +DLQ++F R S+D      +D D  SL VD + D P+L+A+ D  +    R
Sbjct  152  EHVSKHNIVIDLQDLFLRFSYDTMCTIMMDHDPTSLSVD-SPDFPLLKAVADMAHGAFIR  210

Query  685  EILP  696
              +P
Sbjct  211  HAVP  214



>ref|XP_009117295.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=534

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 71/112 (63%), Gaps = 3/112 (3%)
 Frame = +2

Query  41   VVAILCSILC--WIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            ++ I  S LC  + +   +  K+  RS FPTNWP +GMLP LL    R+++YVTE L  S
Sbjct  24   LLEISVSFLCFSYFFGYFLIMKKPHRS-FPTNWPFLGMLPGLLVEIPRVYDYVTEFLEAS  82

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
              TF  KGP F   DML T DPAN++HI+  NF NYPKG  F+K+F VLG G
Sbjct  83   NLTFPFKGPRFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFDVLGDG  134


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 69/126 (55%), Gaps = 3/126 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNF-RTSLERNVSQKMENGMFPV  501
            +GS F +      DG+ N DS+LW+  RK+   +M+   F R +L  N+S K+E G+ P+
Sbjct  120  KGSEFKKLFDVLGDGIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNMS-KLEKGLVPI  178

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILY  681
            L+H+A++    DLQ++F R +FD +F      D G L ++   +     A+ +   AI +
Sbjct  179  LDHFAEKKLVFDLQDVFQRFTFDTTFVLATGIDPGCLSIE-MPEIEFARALDEAEEAIFF  237

Query  682  REILPE  699
            R   PE
Sbjct  238  RHFKPE  243



>emb|CAE54308.1| cytochrome P450-like protein [Gossypium hirsutum]
Length=511

 Score = 83.2 bits (204),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             P NWP VGM+P LL N  R H+ V ++LR S GTF  +G WF N   L T DP NV +I
Sbjct  31   LPRNWPFVGMIPTLLLNIHRPHDKVAQVLRRSNGTFFYRGLWFTNTSFLATSDPENVRYI  90

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  N   Y KGP + K F + G
Sbjct  91   LSSNSSVYLKGPEWLKQFDIFG  112


 Score = 59.3 bits (142),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            + + N D E W+ HR+     +NH  +R SL + + Q++E  +  VLE+ + +   V+LQ
Sbjct  113  EALFNSDGEAWKCHRRVFHAFLNHPQYRQSLSKVLHQRIEEALVKVLEYVSGREMVVNLQ  172

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++    +FDI     +  D G L ++   ++   +A+ D + A  YR ++P+
Sbjct  173  DLLAGHAFDIGCITGVGFDPGLLSIE-FPENRFQKAMSDTLEAAFYRYVVPD  223



>emb|CDY46088.1| BnaA09g42120D [Brassica napus]
Length=516

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 71/112 (63%), Gaps = 3/112 (3%)
 Frame = +2

Query  41   VVAILCSILC--WIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            ++ I  S LC  + +   +  K+  RS FPTNWP +GMLP LL    R+++YVTE L  S
Sbjct  6    LLEISVSFLCFSYFFGYFLIMKKPHRS-FPTNWPFLGMLPGLLVEIPRVYDYVTEFLEAS  64

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
              TF  KGP F   DML T DPAN++HI+  NF NYPKG  F+K+F VLG G
Sbjct  65   NLTFPFKGPRFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFDVLGDG  116


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 70/126 (56%), Gaps = 3/126 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNF-RTSLERNVSQKMENGMFPV  501
            +GS F +      DG+ N DS+LW+  RK+   +M+   F R +L  N+S K+E G+ P+
Sbjct  102  KGSEFKKLFDVLGDGIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNMS-KLEKGLVPI  160

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILY  681
            L+H+A++    DLQ++F R +FD +F      D G L ++   +    +A+ +   AI +
Sbjct  161  LDHFAEKKLVFDLQDVFQRFTFDTTFVLATGIDPGCLSIE-MPEIEFAKALDEAEEAIFF  219

Query  682  REILPE  699
            R   PE
Sbjct  220  RHFKPE  225



>ref|XP_004249314.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=509

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYV  193
            M   + S + + I CS    IW   I  +R++ S  PTNWP++  LP ++ N  R H Y+
Sbjct  1    MDFLEYSLLFLLIFCSTYS-IWF--IIYRRTKTSA-PTNWPILRELPGVIGNLHRGHAYM  56

Query  194  TELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            TE+L E GGT++ KGP F N DM  T DPAN+++I  +NF NYPKGP FRKIF +LG G
Sbjct  57   TEVLIEYGGTYDFKGPIFTNVDMFFTCDPANIHYIFSKNFSNYPKGPEFRKIFDMLGNG  115


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 75/125 (60%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ NVD ELWELHR+TT  +M+H  F+  LE+ +   +E G+ P+L
Sbjct  101  KGPEFRKIFDMLGNGIFNVDHELWELHRRTTMSIMSHAKFQMLLEKTMWDIIEKGLKPIL  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A+QG  +DLQ++  R +FD   +  LD D  SL +D     P  +A  D ++A+L+R
Sbjct  161  DAFAKQGKTLDLQDVLQRFTFDSITRLLLDHDPKSLSMD-LPYLPYEKAFGDALDALLHR  219

Query  685  EILPE  699
             I P+
Sbjct  220  HITPQ  224



>emb|CDP04331.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +2

Query  146  MLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYP  325
            M+P L  N  R  +Y+TE+L+ESGGTFE KGPWFAN DMLVT DPANVNHIL ++F N+ 
Sbjct  1    MMPDLFLNVHRAQDYITEILQESGGTFEFKGPWFANMDMLVTSDPANVNHILSKSFSNFQ  60

Query  326  KGPRFRKIFHVLGMG  370
            KGP F K+F +LG G
Sbjct  61   KGPEFEKMFDILGKG  75


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 68/139 (49%), Gaps = 2/139 (1%)
 Frame = +1

Query  292  SHPLQK-LPELSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNV  468
            +H L K      +G  F +       G+ N + E WE  RKT  PL+NH  F+  +    
Sbjct  49   NHILSKSFSNFQKGPEFEKMFDILGKGIFNAECESWESPRKTIMPLINHQGFQKFVGITS  108

Query  469  SQKMENGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE  648
              K+E G+ PVLE  A+ G  VDLQ++F + +FD +    L  D  S  +D   + P+  
Sbjct  109  WNKLEKGLIPVLELAAKSGMEVDLQQLFAKFTFDTTCILVLGHDPASPGID-LPESPLGN  167

Query  649  AIRDGVNAILYREILPECC  705
            A  D   A+ YR ++P  C
Sbjct  168  AFADAEEAVFYRHVVPRTC  186



>ref|XP_006643842.1| PREDICTED: cytochrome P450 86B1-like [Oryza brachyantha]
Length=510

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = +2

Query  50   ILCSILCWIWARQI-WKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTF  226
            +  +I+C+ W       ++ ++   P NWPV+GMLP L++N   IH+ VT+ LRE+G TF
Sbjct  14   VFLAIICFFWLSLFRLIRQCQKRTLPVNWPVLGMLPFLVKNLHYIHDKVTDALREAGCTF  73

Query  227  EIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             + GPWF N + LVT DPA VNH    NF+NYPKG  F ++F +LG G
Sbjct  74   MVTGPWFLNMNFLVTCDPATVNHCFNANFKNYPKGSEFAEMFDILGDG  121


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 65/125 (52%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E      DG++  DSE WE  R+    +     FR+     +++K  N + P L
Sbjct  107  KGSEFAEMFDILGDGLLVADSESWEHQRRMAMYIFAARKFRSFAMSTIARKTGNVLLPYL  166

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPIL-EAIRDGVNAILY  681
            +H A+ G+ V+L+ +F R S D+++      DL   C+  +   P+  +A ++   A+L+
Sbjct  167  DHMAKFGSEVELEGVFMRFSLDVTYSTVFAADLD--CLSVSSSIPVFGQATKEAEEAVLF  224

Query  682  REILP  696
            R ++P
Sbjct  225  RHVVP  229



>ref|XP_002878665.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54924.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = +2

Query  44   VAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGT  223
            V+I    + +++   +  K+  RS F TNWP +GMLP LL    R+++YVTELL  S  T
Sbjct  9    VSISLLFISFLYGYCLISKKPHRS-FLTNWPFLGMLPGLLVEIPRVYDYVTELLEASNLT  67

Query  224  FEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +  KGP F   DML+T DPAN++HI+  NF NYPKG  F+KIF VLG G
Sbjct  68   YPFKGPCFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 7/128 (5%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F +      DG+ N DSELW+  RK+   +M H +F+    R    K+E G+ P+L
Sbjct  102  KGSEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMTHQDFQRFTLRTSMSKLEKGLVPLL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE---AIRDGVNAI  675
            ++ A++   VDLQ++F R +FD SF      D G L      + P +E   A+ +   AI
Sbjct  162  DYVAEKKLVVDLQDVFQRFTFDTSFILATGVDPGCLAT----EMPQIEFARALDEAEAAI  217

Query  676  LYREILPE  699
             +R + PE
Sbjct  218  FFRHVKPE  225



>gb|KJB75060.1| hypothetical protein B456_012G021500 [Gossypium raimondii]
Length=511

 Score = 83.2 bits (204),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             P NWP VGM+P LL N  R H+ V ++LR S GTF  +G WF N   L T DP NV +I
Sbjct  31   LPRNWPFVGMIPTLLLNIHRPHDKVAQVLRRSNGTFFYRGLWFTNTSFLATSDPENVRYI  90

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  N   Y KGP + K F + G
Sbjct  91   LSSNSSVYLKGPEWLKQFDIFG  112


 Score = 58.2 bits (139),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            + + N D E W+ HR+     +NH  +R SL + + Q++E  +  VLE+ + +   V+LQ
Sbjct  113  EAIFNSDCEAWKCHRRVFHAFLNHPQYRQSLSKVLHQRIEEALVKVLEYVSGREMVVNLQ  172

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R +FDI     +  + G L ++   ++   +A+ D + A  YR + P+
Sbjct  173  DLLVRHAFDIGCITGVGFNPGLLSIE-FPENRFQKAMSDTLEAAFYRYVAPD  223



>ref|XP_009615501.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=507

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  44   VAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGT  223
            + I  +ILC+     +   +     +P NWP+ GMLP  L     IHE VT  +R SGGT
Sbjct  9    IEIFLAILCFFLFHGLKDTKG----YPRNWPIFGMLPGTLYYMQEIHERVTMTMRRSGGT  64

Query  224  FEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            F  KGP FA  DML T DPANV++I+  NF N+PKGP+FR+IF VLG G
Sbjct  65   FLFKGPLFAKMDMLATVDPANVHYIMSENFMNFPKGPKFREIFDVLGDG  113


 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 67/126 (53%), Gaps = 1/126 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      DG+ N D +LW++ RKT   L+ H  F   L +   +K+E G+ PVL
Sbjct  99   KGPKFREIFDVLGDGIFNADMDLWKIQRKTARALITHQQFYKFLVKTSREKVEKGLIPVL  158

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H   +G  VDLQ++F R +FD +       D G + +D   D P  +A+ D   AIL R
Sbjct  159  DHVCHKGVIVDLQDLFQRFTFDTTCILVTGYDPGCVSID-FPDVPFSKAMDDAEEAILVR  217

Query  685  EILPEC  702
             ++PE 
Sbjct  218  HVMPEA  223



>ref|NP_001031814.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AEE87078.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=519

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I  +  C++  R     +    + PTNWP  GM+P LL    R+++++TE+L  +  T+ 
Sbjct  9    ISIAFFCFLLFRHFLINKKTHRLCPTNWPFFGMIPGLLVEIHRVYDFITEILEVTNLTYP  68

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
              GP FAN DMLVT DPAN++HI+  NF NYPKGP F+K+F +LG G
Sbjct  69   CTGPCFANLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDILGDG  115


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 65/125 (52%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N DSELW+  RK+   +M +  F+        +K+E G+ P+L
Sbjct  101  KGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSLKKLEKGLVPLL  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H A++   VDLQ++F R +FD +F      D G L V+   +     A+ D   AI +R
Sbjct  161  DHVAKEKLAVDLQDMFQRFTFDTTFVLATGYDPGCLSVE-MPEVEFARALDDAEEAIFFR  219

Query  685  EILPE  699
             + PE
Sbjct  220  HVKPE  224



>gb|KDO45858.1| hypothetical protein CISIN_1g047974mg [Citrus sinensis]
Length=497

 Score = 83.6 bits (205),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +2

Query  110  RSVFPTNW--PVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPA  283
            R + PT W  P++GML +++ N  ++H+ V ++L ++ G+F IKG W A  DM +T DPA
Sbjct  25   RKINPTPWNLPLLGMLASVILNINQLHDKVAQILEKTKGSFMIKGSWVAQYDMFLTSDPA  84

Query  284  NVNHILCRNFQNYPKGPRFRKIFHVLG  364
            NV HI+  NF  Y KG   RK F + G
Sbjct  85   NVQHIMSTNFSKYHKGSEGRKRFDIFG  111


 Score = 57.0 bits (136),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 3/109 (3%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQE  546
            G+ N D + W+  RK     +NH  F+  + + V + +E G+ PVL+H +++   VD Q+
Sbjct  114  GLFNSDFDEWKHQRKLARAFINHQKFQQLMAKIVPEMIERGLIPVLDHVSEEKMLVDFQD  173

Query  547  IFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREI  690
            +  R +FD +       +  SL V  P    P  +A+ D   AIL R +
Sbjct  174  LLKRTTFDFACLIATGHNPNSLSVGFPEMGFP--DAVDDACEAILIRHL  220



>gb|KJB47429.1| hypothetical protein B456_008G026100 [Gossypium raimondii]
Length=510

 Score = 81.3 bits (199),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             P NWP+VGM+P LL N  R H+ V ++LR S  TF   G WF N   L T DP NV +I
Sbjct  30   LPRNWPLVGMIPTLLLNIHRPHDKVAQILRRSNDTFFYTGLWFTNTSFLATSDPENVRYI  89

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  N   Y KGP + K F + G
Sbjct  90   LSSNSSVYNKGPEWLKQFDIFG  111


 Score = 59.7 bits (143),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            + + N D E W+ HR+     +NH  FR SL + + Q++E  +  VLE+ + +   V+LQ
Sbjct  112  EALFNSDGEAWKRHRRVFHAFLNHPQFRQSLAKVLHQRIEEALVKVLEYVSGREMVVNLQ  171

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R +FDI     +  + G L ++   ++    A+ D + A  YR ++P+
Sbjct  172  DLLVRHAFDIGCITGVGFNPGLLSIE-FPENRFHNAMSDTLEAAFYRYVMPD  222



>ref|XP_010680693.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 75/111 (68%), Gaps = 8/111 (7%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            + V I   + C+++       R++  + PTNWP++GMLPALL+NA RIHE++ EL+  S 
Sbjct  4    ITVLIFFVLFCYLF-------RNKNGI-PTNWPLLGMLPALLKNAYRIHEFLIELMERSN  55

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             TF  KGPWF+N ++L+T DP N++H+L + F+NY KGP+  +I   LG G
Sbjct  56   LTFHFKGPWFSNMNLLLTIDPTNIHHVLSKRFENYVKGPKLYEILEPLGDG  106


 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 66/131 (50%), Gaps = 1/131 (1%)
 Frame = +1

Query  304  QKLPELSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKME  483
            ++     +G    E +    DG++  DS LW  HR       NH  F  SL     +K++
Sbjct  85   KRFENYVKGPKLYEILEPLGDGILTTDSTLWLYHRNVAHSFFNHPKFHQSLVDVTWKKVK  144

Query  484  NGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDG  663
            NG+ PVLEH ++    +DLQ++F R S+D      +D D  SL VD + D P+L+A+ D 
Sbjct  145  NGLIPVLEHVSKHNIVIDLQDLFLRFSYDTMCTIMMDHDPTSLSVD-SPDFPLLKAVADM  203

Query  664  VNAILYREILP  696
             +    R  +P
Sbjct  204  AHGAFIRHAVP  214



>gb|KEH40821.1| cytochrome P450 family protein [Medicago truncatula]
Length=504

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 77/120 (64%), Gaps = 8/120 (7%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYV  193
            M +F+   + VAIL     +I +  IW  R  ++V   NWP++GMLP++L N  +IH++ 
Sbjct  1    MTLFQYITLFVAIL-----FIISYNIW--RRNKNVLVPNWPIIGMLPSVLHNQSKIHDFA  53

Query  194  TELLRESGGTFEIKGPWFAN-RDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            T +L+  GGTF  KGPWF N  + ++T DP NV+HI  +NF NY KG  F +IF +LG+G
Sbjct  54   TLVLKHHGGTFHFKGPWFTNIANFMITSDPMNVHHITSKNFSNYGKGSDFHEIFEILGVG  113


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 57/129 (44%), Gaps = 2/129 (2%)
 Frame = +1

Query  322  SQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPV  501
             +GS F E       G+ N+DS  W+  R     L+   +F   L + +  K+E  + P 
Sbjct  98   GKGSDFHEIFEILGVGIFNLDSNEWKQERALFHSLLKRKSFEILLHQCIRNKLEIFLLPF  157

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSL--CVDPTGDHPILEAIRDGVNAI  675
            L+H ++    +DLQ+I  R +FDI        D   L        D   ++AI    + I
Sbjct  158  LDHASKGVQILDLQDILERFTFDIICTSVFGFDPNCLPNNFSEISDISYVKAISVTEDVI  217

Query  676  LYREILPEC  702
            L R  +P+C
Sbjct  218  LSRHYIPKC  226



>ref|XP_009759082.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=507

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = +2

Query  44   VAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGT  223
            + I  +ILC+     +   +     +P NWP+ GMLP  L     IHE VT  +R SGGT
Sbjct  9    IEIFLAILCFFLFHGLKDTKG----YPRNWPIFGMLPGTLYYMQEIHERVTMTMRRSGGT  64

Query  224  FEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            F  KGP FA  DML T DPANV++I+  NF N+PKGP+FR+IF VLG G
Sbjct  65   FLFKGPIFAKLDMLATVDPANVHYIMSENFMNFPKGPKFREIFDVLGDG  113


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 65/126 (52%), Gaps = 1/126 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      DG+ N D +LW++ RKT   L+ H  F   L +   +K+E G+ PVL
Sbjct  99   KGPKFREIFDVLGDGIFNADLDLWKIQRKTARALITHQQFYKFLVKTSREKVEKGLIPVL  158

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
             H   +G  VDLQ++F R +FD +       D G + +D   D P  +A+ D    IL R
Sbjct  159  NHVCHKGVIVDLQDLFQRFTFDTTCILVTGYDPGCVSID-FPDVPFSKAMDDAEEVILVR  217

Query  685  EILPEC  702
             ++PE 
Sbjct  218  HVMPEA  223



>gb|KJB75061.1| hypothetical protein B456_012G021600 [Gossypium raimondii]
Length=511

 Score = 83.2 bits (204),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             P NWP VGM+P LL N  R H+ V ++LR S GTF  +G WF N   L T DP NV +I
Sbjct  31   LPRNWPFVGMIPTLLLNIHRPHDKVAQVLRRSNGTFFYRGLWFTNTSFLATSDPENVRYI  90

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  N   Y KGP + K F + G
Sbjct  91   LSSNSSVYLKGPEWLKQFDIFG  112


 Score = 56.6 bits (135),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            + + N D E W+ HR+     +NH  +R SL + + Q++E  +  VLE+ + +   V+LQ
Sbjct  113  EALFNSDGEAWKCHRRVFHAFLNHPQYRQSLSKVLHQRIEEALVKVLEYVSGREMVVNLQ  172

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++    +FDI     +  + G L ++   ++   +A+ D + A  YR ++P+
Sbjct  173  DLLVGHAFDIGCITGVGFNPGLLSIE-FPENRFQKAMSDTLEAAFYRYVVPD  223



>gb|KEH41380.1| cytochrome P450 family protein [Medicago truncatula]
Length=508

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = +2

Query  101  RSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLV-TGD  277
            RS+++V   NWP++GMLP++L N  +IH+Y T +L+  GGTF+ KGPWF N   ++ T D
Sbjct  21   RSKKNVTLPNWPIIGMLPSVLHNLSKIHDYATLVLKHHGGTFQFKGPWFTNLATVIFTSD  80

