BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024B21

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004228627.1|  PREDICTED: uncharacterized oxidoreductase C2...    189   1e-54   Solanum lycopersicum
ref|XP_009588958.1|  PREDICTED: uncharacterized protein YMR315W         187   2e-54   Nicotiana tomentosiformis
ref|XP_009773348.1|  PREDICTED: uncharacterized protein LOC104223588    185   2e-53   Nicotiana sylvestris
ref|XP_006348416.1|  PREDICTED: uncharacterized protein YMR315W-like    185   3e-53   Solanum tuberosum [potatoes]
ref|XP_010651283.1|  PREDICTED: uncharacterized protein LOC100245...    167   5e-47   Vitis vinifera
ref|XP_010651284.1|  PREDICTED: uncharacterized protein LOC100245...    167   5e-47   
emb|CBI16434.3|  unnamed protein product                                168   8e-47   Vitis vinifera
ref|XP_008449757.1|  PREDICTED: uncharacterized protein YMR315W         167   1e-46   
ref|XP_002285606.1|  PREDICTED: uncharacterized protein LOC100245...    167   1e-46   Vitis vinifera
ref|XP_002513445.1|  oxidoreductase, putative                           165   1e-45   Ricinus communis
gb|KCW51233.1|  hypothetical protein EUGRSUZ_J00813                     162   1e-45   Eucalyptus grandis [rose gum]
emb|CDP14087.1|  unnamed protein product                                164   3e-45   Coffea canephora [robusta coffee]
ref|XP_010031848.1|  PREDICTED: uncharacterized protein YMR315W         162   1e-44   Eucalyptus grandis [rose gum]
gb|KGN54119.1|  hypothetical protein Csa_4G286920                       157   2e-44   
ref|XP_011025251.1|  PREDICTED: uncharacterized protein YMR315W i...    160   1e-43   Populus euphratica
ref|XP_009364727.1|  PREDICTED: uncharacterized protein LOC103954617    159   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_011025252.1|  PREDICTED: uncharacterized protein YMR315W i...    160   1e-43   Populus euphratica
ref|XP_006386094.1|  hypothetical protein POPTR_0003s22050g             159   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006386095.1|  hypothetical protein POPTR_0003s22050g             159   1e-43   Populus trichocarpa [western balsam poplar]
gb|ABK96297.1|  unknown                                                 159   1e-43   Populus trichocarpa x Populus deltoides
emb|CAN75498.1|  hypothetical protein VITISV_020272                     159   2e-43   Vitis vinifera
gb|ACU17312.1|  unknown                                                 155   2e-43   Glycine max [soybeans]
ref|XP_009364714.1|  PREDICTED: uncharacterized protein LOC103954601    158   4e-43   Pyrus x bretschneideri [bai li]
gb|KFK39395.1|  hypothetical protein AALP_AA3G239500                    157   1e-42   Arabis alpina [alpine rockcress]
gb|KDP20201.1|  hypothetical protein JCGZ_07921                         156   2e-42   Jatropha curcas
emb|CDY06381.1|  BnaC05g31490D                                          155   4e-42   
ref|XP_008358862.1|  PREDICTED: uncharacterized protein YMR315W-l...    155   5e-42   Malus domestica [apple tree]
ref|XP_011090402.1|  PREDICTED: uncharacterized protein YMR315W-like    155   5e-42   Sesamum indicum [beniseed]
emb|CDY19604.1|  BnaA05g20120D                                          155   6e-42   Brassica napus [oilseed rape]
ref|XP_009145584.1|  PREDICTED: uncharacterized protein YMR315W         155   7e-42   Brassica rapa
ref|XP_003543553.1|  PREDICTED: uncharacterized protein YMR315W         155   8e-42   Glycine max [soybeans]
ref|XP_007014900.1|  Oxidoreductase, putative isoform 2                 154   9e-42   
ref|XP_008243595.1|  PREDICTED: uncharacterized protein YMR315W         154   1e-41   Prunus mume [ume]
ref|XP_006298014.1|  hypothetical protein CARUB_v10014059mg             154   1e-41   
ref|XP_002883268.1|  oxidoreductase family protein                      154   1e-41   
ref|XP_007014899.1|  Oxidoreductase, putative isoform 1                 154   2e-41   
ref|XP_006406349.1|  hypothetical protein EUTSA_v10021019mg             154   2e-41   Eutrema salsugineum [saltwater cress]
ref|XP_007205433.1|  hypothetical protein PRUPE_ppa007778mg             154   2e-41   
ref|XP_010091995.1|  Uncharacterized protein L484_007981                154   2e-41   
ref|XP_010488066.1|  PREDICTED: glucose-fructose oxidoreductase d...    154   2e-41   Camelina sativa [gold-of-pleasure]
gb|KJB66095.1|  hypothetical protein B456_010G128200                    154   2e-41   Gossypium raimondii
ref|XP_010544236.1|  PREDICTED: uncharacterized protein YMR315W i...    153   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_010544235.1|  PREDICTED: uncharacterized protein YMR315W i...    153   3e-41   Tarenaya hassleriana [spider flower]
gb|KJB66099.1|  hypothetical protein B456_010G128200                    153   3e-41   Gossypium raimondii
gb|EYU18011.1|  hypothetical protein MIMGU_mgv1a008840mg                153   3e-41   Erythranthe guttata [common monkey flower]
gb|KJB66097.1|  hypothetical protein B456_010G128200                    153   3e-41   Gossypium raimondii
ref|XP_010509356.1|  PREDICTED: glucose-fructose oxidoreductase d...    152   7e-41   Camelina sativa [gold-of-pleasure]
dbj|BAB02487.1|  unnamed protein product                                150   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188715.2|  NAD(P)-binding Rossmann-fold superfamily protein      151   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358864.1|  PREDICTED: uncharacterized protein YMR315W-l...    151   2e-40   Malus domestica [apple tree]
ref|XP_010257400.1|  PREDICTED: uncharacterized protein LOC104597...    150   3e-40   Nelumbo nucifera [Indian lotus]
ref|XP_011080243.1|  PREDICTED: uncharacterized protein LOC105163544    150   5e-40   Sesamum indicum [beniseed]
ref|XP_010257398.1|  PREDICTED: uncharacterized protein LOC104597...    150   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006494722.1|  PREDICTED: uncharacterized protein YMR315W-like    150   7e-40   Citrus sinensis [apfelsine]
ref|XP_006445972.1|  hypothetical protein CICLE_v10015756mg             146   7e-40   
ref|XP_006445973.1|  hypothetical protein CICLE_v10015756mg             147   1e-39   
ref|XP_007150403.1|  hypothetical protein PHAVU_005G150400g             150   1e-39   Phaseolus vulgaris [French bean]
ref|XP_011461910.1|  PREDICTED: uncharacterized protein YMR315W         149   2e-39   Fragaria vesca subsp. vesca
gb|EYU46309.1|  hypothetical protein MIMGU_mgv1a0096471mg               143   2e-39   Erythranthe guttata [common monkey flower]
gb|KJB66096.1|  hypothetical protein B456_010G128200                    148   2e-39   Gossypium raimondii
ref|XP_006445974.1|  hypothetical protein CICLE_v10015756mg             147   8e-39   Citrus clementina [clementine]
gb|KJB66098.1|  hypothetical protein B456_010G128200                    147   1e-38   Gossypium raimondii
gb|AFK46300.1|  unknown                                                 145   2e-38   Lotus japonicus
ref|XP_010257399.1|  PREDICTED: uncharacterized protein LOC104597...    146   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_009385566.1|  PREDICTED: glucose-fructose oxidoreductase d...    144   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010913920.1|  PREDICTED: uncharacterized protein LOC105039...    143   2e-37   Elaeis guineensis
ref|XP_010913917.1|  PREDICTED: uncharacterized protein LOC105039...    143   3e-37   Elaeis guineensis
ref|XP_003577920.1|  PREDICTED: uncharacterized protein LOC100827110    142   4e-37   Brachypodium distachyon [annual false brome]
ref|XP_002459955.1|  hypothetical protein SORBIDRAFT_02g018670          142   6e-37   Sorghum bicolor [broomcorn]
gb|KHG07862.1|  Uncharacterized protein F383_13730                      140   2e-36   Gossypium arboreum [tree cotton]
ref|XP_008787293.1|  PREDICTED: uncharacterized protein LOC103705381    140   3e-36   Phoenix dactylifera