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            P NV+HI+ +NF NY KG  F +IF VLG+G
Sbjct  81   PMNVHHIISKNFSNYGKGSDFHEIFEVLGLG  111


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 65/129 (50%), Gaps = 2/129 (2%)
 Frame = +1

Query  322  SQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPV  501
             +GS F E       G+ N+DS  W+  R     L+ + N     ++N+ +K+EN + P 
Sbjct  96   GKGSDFHEIFEVLGLGIFNLDSNEWKQERALFHSLLKNKNIEIFYQQNIQKKLENCLLPF  155

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSL--CVDPTGDHPILEAIRDGVNAI  675
            L+H +++   +DLQ++  R +FDI+       D  SL    +   D   ++A+    + +
Sbjct  156  LDHASKEVKGLDLQDVIERFTFDITCIFLFGFDPNSLPYKYNELSDIAYVKAVSVLEDLL  215

Query  676  LYREILPEC  702
            LYR  +P+C
Sbjct  216  LYRHYMPKC  224



>gb|KJB75062.1| hypothetical protein B456_012G021600 [Gossypium raimondii]
Length=498

 Score = 83.2 bits (204),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             P NWP VGM+P LL N  R H+ V ++LR S GTF  +G WF N   L T DP NV +I
Sbjct  31   LPRNWPFVGMIPTLLLNIHRPHDKVAQVLRRSNGTFFYRGLWFTNTSFLATSDPENVRYI  90

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  N   Y KGP + K F + G
Sbjct  91   LSSNSSVYLKGPEWLKQFDIFG  112


 Score = 56.6 bits (135),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            + + N D E W+ HR+     +NH  +R SL + + Q++E  +  VLE+ + +   V+LQ
Sbjct  113  EALFNSDGEAWKCHRRVFHAFLNHPQYRQSLSKVLHQRIEEALVKVLEYVSGREMVVNLQ  172

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++    +FDI     +  + G L ++   ++   +A+ D + A  YR ++P+
Sbjct  173  DLLVGHAFDIGCITGVGFNPGLLSIE-FPENRFQKAMSDTLEAAFYRYVVPD  223



>gb|EPS73452.1| hypothetical protein M569_01304 [Genlisea aurea]
Length=134

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = +2

Query  53   LCSIL-CWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            LC +L C+ +A   ++   + +    +WPV+GMLP++L+N  RIH++ TE++ +SGGTF 
Sbjct  6    LCFLLPCFAFALACYRTWRKAA---ADWPVIGMLPSVLRNLHRIHDFATEIVVDSGGTFL  62

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +KGP  A  DML+T DPANV++IL +NF N+ KG  FR+IF V G G
Sbjct  63   LKGPRLAEMDMLLTSDPANVHYILTKNFGNFGKGSDFREIFDVWGDG  109



>gb|KFK32767.1| hypothetical protein AALP_AA6G286100 [Arabis alpina]
Length=515

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = +2

Query  41   VVAILCSILCW--IWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            ++ +  S LC+  ++A  +  K+   S FPTNWP +GMLP LL    R+++Y+TE+L  S
Sbjct  6    LLEVSVSFLCFSVLFAYFLISKKPHPS-FPTNWPFLGMLPGLLVEIHRVYDYMTEVLEAS  64

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
              T+  +GP F   DML+T DPAN++HI+  NF NYPKG  F+KIF VLG G
Sbjct  65   NLTYPFRGPCFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 67/128 (52%), Gaps = 7/128 (5%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F +      DG+ N DSELW+  RK+   +M+H  F+    R    K+E G+ P+L
Sbjct  102  KGSEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMSHPEFQRFTLRTSISKLEKGLIPLL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE---AIRDGVNAI  675
               A++   VDLQ++F R +FD +F      D G L +    + P +E   A+ +   AI
Sbjct  162  NLVAEKKLVVDLQDVFQRFTFDTTFVLATGFDPGCLSI----EMPEIEFSRALDEAEEAI  217

Query  676  LYREILPE  699
             +R + PE
Sbjct  218  FFRHVKPE  225



>ref|XP_011041669.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=507

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 75/117 (64%), Gaps = 9/117 (8%)
 Frame = +2

Query  20   IFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTE  199
            +F   +  + +LCS++  +          + +V P NWP+VGMLP+LL +  R H++VT+
Sbjct  6    LFAIFFAFICVLCSLIFCL---------RKNNVLPMNWPLVGMLPSLLVHVHRFHDHVTD  56

Query  200  LLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +L +S  TF+ KGPWF + D+LVT DPAN+++I+  NF N+ KG  F K F +LG G
Sbjct  57   VLEQSKCTFQFKGPWFGDMDILVTADPANIHYIMSSNFSNFEKGSDFNKRFDILGHG  113


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 67/125 (54%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F +       G++N D +LW+  RK    L+NH  F   L + +  K+E G+ PVL
Sbjct  99   KGSDFNKRFDILGHGILNADRDLWKNQRKVAQALVNHRLFYQRLVKTIQDKVERGLIPVL  158

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            EH  +Q   +DLQ++F R +FD +       D G L +D   +    +AI + + AI YR
Sbjct  159  EHVCKQSLVLDLQDVFQRFAFDATSMIVTSFDPGCLSID-LPEVAFSKAIDNAMEAIFYR  217

Query  685  EILPE  699
             +LPE
Sbjct  218  HVLPE  222



>ref|XP_002468540.1| hypothetical protein SORBIDRAFT_01g047610 [Sorghum bicolor]
 gb|EER95538.1| hypothetical protein SORBIDRAFT_01g047610 [Sorghum bicolor]
Length=506

 Score = 80.1 bits (196),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 61/109 (56%), Gaps = 6/109 (6%)
 Frame = +2

Query  53   LCSILCWI--WARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTF  226
            L SILC++  + R +  K++   V P  WPV+G+LP L  N    H++VT LL  +G TF
Sbjct  10   LFSILCFLILYYRHLQSKKTSHFV-PIKWPVMGVLPGLAANIHHFHDWVTALLAGAGYTF  68

Query  227  EIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF-HVLGMG  370
             + G     +    T DPANV HI   NF NYPKG  F +IF   LG G
Sbjct  69   RVNG--LPGQRYFATCDPANVRHIFTSNFANYPKGHEFVEIFDDFLGGG  115


 Score = 59.7 bits (143),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 48/116 (41%), Gaps = 5/116 (4%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQE  546
            G+ N D E W   R     LM    FR         K E  + P L   A +G   DLQ+
Sbjct  115  GLFNADGESWRRQRVKAQMLMTAPRFRAFTASCSRDKAEKSLLPFLALAADEGRPCDLQD  174

Query  547  IFHRISFDISFQQFLDKDLGSLCVDPTG---DHPILEAIRDGVNAILYREILPECC  705
            +F R+SFD++       D    C+  TG   + P L A    +  I  R I+P  C
Sbjct  175  VFLRLSFDLTCTLIFGID--PACLQVTGLPPEVPFLRAADVALETIFLRHIIPMAC  228



>ref|XP_009601590.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I  +I C+     ++     RS  P NWP +GM P LL +  RIHE   E+   +GGTF 
Sbjct  15   IFVAIFCFF----VFCALGDRSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSTTGGTFL  70

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +KGPWFAN D+L T DPANV++I+  NF+N+PKG  F+KIF VLG G
Sbjct  71   LKGPWFANIDILGTVDPANVHYIMSANFENFPKGEEFKKIFDVLGDG  117


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N D +LW+  RK T  L+ H  F   LE+    K+ENG+ PVL
Sbjct  103  KGEEFKKIFDVLGDGIFNSDLDLWKSQRKITRTLITHQRFHNCLEKTSWDKIENGLIPVL  162

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            E  A++   VDLQ++F R +FD + Q     D G L ++   + P  +A+ +    +  R
Sbjct  163  EFVARESKIVDLQDVFQRFTFDTTCQLVTGFDPGCLSLE-FPNVPFSKAMDEAEEVLFIR  221

Query  685  EILPE  699
             +LPE
Sbjct  222  HLLPE  226



>ref|XP_003564427.1| PREDICTED: cytochrome P450 86B1-like [Brachypodium distachyon]
Length=511

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 71/111 (64%), Gaps = 3/111 (3%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            V +AI+C   C    R I  ++ + S  P NWPVVGMLP L++N   IH+ V ++LRE+G
Sbjct  14   VFLAIIC-FFCLSLFRLI--RQCQESAIPVNWPVVGMLPFLVRNLYNIHDKVADMLREAG  70

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             TF I GPWF N + L T DPA VNH    NF+NYPKG  F ++F +LG G
Sbjct  71   CTFMIIGPWFLNMNFLSTCDPATVNHCFNTNFKNYPKGSEFAEMFDILGDG  121


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 63/125 (50%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E      DG++  DSE WE  R+    +     FR+     +++K    + P L
Sbjct  107  KGSEFAEMFDILGDGLLVADSESWEYQRRVAMLVFASRAFRSFSMSTITRKAGTVLLPYL  166

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPIL-EAIRDGVNAILY  681
            +H A+ G+ V+L+ +F R S D+S+      DL   C+  +   P+  +A ++    +L+
Sbjct  167  DHMAKHGSEVELEGVFMRFSLDVSYSTVFATDLD--CLSVSRPIPVFGQATKEVEEGMLF  224

Query  682  REILP  696
            R ++P
Sbjct  225  RHVVP  229



>gb|EMT14219.1| Cytochrome P450 86A2 [Aegilops tauschii]
Length=512

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 3/111 (3%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            V +AI C   C    R +  +   +S  P NWPV+GMLP L++N  +IH+ VT++LRE+G
Sbjct  14   VFLAIAC-FFCLSLFRLV--RHCHKSDLPVNWPVIGMLPFLVRNLYQIHDSVTDMLREAG  70

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             TF I GPWF N   L T DPA VNH    NF NYPKG  F ++F +LG G
Sbjct  71   CTFRIIGPWFLNMSFLATCDPATVNHCFNTNFNNYPKGSEFAEMFDILGDG  121


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 63/127 (50%), Gaps = 7/127 (6%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E      DG++  DSE WE  R+    +     FR+     +++K    + P L
Sbjct  107  KGSEFAEMFDILGDGLLVADSESWEYQRRVAMQVFASRAFRSFSMSTITRKAGTVLLPFL  166

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPIL---EAIRDGVNAI  675
            +H A+ G+ V+L+ +F R S D+S+      DL  L V     HPI    +A ++    +
Sbjct  167  DHMAKHGSQVELEGVFMRFSLDVSYSTVFATDLDCLSV----SHPIPAFGQATKEVEEGM  222

Query  676  LYREILP  696
            L+R ++P
Sbjct  223  LFRHVVP  229



>gb|EYU31098.1| hypothetical protein MIMGU_mgv1a004607mg [Erythranthe guttata]
Length=518

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 75/104 (72%), Gaps = 2/104 (2%)
 Frame = +2

Query  62   ILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG-GTFEIKG  238
            IL  +W   +W  R+++ +   NWP++GMLPALL + GRIH+  TE+LR +  GTF  KG
Sbjct  6    ILAAVWFFALWLWRNKKRI-AWNWPLIGMLPALLHHVGRIHDGCTEILRRTRRGTFHFKG  64

Query  239  PWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            PWF+  ++L T +PANV++I+  NF N+PKGP+FR+IF VLG G
Sbjct  65   PWFSGMEILGTVNPANVHYIMSANFHNFPKGPKFREIFDVLGDG  108


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      DG+ N D++ W   R+     ++H  F   L +    K+  G+ PVL
Sbjct  94   KGPKFREIFDVLGDGIFNSDADSWRHQRRAARGFLSHRRFHRFLVKISRDKVAYGLVPVL  153

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            E  +++   +DLQ+IF R++FD +       D G L VD   + P  +A+ D   AI  R
Sbjct  154  EMASKENWVLDLQDIFQRLTFDTTCALVTGFDPGCLSVD-LPEVPFSKAMDDVEEAIFLR  212

Query  685  EILPE  699
             +LPE
Sbjct  213  HVLPE  217



>ref|XP_002866853.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43112.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I  +  C++  R     +    + PTNWP +GM+P LL    R+++++TE+L  +  T+ 
Sbjct  9    ISIAFFCFLLFRYFLINKKPHRLCPTNWPFLGMIPGLLVEIHRVYDFITEILEVTNLTYP  68

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
              GP FAN DMLVT DPAN++HI+  NF NYPKGP F+K+F +LG G
Sbjct  69   CIGPCFANLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDILGDG  115


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 65/125 (52%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N DSELW+  RK+   +M +  F+       S K+E G+ P+L
Sbjct  101  KGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSSNKLEKGLVPLL  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H A++   VDLQ++F R +FD +F      D G L V+   +     A+ D   AI +R
Sbjct  161  DHVAKEKLVVDLQDMFQRFTFDTTFVLATGYDPGCLSVE-MPEVEFARALDDAEEAIFFR  219

Query  685  EILPE  699
             I PE
Sbjct  220  HIKPE  224



>ref|NP_179899.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAK43908.1|AF370589_1 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAB87111.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAC42368.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07426.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = +2

Query  44   VAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGT  223
            V+I      +++   +  K+  RS F TNWP +GMLP LL    R++++VTELL  S  T
Sbjct  9    VSISLLFFSFLYGYFLISKKPHRS-FLTNWPFLGMLPGLLVEIPRVYDFVTELLEASNLT  67

Query  224  FEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +  KGP F   DML+T DPAN++HI+  NF NYPKG  F+KIF VLG G
Sbjct  68   YPFKGPCFGGLDMLITVDPANIHHIMSSNFANYPKGTEFKKIFDVLGDG  116


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 70/128 (55%), Gaps = 7/128 (5%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G+ F +      DG+ N DSELW+  RK+   +M H +F+    R +  K+E G+ P+L
Sbjct  102  KGTEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMTHQDFQRFTLRTIMSKLEKGLVPLL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE---AIRDGVNAI  675
            ++ A++   VDLQ++F R +FD SF      D G L    + + P +E   A+ +   AI
Sbjct  162  DYVAEKKQVVDLQDVFQRFTFDTSFVLATGVDPGCL----STEMPQIEFARALDEAEEAI  217

Query  676  LYREILPE  699
             +R + PE
Sbjct  218  FFRHVKPE  225



>gb|AJD25224.1| cytochrome P450 CYP96A84 [Salvia miltiorrhiza]
Length=485

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 78/118 (66%), Gaps = 15/118 (13%)
 Frame = +2

Query  20   IFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTE  199
            ++ E ++++  LC          +W  R  RS+   NWP+VGMLP+LL N GRIHE  T+
Sbjct  6    MYLEIFLIIVSLC----------LW--RIHRSIL--NWPLVGMLPSLLLNVGRIHEICTQ  51

Query  200  LLRESG-GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +L+    GTF  +GPWFAN D+L+T  PANV++I+  NF N+PKG RFR++F VLG G
Sbjct  52   VLQNCRRGTFHFRGPWFANMDILLTAHPANVHYIMTSNFHNFPKGARFREMFDVLGDG  109



>ref|XP_010683407.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=501

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  122  PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHIL  301
            PTNWP+VGML  LL N  RIH+++TE+L +S   F  KGPWFAN +M VT DPANV++I+
Sbjct  28   PTNWPIVGMLLPLLANVPRIHDWITEVLEKSQLNFLFKGPWFANMEMFVTLDPANVHYIM  87

Query  302  CRNFQNYPKGPRFRKIFHVLGMG  370
             +NF+NYPKG +F ++F V G G
Sbjct  88   SKNFKNYPKGSKFNEMFDVFGDG  110


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 67/124 (54%), Gaps = 1/124 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E      DG+ NVDS+LWE HRK     + H  F   L   V +K+E G+ PVL
Sbjct  96   KGSKFNEMFDVFGDGIFNVDSKLWEYHRKMAHTFIGHPKFHQFLHEKVWEKVEKGLIPVL  155

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +  ++QG  VDLQ++F R +FD      +  DL  L VD   + P L+A+ D    I  R
Sbjct  156  DDASKQGLVVDLQDLFSRFTFDTICTLIVGSDLRCLSVD-WPNEPFLKALDDIEEVIFRR  214

Query  685  EILP  696
             ++P
Sbjct  215  HVVP  218



>gb|EMS62655.1| Cytochrome P450 86B1 [Triticum urartu]
Length=546

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 3/111 (3%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            V +AI C   C    R +  +   +S  P NWPV+GMLP L++N  +IH+ VT++LRE+G
Sbjct  14   VFLAIAC-FFCLSLFRLV--RHCHKSDLPVNWPVIGMLPFLVRNLYQIHDSVTDMLREAG  70

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             TF I GPWF N   L T DPA VNH    NF NYPKG  F ++F +LG G
Sbjct  71   CTFRIIGPWFLNMSFLATCDPATVNHCFNTNFNNYPKGSEFAEMFDILGDG  121


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 62/127 (49%), Gaps = 7/127 (6%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E      DG++  DS  WE  R+    +     FR+     +++K    + P L
Sbjct  107  KGSEFAEMFDILGDGLLVADSASWEYQRRVAMQVFASRAFRSFSMSTITRKAGTVLLPFL  166

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPIL---EAIRDGVNAI  675
            +H A+ G+ V+L+ +F R S D+S+      DL  L V     HPI    +A ++    +
Sbjct  167  DHMAKHGSQVELEGVFMRFSLDVSYSTVFATDLDCLSV----SHPIPAFGQATKEVEEGM  222

Query  676  LYREILP  696
            L+R ++P
Sbjct  223  LFRHVVP  229



>gb|AHF22091.1| CYP96A69 [Maesa lanceolata]
Length=570

 Score = 87.4 bits (215),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +2

Query  122  PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHIL  301
            P NWP+VGM P +  N   IHE +TE+L  +GGT   KG WF N D L T    N++HIL
Sbjct  30   PINWPLVGMTPTISLNFRHIHEVLTEILERNGGTIFFKGAWFTNSDKLFTTHVENIHHIL  89

Query  302  CRNFQNYPKGPRFRKIFHVLG  364
             +NF NY KG   ++IF V G
Sbjct  90   TKNFSNYEKGEEAKEIFDVHG  110


 Score = 51.6 bits (122),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 52/111 (47%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            D + N D E W+  RK      N      +  + V   +E G+ PVL H ++ G  VDLQ
Sbjct  111  DLLFNADHEKWKRDRKMIQAFFNDRRCIQATMKLVRDSLEKGVIPVLNHVSEHGHVVDLQ  170

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++F R+  D +       + GSL +    + P+  A+    + +LYR  +P
Sbjct  171  DLFIRVMLDSTCTVITGYNPGSLQIS-FPEMPMATAMDVTNDTVLYRHFVP  220



>ref|XP_010027332.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62196.1| hypothetical protein EUGRSUZ_H04854 [Eucalyptus grandis]
Length=272

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 70/109 (64%), Gaps = 3/109 (3%)
 Frame = +2

Query  44   VAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGT  223
            + I  + +C+   R + K       FP NWP+VGMLPALL N    H++ T ++  S G 
Sbjct  7    LEIFLAGICFAVLRLLSKSNDG---FPRNWPLVGMLPALLLNPSHFHDWATGVVERSHGN  63

Query  224  FEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            F ++ PWF+  DMLVT DPANV++I+  NF N+PKGP F+++F +LG G
Sbjct  64   FFVRFPWFSGMDMLVTADPANVHYIMSANFGNFPKGPEFKRVFDILGDG  112


 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 61/126 (48%), Gaps = 1/126 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F        DG+ N DS LW + R+     M    F   L      K ENG+  VL
Sbjct  98   KGPEFKRVFDILGDGIFNSDSNLWSMQRRVAQVFMKDQRFHRFLSSTTRDKAENGLLRVL  157

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +  +Q+G  VDLQ++FHR +FD + +     D GSL V+   +  I +A+ D    I YR
Sbjct  158  DELSQRGVTVDLQDLFHRFTFDSACRFVTGFDPGSLSVE-FPEVRISKALGDAEEVIFYR  216

Query  685  EILPEC  702
             + PE 
Sbjct  217  HLYPEW  222



>gb|EYU24049.1| hypothetical protein MIMGU_mgv1a004847mg [Erythranthe guttata]
Length=507

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +2

Query  101  RSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG-GTFEIKGPWFANRDMLVTGD  277
            R+R S    NWP++GMLP LL N GRIHE  TE+LR+S  GTF  +GP FAN DML T D
Sbjct  24   RNRGSGLIWNWPLIGMLPGLLLNVGRIHEICTEVLRKSRRGTFHFQGPCFANMDMLWTVD  83

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            P N+++I+  NF+N+PKGP FR+IF VLG G
Sbjct  84   PENIHYIMTSNFRNFPKGPEFREIFDVLGDG  114


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      DG+ N D + W+  R  +  L+ H +F   L     +K+E G+ PVL
Sbjct  100  KGPEFREIFDVLGDGIFNSDDDSWKDQRNVSRALITHRSFHRFLAVISREKVEKGLIPVL  159

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            E  A +   +DLQ++F R +FD   Q     + G L +D   D P  +A+ D   +I  R
Sbjct  160  EKAALENRVLDLQDLFQRFTFDSICQLVTGYNPGCLSLDLADDVPFSKAMDDVEESIFVR  219

Query  685  EILPE  699
             +LPE
Sbjct  220  HVLPE  224



>dbj|BAJ87689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=547

 Score = 90.9 bits (224),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 68/112 (61%), Gaps = 5/112 (4%)
 Frame = +2

Query  41   VVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNA-GRIHEYVTELLRESG  217
             V +L ++  ++    I   R RRS+    WPVVGMLP+LL    G ++E++T +L+  G
Sbjct  37   TVEVLVAVFIFV---AIHSLRQRRSLGLPLWPVVGMLPSLLLGVRGNMYEWITGVLKTRG  93

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRK-IFHVLGMG  370
            GTF  +GPWF N   +VT DP N+ H+L   F N+PKGP FR  +  +LG G
Sbjct  94   GTFTFRGPWFTNLHCVVTADPRNLEHLLKTKFGNFPKGPYFRDTVRDLLGDG  145


 Score = 47.8 bits (112),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 45/114 (39%), Gaps = 1/114 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+   D E+W   RK  +   +   FR     ++ + +   + PVL      G  VDLQ
Sbjct  144  DGIFGADDEVWRQQRKAASLEFHSAEFRALTASSLVELVHRRLLPVLAETEADGAAVDLQ  203

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPECC  705
            ++  R++FD         D G L      + P   A  D   A + R + P   
Sbjct  204  DVLLRLTFDNVCMIAFGADPGCLQ-KGLPEIPFARAFEDATEATIVRFVTPTAV  256



>ref|XP_006346789.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=505

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +2

Query  107  RRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPAN  286
            R S +P N+P+ GMLP LL N  +IHE  T  +R SGGTF  KG WFAN D L T DPAN
Sbjct  25   RHSNYPINFPIFGMLPGLLYNIQQIHERCTMSMRASGGTFLFKGLWFANMDTLTTVDPAN  84

Query  287  VNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            V++I+  NF N+PKGP+F+++F VLG G
Sbjct  85   VHYIMSANFMNFPKGPKFKEMFDVLGNG  112


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+ N D ++W++ RK T  L+ H  F   L +    K+E G+ PV+
Sbjct  98   KGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRALITHHEFYKFLVKTSRDKVEKGLIPVI  157

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H   +G  VDLQ++F R +FD +       D G + +D   D P  +A+ D   AIL+R
Sbjct  158  DHVCNKGCVVDLQDLFQRFTFDTTCILVTGYDPGCVSID-FPDVPFSKAMDDVEEAILFR  216

Query  685  EILPE  699
              LPE
Sbjct  217  HALPE  221



>ref|XP_006351417.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=508

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (65%), Gaps = 2/113 (2%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
             Y ++ +L  I C+ ++      R  ++  PTNWP++  LPA++ N  R H Y+TE+L E
Sbjct  5    EYSILFLL--IFCFTYSIWFIIYRRTKTSAPTNWPILRELPAVIGNIHRGHAYMTEVLIE  62

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             G T++ KGP F N DML T DP ++++I  +NF NYPKGP FRKIF +LG G
Sbjct  63   YGSTYKFKGPIFTNMDMLFTCDPGDIHYIFSKNFSNYPKGPEFRKIFDILGNG  115


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 76/126 (60%), Gaps = 1/126 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+ NVD ELWELHRKTT  +M+H  F+  LE+ +   +E G+ P+L
Sbjct  101  KGPEFRKIFDILGNGIFNVDHELWELHRKTTMSIMSHAKFQILLEKTLWDIIEKGLRPIL  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +A+QG  +DLQ++  R +FD   +  LD D  SL +D     P  +A  D ++A+L+R
Sbjct  161  DAFAKQGKTLDLQDVLQRFTFDSITRLLLDHDPRSLSMD-LPYLPYEKAFGDALDALLHR  219

Query  685  EILPEC  702
             I P+C
Sbjct  220  HITPKC  225



>gb|EYU27553.1| hypothetical protein MIMGU_mgv1a006542mg [Erythranthe guttata]
Length=440

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 75/125 (60%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N D ELWELHR+TT   +NH  F   LER++ +K+E G+ PVL
Sbjct  89   KGPEFKKMFEILGDGIFNADFELWELHRRTTLSFLNHTKFYDLLERSIWEKVETGLLPVL  148

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            + +++QG   DLQ+IF R +FD      LD D  SLCVD     P  +A  D + A+LYR
Sbjct  149  DDFSEQGIDFDLQDIFQRFTFDSICNLVLDYDPCSLCVD-MPLIPCEKAFNDAIEALLYR  207

Query  685  EILPE  699
             +LPE
Sbjct  208  HVLPE  212


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 60/99 (61%), Gaps = 17/99 (17%)
 Frame = +2

Query  74   IWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFAN  253
            +W  +I KK S     PTNWP+VGMLPA+L N  RIH Y TE+L ESGGTF  +G  F +
Sbjct  22   VWRTKIRKKTS----LPTNWPLVGMLPAILLNCHRIHAYFTEILIESGGTFIPRG--FQH  75

Query  254  RDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
                       V +   RNF NYPKGP F+K+F +LG G
Sbjct  76   ---------GYVGYF--RNFSNYPKGPEFKKMFEILGDG  103



>emb|CDY61808.1| BnaC03g76440D [Brassica napus]
Length=403

 Score = 89.4 bits (220),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 71/117 (61%), Gaps = 11/117 (9%)
 Frame = +2

Query  11   TMRIFKESYVVVAILCSILCWIWARQ----IWKKRSRRSVFPTNWPVVGMLPALLQNAGR  178
            ++ +F+ S  +   L  I C+   ++    +  KRS     P NWPV+GMLPAL+  + R
Sbjct  3    SINLFEASLSLFCFLI-IFCYFLNKKHFGYLVNKRS-----PRNWPVLGMLPALVLWSRR  56

Query  179  IHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKI  349
            I + +  +L +S  TF  KGPWFA  D L+T DPAN++HIL  NF NY KGP F++I
Sbjct  57   I-DVLIRVLEKSNLTFLFKGPWFARMDALITVDPANIHHILSSNFSNYIKGPEFKEI  112


 Score = 48.5 bits (114),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +1

Query  469  SQKMENGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE  648
            + K+++ + P+   ++++GT VDLQ++F R  FDIS       D  SL ++   +  + E
Sbjct  129  TSKIKDVLLPIFSRFSEEGTVVDLQDVFRRFMFDISLLLVSGSDPQSLSIE-MPEVELAE  187

Query  649  AIRDGVNAILYREILP  696
            A  D   AI+ R I+P
Sbjct  188  AFEDAGEAIVSRLIIP  203



>ref|XP_010419318.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=363

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            +  +IL +I+   +  K+  + + P NWPV+GMLP +L    RI++YV E+L  S  TF 
Sbjct  9    VFITILVFIFFHFLIHKKPNQ-ISPRNWPVLGMLPGILITLHRINDYVAEVLEVSNLTFV  67

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             KGPWF+  +ML+T DPAN+ H+   NF NY KGP F+++F  LG G
Sbjct  68   FKGPWFSGMNMLITADPANIQHVFSSNFSNYSKGPEFKEMFDFLGNG  114


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 71/126 (56%), Gaps = 3/126 (2%)
 Frame = +1

Query  322  SQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPV  501
            S+G  F E      +G+   DS+LWE  RK+   L++H  F++   R +++K++NG  PV
Sbjct  99   SKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVLLSHQGFQSFSLRTITRKIKNGAVPV  158

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAIL  678
            L+H+A++    DLQ+ F R+SFD++       D  SL ++ P  ++   +A+ D    ++
Sbjct  159  LDHFAEENMIFDLQDFFQRLSFDVTLTLVTGYDSNSLSIEMPMNEYA--KAMDDAEEVVV  216

Query  679  YREILP  696
             R + P
Sbjct  217  DRHVKP  222



>ref|XP_009101870.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=515

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I  + LC+   R     +    + PTNWP +G++P LL    R+++++TE+L  +  T+ 
Sbjct  9    ISIAFLCFFLFRHFLINKKHHRLCPTNWPFLGVIPGLLVEIHRVYDFITEILEVTNLTYF  68

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             KGP +A  DMLVT DP+N++HI+  NF NYPKGP F+K+F VLG G
Sbjct  69   CKGPCYAGLDMLVTVDPSNIHHIMSSNFSNYPKGPEFKKLFDVLGDG  115


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 3/126 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNF-RTSLERNVSQKMENGMFPV  501
            +G  F +      DG+ N DSELW+  RK+   +M H  F + SL  ++S K+E G+ P+
Sbjct  101  KGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMHPEFQKFSLATSMS-KLEKGLVPL  159

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILY  681
            L+H A +   V+L ++F R +FD +       D G L V+   +     A+ D   AI +
Sbjct  160  LDHAANEKLVVNLGDVFQRFTFDTTCVLATGYDPGCLSVE-MPEIEFARALDDAEEAIFF  218

Query  682  REILPE  699
            R + PE
Sbjct  219  RHVKPE  224



>gb|KCW62190.1| hypothetical protein EUGRSUZ_H04847 [Eucalyptus grandis]
Length=502

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 70/109 (64%), Gaps = 3/109 (3%)
 Frame = +2

Query  44   VAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGT  223
            + I  + +C+ + R + K        P NWP+VGMLPAL  N GR+H++VT  L  S G 
Sbjct  7    LEIFLAAICFAFLRLLGKSHDG---LPKNWPLVGMLPALFLNLGRVHDWVTGFLERSHGN  63

Query  224  FEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            F  +  WF+  DMLVT DPANV++I+  NF+N+PKG  F+++F VLG G
Sbjct  64   FLFRFHWFSGMDMLVTADPANVHYIMSTNFENFPKGAEFKRVFDVLGDG  112


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 62/131 (47%), Gaps = 18/131 (14%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G+ F        DG++N DS++W + R+     MN   F   L +    K+ENG+  VL
Sbjct  98   KGAEFKRVFDVLGDGILNSDSDMWRMQRRVAQVFMNDRRFCRFLAKTTRDKVENGLLRVL  157

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTG------DHPILEAIRDGV  666
            +  +Q+G  VDLQ++F R +FD +            C   TG      + P  +A+ D  
Sbjct  158  DELSQKGVAVDLQDLFQRFTFDAA------------CRFVTGLSVEFPEVPFSKALDDAE  205

Query  667  NAILYREILPE  699
              I YR + PE
Sbjct  206  EVIFYRHMYPE  216



>ref|XP_009795090.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=513

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +2

Query  92   WKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVT  271
            W   + ++  P N+P +GM P LL N  RIHE +TE+L ++GGTF +KGPWF N DML T
Sbjct  26   WAIGNTKNDLPRNYPFLGMFPTLLLNIHRIHEKITEVLSKTGGTFLLKGPWFTNMDMLGT  85

Query  272  GDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             DP NV++I+  N  N+PKGP F+KIF   G G
Sbjct  86   VDPVNVHYIMSTNSSNFPKGPEFKKIFDAFGDG  118


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N D +LW+   K    L+ +  +   L + ++ K+++G+ P+L
Sbjct  104  KGPEFKKIFDAFGDGIFNSDFDLWKKQSKYAKELVINQKYHKCLIKTINDKVKDGLIPIL  163

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +  A++    DLQ+IF R++FD   +     D G L ++ P    P ++A+ D    I+ 
Sbjct  164  DFMAKEDKIFDLQDIFKRLTFDTICKVVTGFDPGCLSLEFPCV--PFVKAMEDIDYVIVI  221

Query  682  REILPE  699
            R +LPE
Sbjct  222  RHLLPE  227



>ref|XP_011100902.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 72/119 (61%), Gaps = 8/119 (7%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYV  193
            M  F    ++ A+LC  L W +        S  +  P NWP+VGMLP++  +  +IH+  
Sbjct  3    MASFGYPEILFALLCCFLVWCF--------SNINGMPWNWPLVGMLPSVFWHVNQIHDRC  54

Query  194  TELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
              +  + GGTF +KGPWFAN D++ T DPANV+ I+  NF N+PKG  F+KIF VLG G
Sbjct  55   VNIFEQVGGTFLLKGPWFANMDIIATADPANVHFIMSANFANFPKGAEFKKIFDVLGDG  113


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 69/125 (55%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G+ F +      DG+ N D++LW   RK    L+ H+ FR  L +   +K+E G+ PVL
Sbjct  99   KGAEFKKIFDVLGDGIFNSDADLWRSQRKQARALITHERFRKFLIKTSWEKVEKGLIPVL  158

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            EH ++QG  +DLQ++F R++FD +       D G L  +   D P  +A+ +   AIL R
Sbjct  159  EHVSEQGMVIDLQDLFQRLTFDTTCILVTGFDPGCLSTE-FPDVPFSKAMDEAEEAILMR  217

Query  685  EILPE  699
              LPE
Sbjct  218  HCLPE  222



>gb|KJB47427.1| hypothetical protein B456_008G025900 [Gossypium raimondii]
Length=495

 Score = 80.9 bits (198),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             P NWP+VGM+P LL N  R H+ V + LR S GTF   G WF N   L T DP NV  I
Sbjct  31   LPRNWPLVGMIPTLLLNIHRPHDKVAQTLRRSSGTFFYTGLWFTNTSYLATSDPENVRSI  90

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  N   Y KGP + K F + G
Sbjct  91   LSSNSSVYLKGPEWLKQFDIFG  112


 Score = 56.6 bits (135),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 56/107 (52%), Gaps = 1/107 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            + + N D E W+ HR+     +NH  FR SL + + Q++E  +  VLE+ + +   V+LQ
Sbjct  113  EALFNSDGEAWKCHRRAFHAFLNHPQFRQSLSKVLHQRIEEALVKVLEYVSGREMVVNLQ  172

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            ++  R +FDI     +  + G L ++   ++   EA+ +   A  YR
Sbjct  173  DLLVRHAFDIGCIMGVGFNPGLLSIE-FPENRFHEAVSNTFEAAFYR  218



>gb|KFK33664.1| hypothetical protein AALP_AA5G043500 [Arabis alpina]
Length=511

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 65/94 (69%), Gaps = 2/94 (2%)
 Frame = +2

Query  89   IWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLV  268
            I KKR R   FPTNWP +GMLP LL    R++++VTE L ++   F  KGP++   DMLV
Sbjct  21   ISKKRHRS--FPTNWPFLGMLPGLLVEIPRVYDFVTEFLEDANLNFLFKGPFWGGLDMLV  78

Query  269  TGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            T DPAN++HI+  NF NYPKG  F+K+F +LG G
Sbjct  79   TVDPANIHHIMSSNFANYPKGTEFKKLFDILGDG  112


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 69/126 (55%), Gaps = 3/126 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNF-RTSLERNVSQKMENGMFPV  501
            +G+ F +      DG+ N DSELW   RK+   +M +  F + SL  ++S K+E G+ P+
Sbjct  98   KGTEFKKLFDILGDGIFNADSELWNDLRKSAQSMMMNPKFQKFSLATSLS-KLEKGLLPL  156

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILY  681
            L+H A++   VDL+++F R +FD +       D G L V+   +     A+ D   AI +
Sbjct  157  LDHVAKEKLVVDLEDVFQRFTFDTTCVLATGYDPGCLSVE-MPEIEFARALDDAEEAIFF  215

Query  682  REILPE  699
            R ++PE
Sbjct  216  RHVMPE  221



>gb|EYU23445.1| hypothetical protein MIMGU_mgv1a026937mg [Erythranthe guttata]
Length=523

 Score = 80.1 bits (196),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +2

Query  62   ILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE---  229
            I  ++ A  +W +   RS+  P  WPV+G LP L++N GR+H+++ + LR  GGT++   
Sbjct  9    ISAFVAAYFLWFRSITRSLNGPRLWPVLGSLPGLIENNGRMHDWIADNLRACGGTYQTCI  68

Query  230  IKGPWFANRD--MLVTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
            +  P+ A +   + VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  69   LAVPFLARKQGHVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGQG  118


 Score = 57.0 bits (136),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 49/111 (44%), Gaps = 1/111 (1%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQE  546
            G+ N D + W   RKT          R ++ R VS+ +E    P+L     QG  VDLQ+
Sbjct  118  GIFNSDGDTWLFQRKTAALEFTTRTLRQAMSRWVSRAIETRFVPILNTAQLQGKPVDLQD  177

Query  547  IFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            +  R++FD        KD  +L VD   D+    A      A L R I PE
Sbjct  178  LLLRLTFDNICGLAFGKDPQTLAVD-MPDNSFAAAFDRATEATLQRFIFPE  227



>emb|CBI21517.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 72/104 (69%), Gaps = 6/104 (6%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            IL +++C++    +  + S  ++ P NWP+VGMLP + +N  +I +  TE+L +S GTF 
Sbjct  9    ILLAVICFL----LLHRLSNSNMLPWNWPLVGMLPWIFRNIQQIQDRCTEVLEQSSGTFL  64

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVL  361
            +KGPWFAN DML+T DPANV++I+  NF N+PKGP   K+  VL
Sbjct  65   LKGPWFANMDMLITSDPANVHYIMSTNFSNFPKGP--EKLAQVL  106



>emb|CDY27160.1| BnaA08g07980D [Brassica napus]
Length=513

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 70/113 (62%), Gaps = 5/113 (4%)
 Frame = +2

Query  41   VVAILCSILCWIWARQ---IWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            ++ I  S LC+ +      I KK  R   FPTNWP +GMLP LL    R+++Y+TE L  
Sbjct  6    LLEITVSFLCFSFFFGYFFIMKKPHRS--FPTNWPFLGMLPGLLVEIPRVYDYITEFLEA  63

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            S  TF  KGP F   +ML T DPAN++HI+  NF NYPKG  F+KIF VLG G
Sbjct  64   SNLTFLFKGPCFVGVNMLFTVDPANIHHIMSSNFTNYPKGSEFKKIFDVLGDG  116


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F +      DG+ N D +LW   RK+   +M+   F+    R   +K+E G+ P+L
Sbjct  102  KGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQSMMSRPEFQRFTLRTNMRKLEKGLVPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H+A++   +DLQ++F R +FD +F      D G L ++   +     A+ + +  I +R
Sbjct  162  DHFAEKKLVLDLQDVFQRFTFDTTFVLATGIDPGCLSIE-MPEIEFARALDEAMEVIFFR  220

Query  685  EILPE  699
             I PE
Sbjct  221  HIKPE  225



>ref|XP_006294050.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
 gb|EOA26948.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
Length=508

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 73/114 (64%), Gaps = 2/114 (2%)
 Frame = +2

Query  32   SYVVVAILC-SILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLR  208
            +YV +  LC + L +I+   +  K+  R + P NWPV+GMLP +L    RI++YV E+L 
Sbjct  2    AYVGLLELCIAFLVFIFFHFLIHKKPHR-ILPRNWPVLGMLPGVLIMLHRINDYVAEVLE  60

Query  209  ESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             S  TF  KGPWF+  +ML+T DPAN+ H+   NF NY KGP F+++F  LG G
Sbjct  61   VSSLTFVFKGPWFSGMNMLITADPANIQHVFSSNFSNYDKGPEFKEMFDFLGNG  114


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 73/125 (58%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+   DS+LWE  RK++  +++H  F++   R +++K++ G+ PVL
Sbjct  100  KGPEFKEMFDFLGNGIFTADSKLWEDMRKSSLVVLSHQGFQSFSLRTITRKIKYGVVPVL  159

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +H+A++    DLQ++F R++FD++       +  SL ++ P  ++   +A+ D    ++Y
Sbjct  160  DHFAEENKIFDLQDVFQRLAFDVTLTLVTGSESNSLSIEMPNNEYA--KAMDDAEEVVVY  217

Query  682  REILP  696
            R + P
Sbjct  218  RHVKP  222



>ref|XP_004237151.1| PREDICTED: cytochrome P450 86B1 [Solanum lycopersicum]
Length=506

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +2

Query  107  RRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPAN  286
            R S +P N+P+ GMLP LL N  +IHE  T  ++ SGGTF  KG WFAN D L T DPAN
Sbjct  25   RHSNYPINFPIFGMLPGLLYNIQQIHERCTMSMKASGGTFLFKGLWFANMDTLTTVDPAN  84

Query  287  VNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            V++I+  NF N+PKGP+F+++F VLG G
Sbjct  85   VHYIMSANFMNFPKGPKFKEMFDVLGNG  112


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+ N D ++W++ RK T  L+ H  F   L +    K+E G+ PV+
Sbjct  98   KGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRSLITHHEFYKFLVKTSCDKVEKGLIPVI  157

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H   +G  VDLQ++F R +FD +       D G + +D   D P  +A+ D   AIL+R
Sbjct  158  DHVCNKGCVVDLQDLFQRFTFDTTCILVTGYDPGCVSID-FPDVPFSKAMDDAEEAILFR  216

Query  685  EILPE  699
              LPE
Sbjct  217  HALPE  221



>ref|XP_010275494.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=524

 Score = 70.1 bits (170),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = +2

Query  35   YVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            Y ++AIL       W   ++ K+  ++     WP +G LP +  N  R+H+++TE+    
Sbjct  13   YFLLAILSVFFLMRWV--LFFKQKLKNQIIAEWPFLGSLPTVAWNMNRLHDWITEIFISL  70

Query  215  G-GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            G  TF +KG  F+  D + + DP N  +IL  N  NYPKG   R+IF +LG G
Sbjct  71   GIKTFYLKG-LFSKLDYVFSCDPQNFEYILKVNSGNYPKGEDMRQIFDILGDG  122


 Score = 67.4 bits (163),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D E W   R+ +        FR+ +   V + +E  + P+L H A++G+ +DLQ
Sbjct  121  DGIFNTDFESWATQRRASHSAFRLIEFRSFVSYTVQKVIEEKLLPLLAHVAREGSVIDLQ  180

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILP  696
            ++  R +FD        KD G L  +  G+  + +AI D   AILYR  +P
Sbjct  181  DVLLRFTFDTIAMTTCGKDPGFLAKELPGN-VVAKAIDDAQEAILYRNFVP  230



>ref|XP_009108130.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=513

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 70/113 (62%), Gaps = 5/113 (4%)
 Frame = +2

Query  41   VVAILCSILCWIWARQ---IWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            ++ I  S LC+ +      I KK  R   FPTNWP +GMLP LL    R+++Y+TE L  
Sbjct  6    LLEITVSFLCFSFFFGYFFIMKKPHRS--FPTNWPFLGMLPGLLVEIPRVYDYITEFLEA  63

Query  212  SGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            S  TF  KGP F   +ML T DPAN++HI+  NF NYPKG  F+KIF VLG G
Sbjct  64   SNLTFLFKGPCFVGVNMLFTVDPANIHHIMSSNFTNYPKGSEFKKIFDVLGDG  116


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F +      DG+ N D +LW   RK+   +M+   F+    R   +K+E G+ P+L
Sbjct  102  KGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQSMMSRPEFQRFTLRTNMRKLEKGLVPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H+A++   +DLQ++F R +FD +F      D G L ++   +     A+ + +  I +R
Sbjct  162  DHFAEKKLVLDLQDVFQRFTFDTTFVLATGVDPGCLSIE-MPEIEFARALDEAMEVIFFR  220

Query  685  EILPE  699
             I PE
Sbjct  221  HIKPE  225



>emb|CDY12435.1| BnaC08g09240D [Brassica napus]
Length=513

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 62/91 (68%), Gaps = 1/91 (1%)
 Frame = +2

Query  98   KRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGD  277
            K+  RS FPTNWP +GMLP LL    R+++Y+TE L  S  TF  KGP F   +ML T D
Sbjct  27   KKPHRS-FPTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTVD  85

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            PAN++HI+  NF NYPKG  F+KIF VLG G
Sbjct  86   PANIHHIMSSNFTNYPKGSEFKKIFDVLGDG  116


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 65/125 (52%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F +      DG+ N D +LW   RK+   +M+   F+    R   +K+E G+ P+L
Sbjct  102  KGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQCMMSRPEFQRFTLRTNMRKLEKGLVPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H+A++   +DLQ++F R +FD +       D G L ++   +     A+ + +  I +R
Sbjct  162  DHFAKKKLVLDLQDVFQRFTFDTTLVLATGIDPGCLSIE-MPEIEFARALDEAMEVIFFR  220

Query  685  EILPE  699
             I PE
Sbjct  221  HIKPE  225



>ref|XP_009375001.1| PREDICTED: cytochrome P450 86A8 [Pyrus x bretschneideri]
Length=535

 Score = 85.1 bits (209),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 73/121 (60%), Gaps = 11/121 (9%)
 Frame = +2

Query  29   ESYVVVAILCSILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELL  205
            E+ + + IL +I  +++    W K   RS++ P  WPVVG LP L+QN  R+H+++ + L
Sbjct  2    EASMALMILSAIAAYLF----WFKMISRSMYGPRVWPVVGSLPGLIQNVNRMHDWIADNL  57

Query  206  RESGGTFEI---KGPWFANRDML--VTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGM  367
            R  GGT++      P+ A +  L  VT DP N+ HIL   F NYPKGP ++ +FH +LG 
Sbjct  58   RACGGTYQTCTCAIPFLARKQGLVTVTCDPKNLEHILKLRFDNYPKGPTWQAVFHDLLGD  117

Query  368  G  370
            G
Sbjct  118  G  118


 Score = 52.0 bits (123),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 49/112 (44%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R VS+ +E    PVLE    +   VDLQ
Sbjct  117  DGIFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVSRAIELRFCPVLETAQNEAKSVDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L      ++    A      A L R ILPE
Sbjct  177  DLLLRLTFDNICGLAFGKDPQTL-APGLPENEFANAFDRATEATLQRFILPE  227



>ref|XP_010429263.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  65   LCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPW  244
              +I+   +  K+  RS F T+WP++GMLP LL    RI++Y+TELL  S  T+  KGP 
Sbjct  16   FSFIFGYFLISKKPHRS-FLTDWPILGMLPGLLVEIPRIYDYLTELLEASNLTYPFKGPC  74

Query  245  FANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            F   DMLVT DPAN+++I+  NF NYPKG  FRK+F VLG G
Sbjct  75   FGGLDMLVTVDPANIHYIMSSNFANYPKGSEFRKLFDVLGDG  116


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F +      DG+ N DSELW+  RK+   +M+H +F+    R    K+E G+ P+L
Sbjct  102  KGSEFRKLFDVLGDGIFNADSELWKDLRKSAEGMMSHPDFQRFTVRTSMSKLEKGLVPLL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +  A++   VDLQ++F R +FD SF      D G L  +   +     A+ +   AI +R
Sbjct  162  DCVAEKKLVVDLQDVFQRFTFDNSFVLATGVDPGCLSTE-MPEIKFARALDEAEEAIFFR  220

Query  685  EILPE  699
             + PE
Sbjct  221  HVKPE  225



>emb|CDY53179.1| BnaA06g40580D [Brassica napus]
Length=515

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I  + LC+   R     +    + PTNWP +G++P LL    R+++++TE+L  +  T+ 
Sbjct  9    ISIAFLCFFLFRHFLINKKPHRLCPTNWPFLGVIPGLLVEIHRVYDFITEILEVTNLTYF  68

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             KGP +A  DMLVT DP+N++HI+  NF NYPKGP F+K+F VLG G
Sbjct  69   CKGPCYAGLDMLVTVDPSNIHHIMSSNFSNYPKGPEFKKLFDVLGDG  115


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 3/126 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNF-RTSLERNVSQKMENGMFPV  501
            +G  F +      DG+ N DSELW+  RK+   +M H  F + SL  ++S K+E G+ P+
Sbjct  101  KGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMHPEFQKFSLATSMS-KLEKGLVPL  159

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILY  681
            L+H A +   V+L+++F R +FD +       D G L V+   +     A+ D   AI +
Sbjct  160  LDHVANEKLVVNLEDVFQRFTFDTTCVLATGYDPGCLSVE-MPEIEFARALDDAEEAIFF  218

Query  682  REILPE  699
            R + PE
Sbjct  219  RHVKPE  224



>ref|XP_008801256.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera]
Length=528

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            IL S+ C+ +     K+ +  +  P NWP VGMLPALL +  ++H++ T +L+E+G  F 
Sbjct  20   ILISVACFFFFYCYRKRMNEGTGIPVNWPFVGMLPALLVHLHQLHDWGTMILKETGCNFF  79

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
              GPW++  DML+T DPANV H+   NF NYPKG  F +IF VLG G
Sbjct  80   FHGPWYSGMDMLITCDPANVYHVFSANFHNYPKGDDFSEIFDVLGDG  126


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 63/125 (50%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      DG+ N D+E W   R     L+N   FR  + ++   K+E G+ P+L
Sbjct  112  KGDDFSEIFDVLGDGIFNSDAESWRRQRMKAHSLINDRRFRAFVAQSSRSKVEKGLIPLL  171

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +  A+Q   VDLQ++F R++FD +       D G L +  PT   P  +A+ D   A+L 
Sbjct  172  DQLAEQEVAVDLQDVFLRLTFDTTCYLVFGVDPGCLSIGFPT--IPFAKAMDDATGALLV  229

Query  682  REILP  696
            R  +P
Sbjct  230  RHTVP  234



>ref|XP_010681072.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  110  RSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANV  289
            ++  PTNWP++GMLPALL+N  RIH ++ E+  +S  TF   GPWF N  +L+T DPAN+
Sbjct  26   KTGLPTNWPLLGMLPALLKNIHRIHNFLIEIFEKSHLTFLFDGPWFTNMQILLTIDPANI  85

Query  290  NHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +H++ +NF NYPKG +F ++F VLG G
Sbjct  86   HHVMSKNFGNYPKGTKFNEMFDVLGDG  112


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 67/125 (54%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G+ F E      DG+ N D  +W+ HRK     + H  F   L +   +K+ENG+ PVL
Sbjct  98   KGTKFNEMFDVLGDGIFNADFLVWQYHRKMAQYFLGHPKFHHFLVKKTREKLENGLIPVL  157

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +H +  G  VDLQ++F R +FD+     +D D  SL VD PT      +A+ D   AI +
Sbjct  158  DHVSLHGIEVDLQDLFARFTFDVGCTIMMDHDPKSLVVDLPTNASS--KALDDVEEAIFH  215

Query  682  REILP  696
            R ++P
Sbjct  216  RHVVP  220



>dbj|BAK07250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 68/111 (61%), Gaps = 3/111 (3%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            V +AI C   C    R +  +   +S  P NWPV+GMLP L++N  +IH+  T++LRE+G
Sbjct  14   VFLAIAC-FFCLSLFRLV--RHCHKSDLPVNWPVIGMLPFLVRNLYQIHDSGTDMLREAG  70

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             TF I GPWF N   L T DPA VNH    NF NYPKG  F ++F +LG G
Sbjct  71   CTFRIIGPWFLNMSFLATCDPATVNHCFNTNFNNYPKGSEFAEMFDILGEG  121


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 63/127 (50%), Gaps = 7/127 (6%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F E      +G++  DS+ WE  R+    +    +FR+     +++K    + P L
Sbjct  107  KGSEFAEMFDILGEGLLVADSDSWEYQRRVAMQIFGSRDFRSFSMSTITRKASRVLLPFL  166

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPIL---EAIRDGVNAI  675
            +H A+ G+ V+L+ +F R S D+S+      DL  L V      PI    +A ++    +
Sbjct  167  DHMAKHGSQVELEGVFMRFSLDVSYSTVFATDLDCLSV----SRPIPAFGKATKEVEEGM  222

Query  676  LYREILP  696
            L+R ++P
Sbjct  223  LFRHVVP  229



>ref|XP_011100086.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=512

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (67%), Gaps = 2/114 (2%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            S ++V      L   W   +W  R+RR +   NWP++GMLP LL +  RIH+  TE+LR 
Sbjct  2    SEILVMCFEVFLAVSWFFALWAWRNRRMI-GWNWPLMGMLPTLLLHVDRIHDTCTEILRR  60

Query  212  SG-GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            S  GTF  +GPWFAN ++L T +PA+V++I+  NFQN+PKGP FR++F VLG G
Sbjct  61   SRRGTFRFQGPWFANMEILGTANPADVHYIMSSNFQNFPKGPVFREMFDVLGEG  114


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+ N DS+ W+  R+    L+ H  F   L +   +K+E G+  VL
Sbjct  100  KGPVFREMFDVLGEGIFNADSDSWKHQRRAARALIGHQRFHRCLSKISFEKVEKGLVSVL  159

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            E   ++   +DLQ++F R++FD +       D G L VD   D P  +A+ D   AI  R
Sbjct  160  EMVCREKQVIDLQDLFQRLTFDTTCALVTGYDPGCLSVD-LPDVPFSKAMDDAEEAIFMR  218

Query  685  EILPE  699
             +LP+
Sbjct  219  HVLPD  223



>ref|XP_006391721.1| hypothetical protein EUTSA_v10023410mg [Eutrema salsugineum]
 gb|ESQ29007.1| hypothetical protein EUTSA_v10023410mg [Eutrema salsugineum]
Length=525

 Score = 81.3 bits (199),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 70/121 (58%), Gaps = 11/121 (9%)
 Frame = +2

Query  29   ESYVVVAILCSILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELL  205
            +    V IL  ++ ++    IW    RRS+  P  WP++G LPAL+ NA R+H+++ E L
Sbjct  2    DGSTAVIILTGVVVYL----IWFVSLRRSLKGPRVWPLLGSLPALIANAHRMHDFIAENL  57

Query  206  RESGGTFE---IKGPWFANRD--MLVTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGM  367
            R  GGT++      P+ A +   + VT DP N+ HIL   F NYPKGP ++  FH +LG 
Sbjct  58   RTCGGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSAFHDLLGD  117

Query  368  G  370
            G
Sbjct  118  G  118


 Score = 55.5 bits (132),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 52/113 (46%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R V + ++N + P+L+  A Q   +DLQ
Sbjct  117  DGIFNSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILDSAACQAEPIDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            +I  R++FD        KD  +L  D P     +  A      A L R I+PE
Sbjct  177  DILLRLTFDNICGLTFGKDPRTLSPDFPENRFAV--AFDGATEATLQRFIMPE  227



>ref|XP_010905514.1| PREDICTED: cytochrome P450 86B1-like [Elaeis guineensis]
Length=559

 Score = 85.1 bits (209),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +2

Query  131  WPVVGMLPALLQNA-GRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCR  307
            WPVVGMLP+LL       HE++T +LR  GGTF  +GPWF N   +VT DP N+ HIL  
Sbjct  76   WPVVGMLPSLLLGLRNDAHEWLTGVLRAQGGTFTFRGPWFTNLQCVVTADPRNLEHILKT  135

Query  308  NFQNYPKGPRFRKIF-HVLGMG  370
             F N+PKG  FR I   +LG G
Sbjct  136  KFSNFPKGEYFRNIASDMLGDG  157


 Score = 51.2 bits (121),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 55/112 (49%), Gaps = 3/112 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG  N D E+W   RKT +  ++  +FR++  ++V + + + + PVLE         DLQ
Sbjct  156  DGFFNSDGEVWRRQRKTLSLEVHSADFRSATTQSVFEIVHSRLLPVLELAHDNQAPFDLQ  215

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDP-TGDHPILEAIRDGVNAILYREILP  696
            ++  R++FD         D G  C+ P   + P   A+ +   A L R ++P
Sbjct  216  DVLLRLAFDNLCMVAFGIDPG--CLRPELPEVPFARALENATEATLRRFVVP  265



>gb|KFK22570.1| hypothetical protein AALP_AAs72953U000100 [Arabis alpina]
Length=500

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  98   KRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGD  277
            K+++R  FPTNWPV+GMLPALL    RI++ +TE+L  +  TF  KGPW +  D+L+T D
Sbjct  27   KKTQRP-FPTNWPVLGMLPALLHQVPRIYDCITEVLEAADMTFHFKGPWLSRTDILITVD  85

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLG  364
            PAN+++IL  NF NYPKG  FR IF  LG
Sbjct  86   PANIHYILSSNFVNYPKGMEFRNIFKELG  114


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 58/125 (46%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F        D + NVD ELWE  R +   + +H  F+         K++ G+ P+L
Sbjct  102  KGMEFRNIFKELGDSIFNVDWELWEDLRNSAHAIFSHQEFQKISVSTSMSKLKQGLVPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            E+  ++   VDLQ++F R  +D S       D   L ++ P  +    +A+   V+ + Y
Sbjct  162  ENAVEENILVDLQDLFQRFLYDTSSILMTGYDTECLSIEMPKVEFS--DAVDGVVDGLFY  219

Query  682  REILP  696
            R  +P
Sbjct  220  RHFMP  224



>ref|XP_010025512.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62204.1| hypothetical protein EUGRSUZ_H04862 [Eucalyptus grandis]
Length=507

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 3/109 (3%)
 Frame = +2

Query  44   VAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGT  223
            + I  + +C+ + R + K        P NWP+VGMLPAL  N G +H++VT  L  S G 
Sbjct  7    LEIFLATICFAFLRLLGKSHDG---LPQNWPLVGMLPALFLNLGSVHDWVTSFLERSRGN  63

Query  224  FEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            F  +  WF+  DMLVT DPANV++I+  NF+N+PKG  F+++F VLG G
Sbjct  64   FLFRFHWFSGMDMLVTADPANVHYIMSTNFENFPKGAEFKRVFDVLGDG  112


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G+ F        DG++N DS++W + R+     MN   F   L +    K+ENG+  VL
Sbjct  98   KGAEFKRVFDVLGDGILNSDSDVWRMQRRVAQVFMNDQRFCQFLAKTTRDKVENGLLRVL  157

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +  +Q+G  VDLQ++F R +FD + +     D GSL V+   + P  +A+ D    I YR
Sbjct  158  DELSQRGVAVDLQDLFQRFTFDAACRFVTGFDPGSLSVE-FPEVPFSKALDDAEEVIFYR  216

Query  685  EILPE  699
             + PE
Sbjct  217  HMYPE  221



>ref|XP_008796514.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera]
Length=541

 Score = 80.1 bits (196),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 53/82 (65%), Gaps = 2/82 (2%)
 Frame = +2

Query  131  WPVVGMLPALLQNA-GRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCR  307
            WPVVGMLP+LL      ++E++T +LR  GGTF  +GPWF+N   +VT DP N+ HIL  
Sbjct  59   WPVVGMLPSLLLGLRNDVYEWLTAVLRARGGTFTFRGPWFSNLQCVVTADPRNLEHILKI  118

Query  308  NFQNYPKGPRFRKIF-HVLGMG  370
             F  +PKG  +R I   +LG G
Sbjct  119  KFSKFPKGKYYRNIASDMLGDG  140


 Score = 56.2 bits (134),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 3/112 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D E+W   RKT +  M+   FR+S  +++S+ +   + PVLE      T  DLQ
Sbjct  139  DGIFNSDGEVWRCQRKTLSLEMHSAEFRSSTIQSISELVHLRLLPVLELVHDNHTPFDLQ  198

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDP-TGDHPILEAIRDGVNAILYREILP  696
            ++  R++FD         D G  C+ P   + P   A  +   A L R ++P
Sbjct  199  DVLLRLAFDNLVMVAFGIDPG--CLRPGLPEVPFARAFENATEATLLRFVMP  248



>ref|XP_010418406.1| PREDICTED: cytochrome P450 86A7-like [Camelina sativa]
Length=533

 Score = 81.6 bits (200),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (58%), Gaps = 11/121 (9%)
 Frame = +2

Query  29   ESYVVVAILCSILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELL  205
            E  + V IL  I+ ++    IW    RRS   P  WP+ G LPAL+ NA R+H+++ + L
Sbjct  2    EGSMAVIILTVIVTYL----IWFVSLRRSCKGPRVWPLFGSLPALITNAHRMHDFIADNL  57

Query  206  RESGGTFE---IKGPWFANRD--MLVTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGM  367
            R+ GGT++      P+ A +   + VT DP N+ HIL   F NYPKGP +  +FH +LG 
Sbjct  58   RKCGGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWHSVFHDLLGD  117

Query  368  G  370
            G
Sbjct  118  G  118


 Score = 54.7 bits (130),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 53/113 (47%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W+  RKT          R ++ R V + ++N + P+LE    +   +DLQ
Sbjct  117  DGIFNSDGDTWKFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESAMSRAEPIDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            +I  R++FD        KD  +L ++ P     +  A      A L R I+PE
Sbjct  177  DILLRLTFDNICGLTFGKDPRTLSLEFPENGFAV--AFDGATEATLQRFIMPE  227



>ref|XP_003556827.2| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=509

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = +2

Query  35   YVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            ++ + +  SIL  I    I+ ++  R    TNWP++GMLP++LQN   IH   TE L+  
Sbjct  2    FMYIGVFVSILSTI----IFFRKHNRDEPITNWPIIGMLPSVLQNLSNIHYLTTEALKHY  57

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GGT   KGPWF N + ++T DP NV+HI  +NF NY KG  F +IF VLG G
Sbjct  58   GGTLMFKGPWFTNTNFILTSDPMNVHHITSKNFGNYGKGSNFNEIFEVLGGG  109


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = +1

Query  322  SQGSSFPENISRPRDGMINVDS-ELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFP  498
             +GS+F E       G+IN D    W+  R     L+  ++F+  L++ + +K+EN + P
Sbjct  94   GKGSNFNEIFEVLGGGIINSDDLHAWKQERTMLHSLLKRESFKIFLQKTIQKKLENCLIP  153

Query  499  VLEHYAQQGTHVDLQEIFHRISFD  570
             L+H ++ G  VDLQ+ F R +FD
Sbjct  154  FLDHASKAGAEVDLQDAFQRFTFD  177



>ref|XP_009759095.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I  +I C+     ++     RS  P NWP +GM P LL +  RIHE   E+   +GGT+ 
Sbjct  15   IFVAIFCFF----VFCALGDRSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSRTGGTYL  70

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +KGPWFAN D+L T DPANV++I+   F+N+PKG  F+KIF VLG G
Sbjct  71   LKGPWFANMDILGTVDPANVHYIMSAKFENFPKGEEFKKIFDVLGDG  117


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 66/131 (50%), Gaps = 1/131 (1%)
 Frame = +1

Query  307  KLPELSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMEN  486
            K     +G  F +      DG+ N D +LW+  RK T  L+ H  F   L +    K+EN
Sbjct  97   KFENFPKGEEFKKIFDVLGDGIFNSDLDLWKTQRKITRTLITHQRFHNCLVKTSWDKIEN  156

Query  487  GMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGV  666
            G+  VLE  A++   VDLQ++F R +FD + Q     D G L ++   D+P  +A+ +  
Sbjct  157  GLISVLEFVARESKIVDLQDVFQRFTFDTTCQLVTGYDPGCLSLE-FPDNPFSKAMDEAE  215

Query  667  NAILYREILPE  699
              +  R +LPE
Sbjct  216  EVLFIRHLLPE  226



>ref|XP_002878579.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54838.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = +2

Query  32   SYV-VVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLR  208
            +YV ++ +  + L +I+   +  K++   + P NWPV+GMLP +L     I++YV E+L 
Sbjct  2    AYVGLLEVFIAFLVFIFFHFLIHKKAHH-ILPRNWPVLGMLPGVLFMLHMINDYVAEILE  60

Query  209  ESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             S  TF  KGPWF   +ML+T DPAN+ H+ C NF NY KGP F+++F  LG G
Sbjct  61   VSNLTFAFKGPWFTGMNMLITADPANIQHVFCSNFSNYDKGPEFKEMFDFLGNG  114


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 73/125 (58%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+   DS+LWE  RK+   +++H  F++   R +++K++NG+ PVL
Sbjct  100  KGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRTITRKIKNGLVPVL  159

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +H+++  T  DLQ++F R++FD++       D  SL ++ P  ++   +A+ D    ++Y
Sbjct  160  DHFSEANTVFDLQDVFQRLAFDVTLTLVTGYDSSSLSIEMPKNEYA--KAMDDAEEVVVY  217

Query  682  REILP  696
            R + P
Sbjct  218  RHVKP  222



>gb|KJB77357.1| hypothetical protein B456_012G133700 [Gossypium raimondii]
Length=547

 Score = 76.6 bits (187),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = +2

Query  101  RSRRSVFPTNWPVVGMLPALLQNA-GRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGD  277
            R RR      WP +GMLP+L+      ++E+++++L E  GTF  KGPWF++ + +VT D
Sbjct  48   RQRRRYGLPVWPFLGMLPSLVSGLRSDLYEWISDILCEQNGTFRFKGPWFSSLNCVVTAD  107

Query  278  PANVNHILCRNFQNYPKGPRFRKIF-HVLGMG  370
            P N+ H+L   F  +PKGP FR     +LG G
Sbjct  108  PRNLEHLLKSKFSVFPKGPYFRDTARDLLGDG  139


 Score = 59.3 bits (142),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 52/113 (46%), Gaps = 1/113 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D E W+  RKT +   +   FR     +V + +   + PVLE+   Q   +DLQ
Sbjct  138  DGIFNADDETWQRQRKTASIEFHSAKFRQLTTESVLELVHARLLPVLENAVNQSISIDLQ  197

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPEC  702
            ++  R++FD         D G L +    + P  +A  D   A L R + P C
Sbjct  198  DVLLRLTFDNVCMTAFGVDPGCLRLG-LPEIPFAKAFEDATEATLLRFVTPTC  249



>ref|XP_006285710.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
 gb|EOA18608.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
Length=513

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I  +  C++  R     +    + PTNWP +GM+P LL    R++++VTE+L  +  T+ 
Sbjct  9    ISIAFFCFLLFRYFLINKKPHRLCPTNWPFLGMIPGLLVEIHRVYDFVTEVLEVTNLTYP  68

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
              GP FA  DML+T DPAN++HI+  NF NYPKGP F+K+F VLG G
Sbjct  69   CVGPCFAGLDMLITVDPANIHHIMSSNFANYPKGPEFKKLFDVLGDG  115


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N DSELW+  RK+   +M +  F+         K+E G+ P+L
Sbjct  101  KGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSLNKLEKGLVPLL  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H A++   +DLQ++F R +FD +F      D G L V+   +     A+ D   AI YR
Sbjct  161  DHVAKEKLVLDLQDMFQRFTFDTTFVLATGYDPGCLSVE-MPEVEFARALDDAEEAIFYR  219

Query  685  EILPE  699
             I PE
Sbjct  220  HIKPE  224



>ref|XP_006464845.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
Length=475

 Score = 73.9 bits (180),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +2

Query  146  MLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYP  325
            ML +++ N  ++H+ V ++L ++ G+F IKG W A  DM +T DPANV HI+  NF  Y 
Sbjct  1    MLASVILNINQLHDKVAQILEKTKGSFMIKGSWVAQYDMFLTSDPANVQHIMSTNFSKYH  60

Query  326  KGPRFRKIFHVLG  364
            KG   RK F + G
Sbjct  61   KGSEGRKRFDIFG  73


 Score = 62.0 bits (149),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 58/113 (51%), Gaps = 3/113 (3%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQE  546
            G+ N D + W+  RK     +NH  F+  + + V + +E G+ PVL+H +++   VD Q+
Sbjct  76   GLFNSDFDEWKHQRKLARAFINHQKFQQLMAKIVPEMIERGLIPVLDHVSEEKMLVDFQD  135

Query  547  IFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPEC  702
            +  R +FD +       +  SL V  P    P  +A+ D   AIL R ++PE 
Sbjct  136  LLKRTTFDFACLIATGHNPNSLSVGFPEMGFP--DAVDDACEAILIRHLVPES  186



>ref|XP_010430476.1| PREDICTED: cytochrome P450 86A7 [Camelina sativa]
Length=533

 Score = 79.7 bits (195),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 72/121 (60%), Gaps = 11/121 (9%)
 Frame = +2

Query  29   ESYVVVAILCSILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELL  205
            +  + V IL  I+ ++    IW    RRS   P  WP++G LPAL+ NA R+H+++ + L
Sbjct  2    DGSMAVIILTVIVTYL----IWFVSIRRSCKGPRVWPLLGSLPALITNAHRMHDFIADNL  57

Query  206  RESGGTFE---IKGPWFANRD--MLVTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGM  367
            R+ GGT++      P+ A +   + VT +P N+ HIL   F NYPKGP ++ +FH +LG 
Sbjct  58   RKCGGTYQTCIFPIPFLAKKQGHVTVTCEPKNLEHILKTRFDNYPKGPSWQSVFHDLLGD  117

Query  368  G  370
            G
Sbjct  118  G  118


 Score = 56.2 bits (134),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 52/113 (46%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R V + ++N + P+LE    Q   +DLQ
Sbjct  117  DGIFNSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESAMSQAKPIDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            +I  R++FD        KD  +L ++ P     +  A      A L R I+PE
Sbjct  177  DILLRLTFDNICGLTFGKDPRTLSLEFPENGFAV--AFDGATEATLQRFIMPE  227



>ref|XP_006300436.1| hypothetical protein CARUB_v10020100mg [Capsella rubella]
 gb|EOA33334.1| hypothetical protein CARUB_v10020100mg [Capsella rubella]
Length=546

 Score = 82.4 bits (202),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 72/121 (60%), Gaps = 11/121 (9%)
 Frame = +2

Query  29   ESYVVVAILCSILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELL  205
            +  + V IL  I+ ++    IW    RRS   P  WP++G LPAL+ NA R+H+++ + L
Sbjct  2    DGSMAVIILTVIVTYL----IWFVSLRRSYKGPRVWPLLGSLPALITNAHRMHDFIADNL  57

Query  206  RESGGTFE---IKGPWFANRD--MLVTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGM  367
            R SGGT++      P+ A +   + VT DP N+ HIL   F NYPKGP ++ +FH +LG 
Sbjct  58   RMSGGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGD  117

Query  368  G  370
            G
Sbjct  118  G  118


 Score = 53.1 bits (126),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 51/113 (45%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R V + ++N + P+LE    +   VDLQ
Sbjct  117  DGIFNTDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESAMSRAEPVDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L  + P     +  A      A L R I+PE
Sbjct  177  DVLLRLTFDNICGLTFGKDPRTLSPEFPENGFAV--AFDGATEATLQRFIMPE  227



>ref|XP_002275806.1| PREDICTED: cytochrome P450 86A7 [Vitis vinifera]
Length=545

 Score = 85.5 bits (210),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +2

Query  62   ILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEI--  232
            +L  I A  IW +   RS+  P  WPVVG LP L+QNA R+HE++ E LR  GGT++   
Sbjct  9    LLAIITAYLIWFRSITRSLKGPRVWPVVGSLPLLIQNANRMHEWIAENLRSCGGTYQTCI  68

Query  233  -KGPWFANRDML--VTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
               P+ A +  L  VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  69   CPIPFLARKQGLVTVTCDPKNLEHILKIRFDNYPKGPTWQAVFHDLLGEG  118


 Score = 50.1 bits (118),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 50/112 (45%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ N D E W   RKT          R ++ R V++ ++    P+L+    +G  VDLQ
Sbjct  117  EGIFNSDGETWRFQRKTAALEFTTRTLRQAMARWVTRAIKLRFCPILKKAQLEGKPVDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L      ++    A      A L R ILPE
Sbjct  177  DLLLRLTFDNICGLAFGKDPQTLAPG-LPENSFATAFDRATEATLQRFILPE  227



>gb|KGN48429.1| hypothetical protein Csa_6G487010 [Cucumis sativus]
Length=458

 Score = 68.6 bits (166),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 59/112 (53%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N DS+ W+  RK    L+ H+ F   +     +K+E G+ P+LEH+ +    VDL+
Sbjct  62   DGIFNSDSDSWKNQRKIAQSLIVHEKFFEFMCGVAKEKVEKGLVPILEHFCESKKVVDLK  121

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R+ FD +       D  SL +D   D P  +A+ D    I +R + P+
Sbjct  122  DLFLRLMFDTTCTMVAGFDFNSLSID-FPDIPFTKAMDDIQEVIFFRHLYPK  172


 Score = 67.0 bits (162),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  227  EIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +  G WF N  +L+T DP+N++HI+  NFQNYPKGP F+ IF VLG G
Sbjct  16   DSDGIWFTNTSLLITVDPSNIHHIMTSNFQNYPKGPDFKYIFDVLGDG  63



>emb|CAN80040.1| hypothetical protein VITISV_037194 [Vitis vinifera]
Length=580

 Score = 85.5 bits (210),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +2

Query  62   ILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEI--  232
            +L  I A  IW +   RS+  P  WPVVG LP L+QNA R+HE++ E LR  GGT++   
Sbjct  9    LLAIITAYLIWFRSITRSLKGPRVWPVVGSLPLLIQNANRMHEWIAENLRSCGGTYQTCI  68

Query  233  -KGPWFANRDML--VTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
               P+ A +  L  VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  69   CPIPFLARKQGLVTVTCDPKNLEHILKIRFDNYPKGPTWQAVFHDLLGEG  118


 Score = 50.1 bits (118),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 50/112 (45%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ N D E W   RKT          R ++ R V++ ++    P+L+    +G  VDLQ
Sbjct  117  EGIFNSDGETWRFQRKTAALEFTTRTLRQAMARWVTRAIKLRFCPILKKAQLEGKPVDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L      ++    A      A L R ILPE
Sbjct  177  DLLLRLTFDNICGLAFGKDPQTLAPG-LPENSFATAFDRATEATLQRFILPE  227



>emb|CDY70656.1| BnaAnng34510D [Brassica napus]
Length=298

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = +2

Query  98   KRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGD  277
            K+S       NWP +GMLP +L N  RI ++++E+   +  TF  KGPWF+  DML T D
Sbjct  26   KKSHNVALLENWPFLGMLPGILFNLPRIFDWLSEVHEANDMTFAFKGPWFSGTDMLFTVD  85

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            P N+NH+L  NF NYPKGP F+KIF +LG G
Sbjct  86   PRNINHMLSSNFPNYPKGPEFKKIFEILGDG  116


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 61/129 (47%), Gaps = 1/129 (1%)
 Frame = +1

Query  310  LPELSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENG  489
             P   +G  F +      DG++  D ELWE  RK+   L +H NF      + + K++N 
Sbjct  97   FPNYPKGPEFKKIFEILGDGIVAADMELWEDLRKSGHALFHHQNFLKLTVSSTTSKLKND  156

Query  490  MFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVN  669
            + P+L+  A++   +DLQ++F R  FD +       D  SL ++   +    EA      
Sbjct  157  LVPLLDQAAEENIVIDLQDVFQRFMFDTASILMTGYDQMSLSIE-MPEVEFSEAADFAEE  215

Query  670  AILYREILP  696
            A+ YR + P
Sbjct  216  ALFYRHLKP  224



>emb|CDX90338.1| BnaA08g16460D [Brassica napus]
Length=499

 Score = 87.0 bits (214),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +2

Query  35   YVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            +  + I C  L    +  +  KRS     P NWPV+GMLPAL+  + RI + +  +L +S
Sbjct  14   FCFLIIFCYFLNKKHSGYLVNKRS-----PWNWPVLGMLPALVLWSRRI-DVLIRVLEKS  67

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKI  349
              TF  KGPWFA  D L+T DPAN++HIL  NF NY KGP F+++
Sbjct  68   NLTFLFKGPWFARMDALITVDPANIHHILSSNFSNYIKGPEFKEM  112


 Score = 48.5 bits (114),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +1

Query  469  SQKMENGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE  648
            + K+++ + P+   ++++GT VDLQ++F R  FDIS       D  SL ++   +  + E
Sbjct  129  TSKIKDVLLPIFSRFSEEGTVVDLQDVFRRFMFDISLLLVSGSDPQSLSIE-MPEVELAE  187

Query  649  AIRDGVNAILYREILP  696
            A  D   AI+ R I+P
Sbjct  188  AFEDAGEAIVSRLIIP  203



>gb|EYU24048.1| hypothetical protein MIMGU_mgv1a026886mg [Erythranthe guttata]
Length=509

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +2

Query  35   YVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRES  214
            Y +  IL   + +++   +W  R+   + P NWPVVGMLP+L  +  R+H    ++L+ +
Sbjct  7    YFIAEILLPFIFFLF---VWCFRNINGL-PWNWPVVGMLPSLFCHLHRVHHRCVDILKLA  62

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GGTF +KGP FAN D+++T DPAN++ I+  NF N+PKGP F++IF VLG G
Sbjct  63   GGTFHLKGPSFANSDIIITADPANIHFIMSSNFANFPKGPHFKEIFDVLGDG  114


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 62/127 (49%), Gaps = 3/127 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      DG+ N DS+ W   RK    L+ HD+FR  L R  S+K+ + + PVL
Sbjct  100  KGPHFKEIFDVLGDGIFNADSDSWARQRKQARALITHDSFRRFLIRTTSEKVRHSLIPVL  159

Query  505  EHYA--QQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAIL  678
            E      +G  VDLQ++F R +FD +       D G L V    D P   A+ +   AI 
Sbjct  160  EQVCNNSRGIVVDLQDLFQRFTFDTTCVLVTGYDPGCLSVG-LPDVPFSRALDEAEEAIF  218

Query  679  YREILPE  699
             R  LPE
Sbjct  219  MRHCLPE  225



>ref|XP_006643843.1| PREDICTED: cytochrome P450 86B1-like [Oryza brachyantha]
Length=517

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I+ S  C++     ++ R R    PTNWPVVG LPA++ NAGR+HE+VTE LR +G ++ 
Sbjct  17   IMVSAACFLLLLCRFRMRRRADRVPTNWPVVGALPAVVVNAGRVHEWVTEFLRAAGMSYV  76

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            ++GPW +  D+LVT DPANV H     F NYPKG  F  +F VLG G
Sbjct  77   VEGPWGSPGDVLVTADPANVAHFFTAIFGNYPKGEGFAAMFDVLGDG  123


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F        DG+ N D E W   R+ +  L++   FR ++  + ++K+  G+ P  
Sbjct  109  KGEGFAAMFDVLGDGIFNADGESWSCQRRKSHALLSDARFRAAVAASAARKLGGGLVPPP  168

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +  A  G   DLQ++F R++FD++       D G L  D P+   P  +A+ D    + Y
Sbjct  169  DGLAASGAAADLQDVFMRLTFDLTAMFVFGGDPGCLAADFPS--VPFAKAMDDAEELLFY  226

Query  682  REILP  696
            R + P
Sbjct  227  RHVAP  231



>ref|XP_002894690.1| hypothetical protein ARALYDRAFT_474859 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70949.1| hypothetical protein ARALYDRAFT_474859 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 67/111 (60%), Gaps = 1/111 (1%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            + VA L S++       I KK   + +   NWP +GMLP +L    RI+++  E+L  S 
Sbjct  9    LFVAFLFSLVFLFTCFFIHKKPHGQPIL-KNWPFLGMLPGMLPQIPRIYDWTVEVLEASN  67

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             TF  KGPW +  DML T DP N+NHIL  NF NYPKGP F+KIF VLG G
Sbjct  68   LTFYFKGPWLSGTDMLFTADPKNINHILSSNFGNYPKGPEFKKIFDVLGEG  118



>ref|XP_009389287.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=528

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +2

Query  110  RSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANV  289
            RS  P NWPVVGMLPALL N  R+H++ T++LRE+G +F  +GPWF   + L+T DPANV
Sbjct  44   RSRIPVNWPVVGMLPALLVNLHRLHDWGTDVLREAGCSFWFRGPWFLGMNHLLTCDPANV  103

Query  290  NHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +H+   NF NYPKG  F +IF +LG G
Sbjct  104  HHVFGANFSNYPKGEAFLEIFDILGDG  130


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G +F E      DG+ N D + W+  R     +M+   FRT +  +   K+E G+ P++
Sbjct  116  KGEAFLEIFDILGDGIFNSDEQSWKEQRTKAHSIMSGRRFRTFVADSARSKVEKGLLPLI  175

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
             H AQ+G  VDLQ++F R++FD +       D   L V+ PT   P   A+ D + A+L 
Sbjct  176  HHIAQRGVAVDLQDVFLRLTFDTTCNLVFGVDPRCLSVEFPT--IPFARAMDDAMAALLT  233

Query  682  REILP  696
            R+ +P
Sbjct  234  RQTVP  238



>emb|CDY53182.1| BnaA06g40610D [Brassica napus]
Length=465

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             PTNWPV+GMLP LL    RI++++TELL  +G TF  KGPW +  D+L+T DP N+++I
Sbjct  33   LPTNWPVLGMLPGLLLQVHRIYDWITELLEATGMTFCFKGPWLSGTDILLTVDPVNIHYI  92

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  NF NYPKG  F+KIF V+G
Sbjct  93   LSSNFVNYPKGMEFKKIFEVIG  114


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 62/126 (49%), Gaps = 5/126 (4%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      D + N+DS +WE  R ++  + +  +F+         K+  G+  +L
Sbjct  102  KGMEFKKIFEVIGDAIFNIDSGMWEDMRNSSHAIFSRQDFQRLWVSTSVSKINQGLVHIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGV-NAIL  678
            ++  ++   VDLQ++F R  FD S       DL  L ++ P  D    +A+ DGV +AI 
Sbjct  162  DNAVEKNILVDLQDVFQRFLFDTSTILMTGYDLKCLSLEMPKVDFG--DAV-DGVSDAIF  218

Query  679  YREILP  696
            YR + P
Sbjct  219  YRHVKP  224



>gb|AHH81835.1| putative cytochrome P450, partial [Avicennia officinalis]
Length=351

 Score = 79.7 bits (195),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  41   VVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNA-GRIHEYVTELLRESG  217
            ++ +L ++L ++  + + +K+ +    P  WP VGMLP+L+    G ++++++E+LR   
Sbjct  4    MLELLAAVLVFVAIQSLRQKKHQG--LPI-WPFVGMLPSLILGLRGNMYDWISEVLRRQN  60

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRK-IFHVLGMG  370
            GTF  KGPWF N + +VT DP N+ ++L   F N+PKG  FR  +  +LG G
Sbjct  61   GTFTFKGPWFTNLNCVVTSDPRNLEYLLKTKFSNFPKGVYFRDTVRDLLGDG  112


 Score = 55.5 bits (132),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 54/112 (48%), Gaps = 3/112 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ + D E+W+  RKT +   +   FR     ++ + + + + PVLE   ++ T +DLQ
Sbjct  111  DGIFSADDEIWQRQRKTASLEFHSGKFRKMTTESLRELVHSRLLPVLEDSVRESTWIDLQ  170

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDP-TGDHPILEAIRDGVNAILYREILP  696
            ++  R++FD         D G  C+ P   + P   A  D   A + R I P
Sbjct  171  DVLLRLTFDNVCMIAFGVDPG--CLRPGLPEIPFARAFEDATEATIMRFITP  220



>tpg|DAA43291.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=535

 Score = 79.3 bits (194),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = +2

Query  29   ESYVVVAILCSILCWI--WARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTEL  202
            E + +   L  +LC++  + R +  K++   + PT WP+VG LP L+ N    H++ T +
Sbjct  2    EPFFLFVGLALVLCFLTLYYRHLQSKKTS-PLEPTEWPIVGHLPGLVANIHHFHDWATGV  60

Query  203  LRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            L  +G  FE +      R   +T DP+NV HI   NF NYPKG  +  IF VLG G
Sbjct  61   LAGAGYNFEARAGRTGVR-YFITCDPSNVRHIFTSNFANYPKGEEYAAIFDVLGGG  115


 Score = 55.8 bits (133),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 49/117 (42%), Gaps = 6/117 (5%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQ---QGTHVD  537
            G+ N D E W   R     LM    FR    R    K+E  + P L H+A    +    D
Sbjct  115  GIFNADGESWRRQRVKAQMLMTGPRFRAFTARCSRDKVERSLLPFLAHHADDDGRAPPCD  174

Query  538  LQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPECC  705
            L ++F R++FD++       D G L    P    P   A+ D +  +  R I+P  C
Sbjct  175  LHDVFLRLTFDMTCTLVFGVDPGCLAFGLPV--VPFARAMDDALETLFLRHIIPMAC  229



>ref|XP_010437069.1| PREDICTED: cytochrome P450 86B1 isoform X1 [Camelina sativa]
 ref|XP_010437071.1| PREDICTED: cytochrome P450 86B1 isoform X2 [Camelina sativa]
Length=513

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 68/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I  +  C++  R     +    + PTNWP +GM+P LL    R++++VT++L  +  T+ 
Sbjct  9    ISIAFFCFLLFRYFLINKKPHRLCPTNWPFLGMIPGLLVEIHRVYDFVTDILEVTNLTYP  68

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
              GP F+  DMLVT DPAN++HI+  NF NYPKGP F+K+F VLG G
Sbjct  69   CVGPLFSGLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDVLGDG  115


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 65/125 (52%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N DS+LW+  RK+   +M +  F+         K+E G+ P+L
Sbjct  101  KGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQSMMMNPEFQKFSLATSLNKLEKGLVPLL  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H A++   VDLQ++F R +FD +F      D G L V+   +    +A+ D   AI YR
Sbjct  161  DHVAKEKLAVDLQDVFQRFTFDTTFVLATGYDPGCLSVE-MPEVEFAKALDDAEEAIFYR  219

Query  685  EILPE  699
             + PE
Sbjct  220  HVKPE  224



>ref|XP_002886391.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=549

 Score = 81.3 bits (199),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = +2

Query  62   ILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE---  229
            IL  I    IW    RRS   P  WP+VG LPAL+ NA R+H+++ + LR  GGT++   
Sbjct  9    ILTLIVTYLIWFVSLRRSYKGPRVWPLVGSLPALITNAHRMHDFIADNLRMCGGTYQTCI  68

Query  230  IKGPWFANRD--MLVTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
               P+ A +   + VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  69   FPIPFLAKKQGHVTVTCDPKNLEHILKSRFDNYPKGPSWQSVFHDLLGDG  118


 Score = 53.5 bits (127),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 51/113 (45%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R V + ++N + P+LE    +   +DLQ
Sbjct  117  DGIFNSDGDTWRFQRKTAALDFTTRTLRQAMARWVDRAIKNRLVPILESAMSRAEPIDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L  D P     +  A      A L R I+PE
Sbjct  177  DVLLRLTFDNICGLTFGKDPRTLSPDFPENGFAV--AFDGATEATLQRFIMPE  227



>ref|XP_002452782.1| hypothetical protein SORBIDRAFT_04g032410 [Sorghum bicolor]
 gb|EES05758.1| hypothetical protein SORBIDRAFT_04g032410 [Sorghum bicolor]
Length=542

 Score = 70.9 bits (172),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 59/108 (55%), Gaps = 12/108 (11%)
 Frame = +2

Query  65   LCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE---IK  235
            L W W      + SR    P  WPV+G LP L+Q+A  +HE++   LR +GGT++     
Sbjct  17   LAWFW------RLSRGLSGPRVWPVLGSLPGLVQHAEDMHEWIVGNLRRTGGTYQTCIFA  70

Query  236  GPWFANRDML--VTGDPANVNHILCRNFQNYPKGPRFRKIF-HVLGMG  370
             P  A R  L  VT DP N+ H+L   F NYPKGP +  +F  +LG G
Sbjct  71   VPGVARRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDG  118


 Score = 64.3 bits (155),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 54/113 (48%), Gaps = 1/113 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          RT++ R VS+ +   + P+L+  A +GTHVDLQ
Sbjct  117  DGIFNSDGDTWVAQRKTAALEFTTRTLRTAMSRWVSRSIHLRLLPILDEAASEGTHVDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPEC  702
            ++  R++FD        KD  +L      ++    A      A L R I PEC
Sbjct  177  DLLLRLTFDNICGLAFGKDPETLAPG-LPENAFATAFDRATEATLNRFIFPEC  228



>ref|NP_001141467.1| uncharacterized protein LOC100273577 [Zea mays]
 gb|ACF86433.1| unknown [Zea mays]
Length=537

 Score = 79.3 bits (194),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = +2

Query  29   ESYVVVAILCSILCWI--WARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTEL  202
            E + +   L  +LC++  + R +  K++   + PT WP+VG LP L+ N    H++ T +
Sbjct  2    EPFFLFVGLALVLCFLTLYYRHLQSKKTS-PLEPTEWPIVGHLPGLVANIHHFHDWATGV  60

Query  203  LRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            L  +G  FE +      R   +T DP+NV HI   NF NYPKG  +  IF VLG G
Sbjct  61   LAGAGYNFEARAGRTGVR-YFITCDPSNVRHIFTSNFANYPKGEEYAAIFDVLGGG  115


 Score = 55.5 bits (132),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 49/117 (42%), Gaps = 6/117 (5%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQ---QGTHVD  537
            G+ N D E W   R     LM    FR    R    K+E  + P L H+A    +    D
Sbjct  115  GIFNADGESWRRQRVKAQMLMTGPRFRAFTARCSRDKVERSLLPFLAHHADDDGRAPPCD  174

Query  538  LQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPECC  705
            L ++F R++FD++       D G L    P    P   A+ D +  +  R I+P  C
Sbjct  175  LHDVFLRLTFDMTCTLVFGVDPGCLAFGLPV--VPFARAMDDALETLFLRHIIPMAC  229



>ref|XP_009107985.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=502

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             PTNWPV+GMLP LL +  RI++ +TELL  S  TF  KGPW +  D+L+T DPAN+ +I
Sbjct  33   LPTNWPVLGMLPGLLVHINRIYDAITELLEASNMTFCFKGPWLSGTDILITVDPANIRYI  92

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  NF NYPKG  F++IF VLG
Sbjct  93   LSSNFDNYPKGMEFKQIFEVLG  114


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 61/125 (49%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      D + NVDSELWE  R ++  + +H +F+         K+  G+ P+L
Sbjct  102  KGMEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQRFWVNTSVSKLNQGLVPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            E+  ++   VDLQ++FHR  FD S       D G L ++ P  +    +A+    + + Y
Sbjct  162  ENAVEKNIIVDLQDLFHRFLFDTSSILITGYDPGCLSIEMPKVNFS--DAVDGVADGLFY  219

Query  682  REILP  696
            R   P
Sbjct  220  RHAKP  224



>ref|XP_010555337.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=501

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  125  TNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILC  304
            TNWP +GMLP L+    R ++++ E+L  +G TF  KGPWF   D+L T DPAN+NHIL 
Sbjct  29   TNWPFLGMLPGLIVETPRFYDWIVEILEATGLTFHFKGPWFTRSDLLFTVDPANINHILS  88

Query  305  RNFQNYPKGPRFRKIFHVLGMG  370
             NF NYPKGP FR IF  LG G
Sbjct  89   SNFVNYPKGPDFRDIFEPLGDG  110


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 3/127 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N D +LW+  RK+   L++  +F+   +      ++N + PVL
Sbjct  96   KGPDFRDIFEPLGDGIFNADFDLWKDLRKSAHALLSRQDFQGFTKSTTVGVVKNRLLPVL  155

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +H  +  T VDLQ++F R +FD +       D  SL +D P  +  I  A+ D   AI +
Sbjct  156  DHADKTDTVVDLQDVFQRFTFDTTLTLVTGYDPKSLSMDMPHVELAI--AVEDAEEAIFH  213

Query  682  REILPEC  702
            R   P  
Sbjct  214  RHFRPRI  220



>emb|CDY44658.1| BnaA08g06820D [Brassica napus]
Length=502

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             PTNWPV+GMLP LL +  RI++ +TELL  S  TF  KGPW +  D+L+T DPAN+ +I
Sbjct  33   LPTNWPVLGMLPGLLVHINRIYDAITELLEASNMTFCFKGPWLSGTDILITVDPANIRYI  92

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  NF NYPKG  F++IF VLG
Sbjct  93   LSSNFDNYPKGMEFKQIFEVLG  114


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 0/99 (0%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      D + NVDSELWE  R ++  + +H +F+         K+  G+ P+L
Sbjct  102  KGMEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQRFWVNTSVSKLNQGLVPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD  621
            E+  ++   VDLQ++FHR  FD S       D G L ++
Sbjct  162  ENAVEKNIIVDLQDLFHRFLFDTSSILITGYDPGCLSIE  200



>ref|XP_010446495.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 68/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            I  +  C++  R     +    + PTNWP +GM+P +L    R++++VT++L  +  T+ 
Sbjct  9    ISIAFFCFLLFRYFLINKKPHRLCPTNWPFLGMIPGMLAEIHRVYDFVTDILEVTNLTYP  68

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
              GP F+  DMLVT DPAN++HI+  NF NYPKGP F+K+F VLG G
Sbjct  69   CVGPLFSGLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDVLGDG  115


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ N DS+LW+  RK+   +M +  F+         K+E G+ P+L
Sbjct  101  KGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQNMMMNPEFQKFSLATSLNKLEKGLVPLL  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H A +   VDLQ++F R +FD +F      D G L ++   +     A+ D   AI YR
Sbjct  161  DHAANEKLAVDLQDMFQRFTFDTTFVLATGYDPGCLSLE-MPEVEFARALDDAEEAIFYR  219

Query  685  EILPE  699
             + PE
Sbjct  220  HVKPE  224



>gb|EMT01938.1| Cytochrome P450 86A2 [Aegilops tauschii]
Length=489

 Score = 72.0 bits (175),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 12/108 (11%)
 Frame = +2

Query  65   LCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE---IK  235
            L W W      + SR    P  WP+VG LP LLQ+A  +HE++   LR +GGT++     
Sbjct  17   LAWFW------RMSRGLSGPRVWPLVGSLPGLLQHAEDMHEWIVGNLRRTGGTYQTCIFA  70

Query  236  GPWFANRDML--VTGDPANVNHILCRNFQNYPKGPRFRKIF-HVLGMG  370
             P  A R  L  VT DP N+ H+L   F NYPKGP +  +F  +LG G
Sbjct  71   VPGVARRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHGVFSDLLGDG  118


 Score = 62.8 bits (151),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 52/113 (46%), Gaps = 1/113 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          RT++ R VS+ + + M P+L   A  G HVDLQ
Sbjct  117  DGIFNSDGDTWVAQRKTAALEFTTRTLRTAMSRWVSRSIHHRMLPILSDAAASGAHVDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPEC  702
            ++  R++FD        KD  +L      ++    +      A L R I PEC
Sbjct  177  DLLLRLTFDNICGLAFGKDPETL-ARGLPENAFATSFDSATEATLNRFIFPEC  228



>ref|XP_010473620.1| PREDICTED: cytochrome P450 86A7-like [Camelina sativa]
Length=533

 Score = 80.9 bits (198),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 71/121 (59%), Gaps = 11/121 (9%)
 Frame = +2

Query  29   ESYVVVAILCSILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELL  205
            +  + V IL  I+ ++    IW    RRS   P  WP++G LPAL+ NA R+H+++ + L
Sbjct  2    DGSMAVIILTVIVTYL----IWFVSIRRSCKGPRVWPLLGSLPALITNAHRMHDFIADNL  57

Query  206  RESGGTFE---IKGPWFANRD--MLVTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGM  367
            R+ GGT++      P+ A +   + VT DP N+ HIL   F NYPKGP +  +FH +LG 
Sbjct  58   RKCGGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWHSVFHDLLGD  117

Query  368  G  370
            G
Sbjct  118  G  118


 Score = 53.5 bits (127),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R V + ++N + P+LE    +   +DLQ
Sbjct  117  DGIFNSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESSMSRAEPIDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L ++ P     +  A      A L R I+PE
Sbjct  177  DVLLRLTFDNICGLTFGKDPRTLSLEFPENGFAV--AFDGATEATLQRFIMPE  227



>ref|XP_010555338.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=564

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 71/104 (68%), Gaps = 1/104 (1%)
 Frame = +2

Query  59   SILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKG  238
            + +C++    +  K+S R V  TNWP++GMLP+L+    R++++  ++L  S  TF  KG
Sbjct  67   AFICFLIFGFLLFKKSNRDVL-TNWPILGMLPSLVVQIPRVYDWSVDVLEASNLTFLFKG  125

Query  239  PWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            PW A  D+LVT DPAN++HI+  NF+NYPKG  F+KIF VLG G
Sbjct  126  PWLAGMDLLVTVDPANIHHIMSSNFKNYPKGHEFKKIFDVLGDG  169


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 67/125 (54%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ NVDS+LW+  RK+   + NH +F+T   R    K+E G+ P+L
Sbjct  155  KGHEFKKIFDVLGDGIFNVDSDLWKDLRKSAQTMFNHQDFQTFTVRTSISKLEKGLLPLL  214

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H +     VDLQ++F R +FD +F      D G L ++   +    +A+ D   AI +R
Sbjct  215  DHVSGHDIVVDLQDVFQRFTFDTTFILMTGYDPGCLSLE-MPEIEFAKALDDAEEAIFFR  273

Query  685  EILPE  699
             I PE
Sbjct  274  HIKPE  278



>ref|XP_011100903.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=515

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +2

Query  128  NWPVVGMLPALLQNAGRIHEYVTELLRESG-GTFEIKGPWFANRDMLVTGDPANVNHILC  304
            NWPV+GMLP LL +  RIH+  TE++ +S  GTF  +GPW A+ DM+ T DP NV++I+ 
Sbjct  31   NWPVIGMLPTLLLHVSRIHDNCTEIMGKSRRGTFHFRGPWLADMDMMGTADPENVHYIMS  90

Query  305  RNFQNYPKGPRFRKIFHVLGMG  370
             NFQN+PKGP+FR+IF VLG G
Sbjct  91   ANFQNFPKGPKFREIFDVLGDG  112


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      DG+ N DSE W   R+    L++H  F   L +   +K+E G+ PVL
Sbjct  98   KGPKFREIFDVLGDGIFNADSESWRDQRRVARALISHHGFLRFLAKISREKVEKGLIPVL  157

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            E    +   VDLQ++F R++FD +       D G L VD   D P  +A+ D   AI  R
Sbjct  158  ETVCLENRVVDLQDLFQRLTFDTTCTFVTGYDPGCLSVD-LPDVPFSKALDDAEEAIFMR  216

Query  685  EILPE  699
             ++PE
Sbjct  217  HVVPE  221



>ref|XP_010416946.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +2

Query  101  RSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDP  280
            +    + P NWPV+GMLP +L    RI++YV E+L  S  TF  KGPWF+  +ML+T DP
Sbjct  25   KKHHQILPRNWPVLGMLPGVLIMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADP  84

Query  281  ANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            AN+ H+   NF NY KGP F++IF  LG G
Sbjct  85   ANIQHVFSSNFTNYDKGPEFKEIFDFLGNG  114


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 72/125 (58%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+   DS+LWE  RK+   +++H  F++   R +++K++NG+ PVL
Sbjct  100  KGPEFKEIFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRTITRKIKNGVVPVL  159

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +H+A+     DLQ++F R++FD++       D  SL ++ P  ++   +A+ D    ++Y
Sbjct  160  DHFAEANMIFDLQDVFQRLAFDVTLTLVAGYDSNSLSIEMPMNEYA--KAMDDAEEVVVY  217

Query  682  REILP  696
            R + P
Sbjct  218  RHVKP  222



>gb|KDP46408.1| hypothetical protein JCGZ_10248 [Jatropha curcas]
Length=510

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 7/119 (6%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYV  193
            M I     +V+A +  +  W+WAR     RS   ++   WPV GM+P LL NA RIH++ 
Sbjct  1    MGILGYGEIVLAFIFLVFLWVWARN----RSSPIIY---WPVFGMIPQLLWNASRIHDFS  53

Query  194  TELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            T +L+  GGTF +KGPWF++ D LVT D  N+++ L +NF NYPKG   ++IF  LG G
Sbjct  54   TYVLQCYGGTFLVKGPWFSDLDFLVTSDSMNIHYTLNKNFPNYPKGAESKEIFEPLGDG  112


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +1

Query  304  QKLPELSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKME  483
            +  P   +G+   E      DG++N D + W   R+          F  +++ ++ QK+ 
Sbjct  91   KNFPNYPKGAESKEIFEPLGDGILNSDCDSWRTQRRIIHSFFKDKRFELAIKTSIEQKIL  150

Query  484  NGMFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDG  663
             G+FPVLE+ ++    +D+QE+F R +FD S Q  L  D  SL ++   + PI + +   
Sbjct  151  KGLFPVLENASKLRNEIDIQEVFQRFTFDNSCQLVLGFDPNSLSIE-LPEVPIEKVLGGA  209

Query  664  VNAILYREILP  696
              A+LYR   P
Sbjct  210  EEALLYRHFYP  220



>gb|AAZ39642.1| cytochrome P450 fatty acid omega-hydroxylase [Petunia x hybrida]
Length=553

 Score = 83.2 bits (204),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 70/118 (59%), Gaps = 8/118 (7%)
 Frame = +2

Query  32   SYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRE  211
            + ++VAI+ + L W    +   K  +    PT WPVVG LP L++N  R+HE++ + LR 
Sbjct  6    TMMIVAIVAAYLLWF---KSITKSMKGPKGPTMWPVVGSLPGLIENGNRMHEWIADNLRA  62

Query  212  SGGTFEI---KGPWFANRDML-VTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
              GT++      P+ A + ++ VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  63   CSGTYQTCICAIPFLARKQLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGEG  120


 Score = 50.8 bits (120),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 53/112 (47%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ N D + W   RKT          R ++ R V++ ++N   P+LE    QG  VDLQ
Sbjct  119  EGIFNSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRAIKNRFCPILEMAQVQGKPVDLQ  178

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L  +   ++    +      A L+R I+PE
Sbjct  179  DLLLRLTFDNICGLAFGKDPETLSPE-LPENNFATSFDRATEATLHRFIMPE  229



>ref|XP_002465889.1| hypothetical protein SORBIDRAFT_01g047640 [Sorghum bicolor]
 gb|EER92887.1| hypothetical protein SORBIDRAFT_01g047640 [Sorghum bicolor]
Length=536

 Score = 80.5 bits (197),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 64/116 (55%), Gaps = 4/116 (3%)
 Frame = +2

Query  29   ESYVVVAILCSILCWI--WARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTEL  202
            E + +   L  +LC++  + R +  K++   + PT WP+VG LP L+ N    H++ T +
Sbjct  2    EPFFLFIELALVLCFLTLYYRHLQSKKTS-PLEPTEWPIVGHLPGLVANIHHFHDWATGV  60

Query  203  LRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            L  +G  FE +G     R   +T DP+NV HI   NF NYPKG  +  IF VLG G
Sbjct  61   LTGAGCNFEARGGRTGLR-YFITCDPSNVRHIFTSNFANYPKGEEYAVIFDVLGGG  115


 Score = 53.5 bits (127),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 50/115 (43%), Gaps = 7/115 (6%)
 Frame = +1

Query  367  GMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQ-QGTH---V  534
            G+ N D E W   R     LM    FR    R    K+E  + P L H+A  +G+     
Sbjct  115  GIFNADGESWRRQRVMAQMLMTGPRFRAFTARCSRDKVERSLLPFLAHHAADEGSSRPPC  174

Query  535  DLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILP  696
            DL ++F R++FD++       D G L V  P    P   A+ D +  +  R I P
Sbjct  175  DLHDVFLRLTFDMTCSLVFGVDPGCLAVGLPV--VPFARAMDDALETLFLRHITP  227



>ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 71/111 (64%), Gaps = 2/111 (2%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            +  AI  S+ C+++     ++RS +     ++P++GMLP +L N  RIH++ TE+L++ G
Sbjct  6    IYAAITASLFCFLYL--FHRRRSCKHPLMRDYPILGMLPPILFNLWRIHDFCTEVLKKQG  63

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GT E KGPWF     L+T D  NV H+LC++F NY KGP FR+IF   G G
Sbjct  64   GTGEFKGPWFTKMHYLITCDSLNVQHMLCKSFDNYIKGPEFREIFEPFGDG  114


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 61/124 (49%), Gaps = 1/124 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      DG++  DSE W+  R     L+    F T +++ V +K+   + P+L
Sbjct  100  KGPEFREIFEPFGDGVVTADSETWKYFRTVLHSLIKQRRFETFVDKTVQKKVHTSLLPIL  159

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H  QQG  VDLQ++F+R +FD      +  D   L +D   +  I  A  +   +I YR
Sbjct  160  DHVQQQGEMVDLQDVFNRFTFDNICSTIVGHDPKCLSID-FPEVAIERAFNESEESIFYR  218

Query  685  EILP  696
              +P
Sbjct  219  HTVP  222



>ref|XP_008373994.1| PREDICTED: cytochrome P450 86A8-like [Malus domestica]
Length=535

 Score = 83.2 bits (204),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 66/110 (60%), Gaps = 7/110 (6%)
 Frame = +2

Query  62   ILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEI--  232
            IL  I A  IW K   RS++ P  WPVVG LP L+QN  R+H+++ + LR   GT++   
Sbjct  9    ILSAIAAYLIWFKMISRSMYGPRVWPVVGSLPGLIQNVNRMHDWIADNLRACCGTYQTCT  68

Query  233  -KGPWFANRDML--VTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
               P+ A +  L  VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  69   CAIPFLARKQGLVTVTCDPKNLEHILKLRFDNYPKGPTWQAVFHDLLGDG  118


 Score = 50.8 bits (120),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 49/112 (44%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R VS+ +E    P+LE    +   VDLQ
Sbjct  117  DGIFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVSRAIELRFCPILETAQNEAKPVDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L      ++    A      A L R ILPE
Sbjct  177  DLLLRLTFDNICGLAFGKDPQTL-APGLPENEFANAFDRATEATLQRFILPE  227



>ref|XP_004982787.1| PREDICTED: cytochrome P450 86B1-like [Setaria italica]
Length=541

 Score = 85.5 bits (210),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +2

Query  89   IWKKRSRRSVFPTNWPVVGMLPALLQNA-GRIHEYVTELLRESGGTFEIKGPWFANRDML  265
            I   R RRS     WP+VGMLP+LL    G ++E++T +L+  GGTF  +GPWF N   +
Sbjct  48   IHSLRQRRSQGLPTWPLVGMLPSLLLGLRGDMYEWITGILKARGGTFTFRGPWFTNLHCV  107

Query  266  VTGDPANVNHILCRNFQNYPKGPRFRK-IFHVLGMG  370
            VT DP N+ H+L   F ++PKGP FR  +  +LG G
Sbjct  108  VTADPRNLEHLLKTRFGSFPKGPYFRDNVRDLLGDG  143


 Score = 48.5 bits (114),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 47/115 (41%), Gaps = 3/115 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+   D E+W   RK  +   +   FR     ++ + +   + PVL      G  VDLQ
Sbjct  142  DGIFGADDEVWRRQRKAASLEFHSAEFRALTASSLVELVHRRLLPVLADAEAGGGAVDLQ  201

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPT-GDHPILEAIRDGVNAILYREILPECC  705
            ++  R++FD         D G  C+ P   + P   A  D   A + R + P   
Sbjct  202  DVLLRLTFDNVCMIAFGVDPG--CIRPGLPEIPFARAFEDATEATIVRFLTPTAV  254



>emb|CDY32582.1| BnaC03g15500D [Brassica napus]
Length=435

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +2

Query  110  RSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANV  289
            ++ FPTNWPV+GMLP LL    RIH+++T++L  +  TF +KGPW +  D+LVT DP NV
Sbjct  30   QTPFPTNWPVLGMLPGLLLQIHRIHDWLTQVLEAANMTFRLKGPWGSGTDILVTVDPVNV  89

Query  290  NHILCRNFQNYPKGPRFRKIFHVLGMG  370
            ++IL  +F NYPKG  F+KIF  LG G
Sbjct  90   HYILSSHFVNYPKGEEFQKIFEFLGDG  116


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ NVDS LWE  R ++  + +H +FR+        K+  G+ P+L
Sbjct  102  KGEEFQKIFEFLGDGIFNVDSGLWEEMRNSSHAIFSHQDFRSFSVSTSVSKLRQGLVPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDIS  576
            E+ +++   VDLQ++F R  FD S
Sbjct  162  ENASEKNILVDLQDLFQRFLFDTS  185



>ref|XP_009778171.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=244

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ NVD ELWE HRKTT  +M+H  F+T LERN+    E G+ P+   +A+QG  +DLQ
Sbjct  7    NGIFNVDHELWEFHRKTTLSIMSHAKFQTLLERNMWYTFEKGLQPIFYAFAEQGKTLDLQ  66

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPECC  705
            ++F R +FD   +  LD D  SL +D     P  +A  D ++A+L+R I+PE C
Sbjct  67   DVFQRFTFDSITKLLLDHDPRSLSIDLPF-LPYEKAFGDALDAVLHRHIMPESC  119



>ref|XP_007019556.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY16781.1| Cytochrome P450 [Theobroma cacao]
Length=517

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 77/121 (64%), Gaps = 2/121 (2%)
 Frame = +2

Query  8    YTMRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHE  187
            YT+++   +Y+   IL  I+ +    + + ++++    P NWP++GMLP +L N  R+ +
Sbjct  6    YTIKMAIFAYLEFLILPVIILFFIVLRCYSRKNKD--LPWNWPIIGMLPMILTNWHRLAD  63

Query  188  YVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGM  367
              TE+L  SGGTF +KG WF N D+++T DPANV+HIL  NF  YPKG  ++K F V G 
Sbjct  64   RCTEILESSGGTFTLKGFWFVNMDLIITSDPANVHHILSSNFSMYPKGVEWKKRFDVFGS  123

Query  368  G  370
            G
Sbjct  124  G  124



>ref|XP_007040281.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 [Theobroma 
cacao]
 gb|EOY24782.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 [Theobroma 
cacao]
Length=541

 Score = 81.3 bits (199),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 66/110 (60%), Gaps = 7/110 (6%)
 Frame = +2

Query  62   ILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEI--  232
            IL  I A  +W K   RS+  P  WP++G LP L+QN+  +HE++ E LR  GGT++   
Sbjct  9    ILSAIAAYLVWFKLITRSLHGPRVWPLLGSLPGLIQNSNCMHEWIAENLRACGGTYQTCI  68

Query  233  -KGPWFANRDML--VTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
               P+ A +  L  VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  69   SAIPFLARKQGLVTVTCDPKNLEHILKGRFDNYPKGPNWQAVFHDLLGDG  118


 Score = 52.4 bits (124),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (46%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R VS+ +++   P+LE    QG  VDLQ
Sbjct  117  DGIFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVSRAIKHRFCPILETAQLQGKPVDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L      ++    A      A L R ILPE
Sbjct  177  DLLLRLTFDNICGLTFGKDPQTLSPG-LPENGFAMAFDRATEATLQRFILPE  227



>ref|XP_002523775.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38624.1| cytochrome P450, putative [Ricinus communis]
Length=550

 Score = 74.3 bits (181),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = +2

Query  41   VVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALL-QNAGRIHEYVTELLRESG  217
            V+ +  ++  +I    + +K+  R   P  WPV+GMLP+++      ++E+++++L    
Sbjct  38   VLELFLALFVFISIHSLRQKK--RYGLPV-WPVLGMLPSMIFALQSNLYEWISDVLCRQN  94

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRK-IFHVLGMG  370
            GTF  +GPWF++ + +VT DP N+ H+L   F N+PKG  FR  +  +LG G
Sbjct  95   GTFRFRGPWFSSLNCVVTADPRNLEHLLKSKFSNFPKGQYFRDTVRDLLGDG  146


 Score = 59.3 bits (142),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (48%), Gaps = 1/113 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D E+W+  RKT +   +   FR    +++ + + + + PVLE+       +DLQ
Sbjct  145  DGIFNADDEMWQRQRKTASIEFHSTKFRQLTTKSLLELVHSRLLPVLENAVNNSITIDLQ  204

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPEC  702
            +I  R++FD         D G L +D   + P   A  D   A + R + P C
Sbjct  205  DILLRLTFDNVCMIAFGVDPGCLNLD-LPEIPFARAFEDATEATVLRFVTPTC  256



>ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40964.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 71/112 (63%), Gaps = 8/112 (7%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALL-QNAGRIHEYVTELLRES  214
            + +A+L  I   +W R        R +  TNWPVVGM+P LL +    +H++ T +L+ S
Sbjct  7    MAIALLSIIFLRVWWRS-------RGLVVTNWPVVGMIPGLLFRPISSVHDFATYVLQRS  59

Query  215  GGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            GGT   +GPWF+  + L+T DP NV +I+ +NF NYPKGP FR+IF VLG G
Sbjct  60   GGTLLFQGPWFSGMNFLMTSDPMNVQYIVSKNFANYPKGPDFRQIFEVLGDG  111


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 1/124 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ NVDS+ W + R+    L+    F  ++ER V  K+  G+F VL
Sbjct  97   KGPDFRQIFEVLGDGIFNVDSDSWRIQRRIMHSLLKSKRFHLAVERTVEHKILKGLFVVL  156

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            ++ ++  + VD+Q++F R +FD      L  D  SL ++     P  +A  D   A+LYR
Sbjct  157  DNVSELASEVDIQDVFQRFTFDSICILALSYDPDSLSIE-FPHVPFAKAFDDIEEAVLYR  215

Query  685  EILP  696
             ++P
Sbjct  216  YLVP  219



>ref|XP_010472325.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=282

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +2

Query  101  RSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDP  280
            +  RS F TNW  +GMLP  L    R+++Y+TELL  S  T+  KGP F N DML T DP
Sbjct  61   KQHRS-FLTNWLFLGMLPGFLMEIPRVYDYMTELLEASNLTYLFKGPCFGNLDMLFTVDP  119

Query  281  ANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            AN++HI+  NF NYPKG  F+K+F VLG G
Sbjct  120  ANIHHIMSSNFANYPKGSEFKKLFDVLGDG  149


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 62/127 (49%), Gaps = 1/127 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F +      DG+ N DSELW+  RK+   +M +  ++    R    K+E G+ P L
Sbjct  135  KGSEFKKLFDVLGDGIFNADSELWKDLRKSAQSIMRNPEYQRFTLRTSMSKLEKGLVPFL  194

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
             H A++   VDLQ++F R +FD +F      D G L  +   +     A+ +   AI +R
Sbjct  195  NHVAEKKLVVDLQDLFQRFTFDTTFVLATGIDPGCLSTE-MPEIEFARALDEAEEAIFFR  253

Query  685  EILPECC  705
               PE  
Sbjct  254  HFKPEMV  260



>ref|XP_010473744.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  110  RSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANV  289
              + P NWPV+GMLP +L    RI++YV E+L  S  TF  KGPWF+  +ML+T DPAN+
Sbjct  28   HQILPRNWPVLGMLPGVLAMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANI  87

Query  290  NHILCRNFQNYPKGPRFRKIFHVLGMG  370
             H+   NF NY KGP F+++F  LG G
Sbjct  88   QHVFSSNFTNYDKGPEFKEMFDFLGNG  114


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 72/125 (58%), Gaps = 3/125 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F E      +G+   DS+LWE  RK+   +++H  F++   R +++K+ENG+ PVL
Sbjct  100  KGPEFKEMFDFLGNGIFTADSKLWENMRKSALVVLSHQGFQSFSLRTITRKIENGVVPVL  159

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILY  681
            +H+A+     DLQ++F R++FD++       D  SL ++ P  ++   +A+ D    ++Y
Sbjct  160  DHFAEANMIFDLQDVFQRLAFDVTLTLVAGYDSNSLSIEMPMNEYA--KAMDDAEEVVVY  217

Query  682  REILP  696
            R + P
Sbjct  218  RHVKP  222



>gb|KEH40822.1| cytochrome P450 family protein [Medicago truncatula]
Length=512

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 8/120 (7%)
 Frame = +2

Query  14   MRIFKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYV  193
            M +F+   + VAIL  I  +IW       R  ++V  TNWP++GMLP +L N   +H++V
Sbjct  1    MTLFQYITLFVAILLVIFYYIW-------RRNQNVLVTNWPIIGMLPFVLHNQSNLHDFV  53

Query  194  TELLRESGGTFEIKGPWFAN-RDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            T  L+   GTF  KGPWF N  + ++T D  NV+HI  +NF NY KG  F +IF VLG+G
Sbjct  54   TLGLKLCRGTFHFKGPWFTNIANFILTSDHLNVHHITSKNFSNYGKGTDFHEIFDVLGVG  113


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +1

Query  322  SQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPV  501
             +G+ F E       G++N+D E W+  R     L+   +F  S ++N+ +K+EN +   
Sbjct  98   GKGTDFHEIFDVLGVGILNLDFEEWKQERTLLHSLLKGKSFEISFQQNIQKKLENFLLRF  157

Query  502  LEHYAQQGTHVDLQEIFHRISFDIS  576
            L+H ++    +DLQ+I  R +FDI+
Sbjct  158  LDHASKSVQVLDLQDILERFTFDIT  182



>ref|NP_176558.1| cytochrome P450, family 86, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
 sp|Q9CAD6.1|C86A7_ARATH RecName: Full=Cytochrome P450 86A7 [Arabidopsis thaliana]
 gb|AAG52424.1|AC011622_12 putative cytochrome P450; 34849-36420 [Arabidopsis thaliana]
 gb|AEE34136.1| cytochrome P450, family 86, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
Length=523

 Score = 80.9 bits (198),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = +2

Query  62   ILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE---  229
            IL  I    IW    RRS   P  WP+VG LPAL+ NA R+H+++ + LR  GGT++   
Sbjct  9    ILTLIVTYIIWFVSLRRSYKGPRVWPLVGSLPALITNAHRMHDFIADNLRMCGGTYQTCI  68

Query  230  IKGPWFANRD--MLVTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
               P+ A +   + VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  69   FPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDG  118


 Score = 52.0 bits (123),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R V + ++N + P+LE    +   +DLQ
Sbjct  117  DGIFNSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESARSRAEPIDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L  + P     +  A      A L R I+PE
Sbjct  177  DVLLRLTFDNICGLTFGKDPRTLSPEFPENGFAV--AFDGATEATLQRFIMPE  227



>gb|AHF22086.1| CYP96A68 [Maesa lanceolata]
Length=465

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  146  MLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYP  325
            MLP  + +  +IH+   E+L+++ GT  +KG WF N D L+T DP N ++IL  NF NYP
Sbjct  1    MLPFSIIHFNQIHDKFVEILKKNDGTVILKGLWFTNTDKLLTSDPTNAHYILSTNFANYP  60

Query  326  KGPRFRKIFHVLG  364
            KGP  ++IF V G
Sbjct  61   KGPLSKRIFQVQG  73


 Score = 56.6 bits (135),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 55/112 (49%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            D + N D E W++HRKT     N      +  + V   +E G+ P L+H ++QG  VDLQ
Sbjct  74   DFLFNSDHEEWKIHRKTMRAFFNDRRCMEATVKVVRDSIEKGLIPFLDHVSKQGMVVDLQ  133

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++F R+  D +       +  SL +    + P+  A+    + +  R ++PE
Sbjct  134  DLFTRLMLDSTCTLATGYNPSSLSIG-FPETPLATAMDIANDTVFQRNLIPE  184



>gb|AAM65207.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=523

 Score = 80.9 bits (198),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = +2

Query  62   ILCWIWARQIWKKRSRRSVF-PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE---  229
            IL  I    IW    RRS   P  WP+VG LPAL+ NA R+H+++ + LR  GGT++   
Sbjct  9    ILTLIVTYIIWFVSLRRSYKGPRVWPLVGSLPALITNAHRMHDFIADNLRMCGGTYQTCI  68

Query  230  IKGPWFANRD--MLVTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
               P+ A +   + VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  69   FPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDG  118


 Score = 52.0 bits (123),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 3/113 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D + W   RKT          R ++ R V + ++N + P+LE    +   +DLQ
Sbjct  117  DGIFNSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESARSRAEPIDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L  + P     +  A      A L R I+PE
Sbjct  177  DVLLRLTFDNICGLTFGKDPRTLSPEFPENGFAV--AFDGATEATLQRFIMPE  227



>emb|CDY39931.1| BnaA09g15130D [Brassica napus]
Length=485

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = +2

Query  98   KRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGD  277
            K+S       NWP +GMLP +L N  RI ++++E+   +  TF  KGPWF+  DML T D
Sbjct  26   KKSHNVALLKNWPFLGMLPGVLFNLPRIFDWLSEVHEANDMTFAFKGPWFSGTDMLFTVD  85

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            P NVNH+L  NF NYP+GP FRKIF +LG G
Sbjct  86   PRNVNHMLSSNFPNYPRGPEFRKIFDILGDG  116


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +1

Query  310  LPELSQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENG  489
             P   +G  F +      DG++  D ELWE  RK+   L +H NF        + K+++ 
Sbjct  97   FPNYPRGPEFRKIFDILGDGIVAADMELWEDLRKSGHALFHHQNFLELSLSCTTSKLKDH  156

Query  490  MFPVLEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD  621
            + P L+  A++   +DLQ++F R  FD +       D  SL ++
Sbjct  157  LVPYLDKAAEENIVIDLQDVFKRFMFDTASILMTGYDQMSLSIE  200



>ref|XP_007150923.1| hypothetical protein PHAVU_004G006000g [Phaseolus vulgaris]
 gb|ESW22917.1| hypothetical protein PHAVU_004G006000g [Phaseolus vulgaris]
Length=494

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  125  TNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHILC  304
            T++P++GMLP LL N  R H++ TE+L+E GGT E  GPWF N + L T DP NV H++ 
Sbjct  34   TDYPILGMLPQLLFNLSRFHDFFTEILKEKGGTGEFTGPWFTNMNYLFTSDPLNVRHVMS  93

Query  305  RNFQNYPKGPRFRKIFHVLGMG  370
             +F NY KGP FR IF VLG G
Sbjct  94   TSFHNYVKGPVFRDIFEVLGEG  115


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 63/126 (50%), Gaps = 1/126 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      +G+   DSE W+ +R     L     F   LE+ + +K++N + PVL
Sbjct  101  KGPVFRDIFEVLGEGIAATDSEAWKYNRDLIHYLFKQKKFEVFLEKTIHKKIKNSLLPVL  160

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H  QQG+ VDLQ++F+R +FD         D   L VD   +  I +A  D    I  R
Sbjct  161  DHVHQQGSVVDLQDLFNRFTFDNLCYSVNGHDPNCLSVD-FPEVEIEKAFNDAGETIFRR  219

Query  685  EILPEC  702
             ++P+C
Sbjct  220  HVVPKC  225



>ref|XP_010417073.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Camelina sativa]
 ref|XP_010417074.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Camelina sativa]
Length=514

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +2

Query  98   KRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGD  277
            K+  RS F T+WP+VGMLP LL    RI++Y+TELL  S  T+  KGP     DMLVT D
Sbjct  27   KKPHRS-FMTDWPIVGMLPGLLVEIPRIYDYLTELLEASNLTYPFKGPCSGGLDMLVTID  85

Query  278  PANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            PAN+++I+  NF NYPKG  FRK+F VLG G
Sbjct  86   PANIHYIMSSNFANYPKGSEFRKLFDVLGDG  116


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 69/128 (54%), Gaps = 7/128 (5%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F +      DG+ N DSELW+  RK+   +M+H +F+    R    K+E G+ P+L
Sbjct  102  KGSEFRKLFDVLGDGIFNADSELWKDLRKSAEGMMSHPDFQRFTVRTSMSKLEKGLVPLL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE---AIRDGVNAI  675
            +  AQ+   VDLQ++F R +FD SF      D G L    + + P +E   A+ +   AI
Sbjct  162  DCVAQKKLVVDLQDVFQRFTFDNSFVLATGVDPGCL----STEMPKIEFARALDEAEEAI  217

Query  676  LYREILPE  699
             +R + PE
Sbjct  218  FFRHVKPE  225



>ref|XP_007019555.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY16780.1| Cytochrome P450 [Theobroma cacao]
Length=507

 Score = 72.4 bits (176),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +2

Query  128  NWPVVGMLPALLQNAGRIHEYVTELLRESGGT-FEIKGPWFANRDMLVTGDPANVNHILC  304
             WPVV  LP  ++   + H++  ++L  SGGT   +K  WF N D  +T +PANV HI+ 
Sbjct  34   QWPVVAKLPQFVRRYCQFHDWSAQILERSGGTCLVVKNLWFVNMDNWLTSNPANVQHIMS  93

Query  305  RNFQNYPKGPRFRKIFHVLG  364
            ++F  YPKG  +RK F + G
Sbjct  94   KSFTKYPKGIDWRKRFDIFG  113


 Score = 60.5 bits (145),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 54/113 (48%), Gaps = 1/113 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            D + N DS  W+  R      +NH  F   + +     ME  + P+LEH ++Q   V LQ
Sbjct  114  DSVFNSDSVKWKYERALYKGFLNHQRFHELMPKIFEDSMEKQLIPILEHVSKQHVPVALQ  173

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPEC  702
            ++  +  F  S +     DLG L    + +H   +AI +   AI +R +LPEC
Sbjct  174  DLLGKHIFYFSCRMTTGCDLG-LFQSSSHEHLFAKAIVNACEAISFRYLLPEC  225



>ref|XP_006411749.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
 gb|ESQ53202.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
Length=517

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  122  PTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHIL  301
            PTNWP +GM+P LL    R++++VT++L  +  T+   GP FA  DMLVT DPAN++HI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFVTDILEVTNLTYPCIGPCFAGLDMLVTVDPANIHHIM  92

Query  302  CRNFQNYPKGPRFRKIFHVLGMG  370
              NF NYPKGP F+K+F VLG G
Sbjct  93   SSNFSNYPKGPEFKKLFDVLGDG  115


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 3/126 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNF-RTSLERNVSQKMENGMFPV  501
            +G  F +      DG+ N DSELW+  RK+   +M +  F R SL  ++S K+E G+ P+
Sbjct  101  KGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQRFSLATSLS-KLEKGLVPL  159

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILY  681
            L+H A +   VDL+++F R +FD +       D G L V+   +     A+ D   AI +
Sbjct  160  LDHVANEKLVVDLEDVFSRFTFDTTCVLATGYDPGCLSVE-MPEIEFARALDDAEEAIFF  218

Query  682  REILPE  699
            R I PE
Sbjct  219  RHIKPE  224



>emb|CDY13727.1| BnaA06g31960D [Brassica napus]
Length=463

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = +2

Query  44   VAILC-SILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGG  220
            +A +C  I+C++     + K+   S   TNWP++GMLP L     R++++  ELL  S  
Sbjct  1    MAFICIPIVCFLILLHFFIKKPNMSFITTNWPLIGMLPGLFMVLHRVYDFTVELLESSNL  60

Query  221  TFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVL  361
            TF+ KGPW +  DML T DPAN++++L  NF NY KGP F++IF V 
Sbjct  61   TFQFKGPWLSGMDMLATVDPANIHYMLSSNFLNYNKGPEFKEIFDVF  107


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 68/125 (54%), Gaps = 1/125 (1%)
 Frame = +1

Query  322  SQGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPV  501
            ++G  F E      D + NVD+ELW   RK    ++ H  F         +K++NG+ PV
Sbjct  95   NKGPEFKEIFDVFEDVIFNVDAELWYNSRKAAEGILRHQGFPRVSMSATRRKLKNGLVPV  154

Query  502  LEHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILY  681
             +H+A++G  ++LQ++F R +FD S       D  +L +D   ++   +A+ + ++ ILY
Sbjct  155  FDHFAKEGMVMNLQDVFRRFTFDTSMGLITGSDPTTLSID-MPENEFYKALTEAIDGILY  213

Query  682  REILP  696
            R+I P
Sbjct  214  RKIKP  218



>dbj|BAD94304.1| cytochrome p450 - like protein [Arabidopsis thaliana]
Length=506

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 71/109 (65%), Gaps = 5/109 (5%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESG  217
            V VAILC ++   +   ++KK   R  +P NWPV+ MLPA+L+   RI++Y  E+L  S 
Sbjct  9    VSVAILCFLILHYF---LFKKPHGR--YPRNWPVLRMLPAMLKALHRIYDYSVEILETSD  63

Query  218  GTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLG  364
             TF  KGP F   DML+T DPAN++HI+  NF NY KGP F+ +F VLG
Sbjct  64   LTFPFKGPRFTGMDMLLTVDPANIHHIMSSNFSNYIKGPEFQDVFDVLG  112


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 63/124 (51%), Gaps = 1/124 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      D  I  DSELW+  RK+   +++   F+      ++ K++ G+ P+L
Sbjct  100  KGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAMLHSQEFQRFSMSTMTSKLKYGLVPLL  159

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
             H+A++GT +DLQ +F R +FD  F      D  SL ++   D    +A+ D    ILYR
Sbjct  160  NHFAEEGTTLDLQSVFGRFTFDTIFILVTGSDPRSLSIEMPEDE-FAKALDDVGEGILYR  218

Query  685  EILP  696
               P
Sbjct  219  HFKP  222



>ref|XP_002275905.2| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=522

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +2

Query  50   ILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE  229
            IL +++ +I   + W         P NWP++GM P++  +  RIH+ VT++L +SG TF 
Sbjct  24   ILLAVIFFIILGRFWNIND----LPWNWPLLGMFPSVFLHLHRIHDRVTDILEKSGCTFL  79

Query  230  IKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            +KGPWF N D+LVT DPANV++I+  +F N+PKG  F KIF  LG G
Sbjct  80   VKGPWFCNMDLLVTTDPANVHYIMSSHFSNFPKGSEFSKIFDFLGDG  126


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (52%), Gaps = 2/126 (2%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +GS F +      DG+ N D+E W   RK    ++N+      L +    K+E G+ P+L
Sbjct  112  KGSEFSKIFDFLGDGIFNSDAESWRKQRKLGQLMINNVRLYRFLGKITQNKVEKGLLPIL  171

Query  505  EHYA-QQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILY  681
            ++ + Q+   +DLQ++F R++FD +       D   L ++   + P   A+ D   AIL+
Sbjct  172  DYLSEQEDRAMDLQDVFQRLTFDTTCMLVTGFDSKCLSIE-LPEVPFATALEDAEEAILH  230

Query  682  REILPE  699
            R +LPE
Sbjct  231  RHVLPE  236



>emb|CDX72698.1| BnaC07g47200D [Brassica napus]
Length=449

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  119  FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPANVNHI  298
             PTNW V+GMLP LL    RI++++TELL  +G TF  KGPW +  D+L+T DP N+++I
Sbjct  33   LPTNWSVLGMLPGLLLQVHRIYDWITELLEATGMTFCFKGPWLSGTDILLTVDPVNIHYI  92

Query  299  LCRNFQNYPKGPRFRKIFHVLG  364
            L  NF NYPKG  F+KIF V+G
Sbjct  93   LSSNFVNYPKGMEFKKIFEVIG  114


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 60/126 (48%), Gaps = 5/126 (4%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      D + N+DS +WE  R ++  + +  +F+         K+  G+ P+L
Sbjct  102  KGMEFKKIFEVIGDAIFNIDSGMWEDMRNSSHAIFSRQDFQRLWVSTSVSKINQGLVPIL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVD-PTGDHPILEAIRDGV-NAIL  678
            ++  ++   VDLQ++F R  FD S       DL  L ++ P  D        DGV +AI 
Sbjct  162  DNAVEKNILVDLQDVFQRFLFDTSTILMTGYDLKCLSIEMPKVD---FGGAVDGVSDAIF  218

Query  679  YREILP  696
            YR + P
Sbjct  219  YRHVKP  224



>emb|CBI34653.3| unnamed protein product [Vitis vinifera]
Length=1462

 Score = 84.3 bits (207),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 65/106 (61%), Gaps = 7/106 (7%)
 Frame = +2

Query  74   IWARQIWKKRSRRSV-FPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEI---KGP  241
            I A  IW +   RS+  P  WPVVG LP L+QNA R+HE++ E LR  GGT++      P
Sbjct  140  ITAYLIWFRSITRSLKGPRVWPVVGSLPLLIQNANRMHEWIAENLRSCGGTYQTCICPIP  199

Query  242  WFANRDML--VTGDPANVNHILCRNFQNYPKGPRFRKIFH-VLGMG  370
            + A +  L  VT DP N+ HIL   F NYPKGP ++ +FH +LG G
Sbjct  200  FLARKQGLVTVTCDPKNLEHILKIRFDNYPKGPTWQAVFHDLLGEG  245


 Score = 48.1 bits (113),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 50/112 (45%), Gaps = 1/112 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            +G+ N D E W   RKT          R ++ R V++ ++    P+L+    +G  VDLQ
Sbjct  244  EGIFNSDGETWRFQRKTAALEFTTRTLRQAMARWVTRAIKLRFCPILKKAQLEGKPVDLQ  303

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPE  699
            ++  R++FD        KD  +L      ++    A      A L R ILP+
Sbjct  304  DLLLRLTFDNICGLAFGKDPQTLA-PGLPENSFATAFDRATEATLQRFILPD  354



>ref|XP_011070444.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Sesamum 
indicum]
Length=652

 Score = 81.3 bits (199),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 62/94 (66%), Gaps = 4/94 (4%)
 Frame = +2

Query  95   KKRSRRSVFPTNWPVVGMLPAL-LQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVT  271
            +++SR+ +   NWPV+GMLP+L L   G ++E+++E+L    GTF  KGPWF N + +VT
Sbjct  82   RQKSRQGL--PNWPVLGMLPSLMLALRGDMYEWISEVLNRQNGTFTFKGPWFTNLNCVVT  139

Query  272  GDPANVNHILCRNFQNYPKGPRFRK-IFHVLGMG  370
             DP N+ ++L   F N+PKG  FR  +  +LG G
Sbjct  140  SDPRNLEYLLKTKFSNFPKGAYFRDTVRDLLGDG  173


 Score = 51.2 bits (121),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 51/112 (46%), Gaps = 3/112 (3%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ + D E+W+  RKT +   +   FR     ++ + + + + PVLE   Q+   +DLQ
Sbjct  172  DGIFSADDEIWQRQRKTASLEFHSAKFRQMTTDSLLELVHSRLLPVLEESVQKSARIDLQ  231

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDP-TGDHPILEAIRDGVNAILYREILP  696
            +I  R++FD         D G  C+ P   + P   A      A   R + P
Sbjct  232  DILLRLTFDNVCMIAFGVDPG--CLRPGLPEIPFASAFEAATEATTARFVTP  281



>gb|KDP33058.1| hypothetical protein JCGZ_13644 [Jatropha curcas]
Length=547

 Score = 75.1 bits (183),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 69/118 (58%), Gaps = 5/118 (4%)
 Frame = +2

Query  23   FKESYVVVAILCSILCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNA-GRIHEYVTE  199
            F +   ++ ++ +IL +I    +  K+  R   P  WPV+GMLP+L+      ++E++++
Sbjct  30   FLQDIQILELILAILVFIAIHSLRHKK--RYGLPV-WPVLGMLPSLVFGLRSNMYEWISD  86

Query  200  LLRESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIF-HVLGMG  370
            +L +  GTF  +GPWF++ + +VT DP N+ H+L   F  +PKG  FR     +LG G
Sbjct  87   VLCQQNGTFRFRGPWFSSLNCVVTADPRNIEHLLKTRFTYFPKGQYFRDTLRDLLGDG  144


 Score = 57.4 bits (137),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 52/113 (46%), Gaps = 1/113 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D E W+  RKT +   +   FR     ++++ + + + PVLE+ A     +DLQ
Sbjct  143  DGIFNADDETWQRQRKTASIEFHSAKFRKLTTESLNELVHSRLLPVLENAANDFISIDLQ  202

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPEC  702
            +I  R++FD         D G L +      P   A  D   A + R + P C
Sbjct  203  DILLRLTFDNVCMIAFGVDPGCLSLG-LSQIPFARAFEDATQATVLRFVTPTC  254



>ref|XP_004955136.1| PREDICTED: cytochrome P450 86A2-like [Setaria italica]
Length=455

 Score = 69.7 bits (169),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 59/108 (55%), Gaps = 12/108 (11%)
 Frame = +2

Query  65   LCWIWARQIWKKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFE---IK  235
            + W W      + SR    P  WPV+G LP L+Q+A  +HE++   LR +GGT++     
Sbjct  17   MAWFW------RLSRGLSGPRVWPVLGSLPGLVQHAEDMHEWIVGNLRRTGGTYQTCIFA  70

Query  236  GPWFANRDML--VTGDPANVNHILCRNFQNYPKGPRFRKIF-HVLGMG  370
             P  A R  L  VT DP N+ H+L   F NYPKGP +  +F  +LG G
Sbjct  71   VPGVARRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDG  118


 Score = 62.8 bits (151),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 53/113 (47%), Gaps = 1/113 (1%)
 Frame = +1

Query  364  DGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVLEHYAQQGTHVDLQ  543
            DG+ N D E W   RKT          RT++ R VS+ +   + P+L+  A + THVDLQ
Sbjct  117  DGIFNSDGETWVAQRKTAALEFTTRTLRTAMSRWVSRSIHLRLLPILDEAANEKTHVDLQ  176

Query  544  EIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYREILPEC  702
            ++  R++FD        KD  +L      ++    A      A L R I PEC
Sbjct  177  DLLLRLTFDNICGLAFGKDPETL-APGLPENAFASAFDRATEATLNRFIFPEC  228



>emb|CDY38915.1| BnaA03g12640D [Brassica napus]
Length=232

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = +2

Query  38   VVVAILCSILCWIWARQIW---KKRSRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLR  208
            +++ +L  I+ +I+   ++        ++ F TNWPV+GMLP LL    RIH+++T++L 
Sbjct  3    MIIGLLDIIIAFIFFLVLYCLFLHMRTQTPFLTNWPVLGMLPGLLLQIHRIHDWLTQVLE  62

Query  209  ESGGTFEIKGPWFANRDMLVTGDPANVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
             +  TF +KGPW +  D+LVT DP NV++IL  +F NYPKG  F+KIF  LG G
Sbjct  63   AANMTFRLKGPWRSGTDILVTVDPVNVHYILSSHFVNYPKGEEFQKIFEFLGDG  116


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 7/127 (6%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G  F +      DG+ NVDS LWE  R ++  + ++ +F++        K+  G+ PVL
Sbjct  102  KGEEFQKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSNKDFQSFSVSTSVSKIRQGLVPVL  161

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILE---AIRDGVNAI  675
            E+ +++   VDLQ++F R  FD S       D GSL +    + P +E   A+   V+ I
Sbjct  162  ENASEKNILVDLQDLFQRFLFDTSSILMTGYDPGSLSI----EMPKVEFGAAVEGVVDGI  217

Query  676  LYREILP  696
             YR I P
Sbjct  218  FYRHIKP  224



>ref|XP_002279531.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=507

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  104  SRRSVFPTNWPVVGMLPALLQNAGRIHEYVTELLRESGGTFEIKGPWFANRDMLVTGDPA  283
            S++ V P NWP+VGM   LL +  RIH+   E+L ++G TF  KGPWF N DML T DPA
Sbjct  24   SKKGV-PWNWPIVGMFAGLLFHVHRIHDEAAEILEKTGCTFLFKGPWFCNMDMLGTTDPA  82

Query  284  NVNHILCRNFQNYPKGPRFRKIFHVLGMG  370
            NV++I+  NF N+PKG  FRK+F VLG G
Sbjct  83   NVHYIMSSNFSNFPKGTEFRKMFEVLGDG  111


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 64/125 (51%), Gaps = 1/125 (1%)
 Frame = +1

Query  325  QGSSFPENISRPRDGMINVDSELWELHRKTTTPLMNHDNFRTSLERNVSQKMENGMFPVL  504
            +G+ F +      DG+ N D E W   RK    ++N+  F   L +    K+E G+ P+L
Sbjct  97   KGTEFRKMFEVLGDGIFNADGESWRNQRKLGQSMINNPRFHRFLAKVTYNKVEKGLVPLL  156

Query  505  EHYAQQGTHVDLQEIFHRISFDISFQQFLDKDLGSLCVDPTGDHPILEAIRDGVNAILYR  684
            +H ++QG  VDLQ++F R++FD +       D   L ++   + P   A+ D   A+ YR
Sbjct  157  DHLSEQGRVVDLQDVFQRLTFDTTCMLVTGFDTKCLSIE-FPEVPFATALEDVEEAVFYR  215

Query  685  EILPE  699
              LPE
Sbjct  216  HALPE  220



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350