ref|XP_006850072.1|  hypothetical protein AMTR_s00022p00213490          140   3e-36   
ref|NP_001149836.1|  NAD-dependent dyhydrogenase, Gfo/Idh/MocA fa...    140   3e-36   Zea mays [maize]
ref|XP_004956459.1|  PREDICTED: uncharacterized protein YMR315W-like    140   4e-36   Setaria italica
ref|XP_008668038.1|  PREDICTED: NAD-dependent dyhydrogenase, Gfo/...    139   8e-36   Zea mays [maize]
ref|XP_006660493.1|  PREDICTED: uncharacterized protein YMR315W-like    136   1e-34   Oryza brachyantha
gb|EMT01460.1|  hypothetical protein F775_26364                         135   1e-34   
ref|XP_010673578.1|  PREDICTED: uncharacterized protein YMR315W i...    134   7e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673579.1|  PREDICTED: uncharacterized protein YMR315W i...    134   7e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE69341.1|  hypothetical protein OsJ_28659                          133   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062764.1|  Os09g0280300                                       133   1e-33   
ref|XP_004486934.1|  PREDICTED: uncharacterized protein YMR315W-like    132   3e-33   Cicer arietinum [garbanzo]
gb|EPS68382.1|  hypothetical protein M569_06387                         129   4e-32   Genlisea aurea
ref|XP_004169964.1|  PREDICTED: uncharacterized protein LOC101228167    117   8e-30   
ref|XP_003597479.1|  Oxidoreductase, putative                           122   1e-29   Medicago truncatula
ref|XP_004142242.1|  PREDICTED: uncharacterized LOC101204258            117   1e-28   
ref|XP_001754780.1|  predicted protein                                  114   1e-26   
ref|XP_001762266.1|  predicted protein                                  113   3e-26   
ref|XP_001776337.1|  predicted protein                                94.0    2e-19   
ref|XP_002981277.1|  hypothetical protein SELMODRAFT_114540           92.0    7e-19   
ref|XP_002969664.1|  hypothetical protein SELMODRAFT_92921            91.7    8e-19   
ref|XP_002973220.1|  hypothetical protein SELMODRAFT_413759           86.7    6e-17   
ref|XP_002976631.1|  hypothetical protein SELMODRAFT_416506           84.0    4e-16   Selaginella moellendorffii
ref|XP_002973823.1|  hypothetical protein SELMODRAFT_414190           73.6    2e-12   
gb|KJB66094.1|  hypothetical protein B456_010G128200                  72.4    4e-12   Gossypium raimondii
ref|XP_004152962.1|  PREDICTED: uncharacterized protein LOC101204258  58.9    2e-08   
ref|XP_004162028.1|  PREDICTED: uncharacterized LOC101204258          59.7    9e-08   
gb|KJB66101.1|  hypothetical protein B456_010G128200                  55.1    5e-06   Gossypium raimondii
gb|ERT01696.1|  hypothetical protein HMPREF1624_02949                 55.1    6e-06   Sporothrix schenckii ATCC 58251
gb|KIH93169.1|  hypothetical protein SPBR_02922                       55.1    6e-06   Sporothrix brasiliensis 5110
gb|EFQ28397.1|  oxidoreductase family protein                         54.3    1e-05   Colletotrichum graminicola M1.001
ref|XP_010466287.1|  PREDICTED: uncharacterized protein LOC104746495  52.4    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_571074.1|  hypothetical protein                                49.3    6e-04   Cryptococcus neoformans var. neoformans JEC21
gb|KIR84978.1|  NAD-binding Rossmann fold oxidoreductase              49.3    6e-04   Cryptococcus gattii VGIV IND107
gb|KIR46111.1|  NAD-binding Rossmann fold oxidoreductase              49.3    7e-04   Cryptococcus gattii CA1280



>ref|XP_004228627.1| PREDICTED: uncharacterized oxidoreductase C26H5.09c [Solanum 
lycopersicum]
Length=359

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +QLPQIAILG+GIFVKTQYIPRLAEIS LF+L+AIWSR+EES RSAVE+A+ HFPNVECK
Sbjct  2    AQLPQIAILGAGIFVKTQYIPRLAEISNLFILRAIWSRTEESVRSAVEIAQKHFPNVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG AGLEEIIKD+SI GVAVV+AGQT V+MSLRLLK GKHVLQEKPAA  + EAE AL H
Sbjct  62   WGDAGLEEIIKDSSITGVAVVLAGQTMVDMSLRLLKAGKHVLQEKPAAPTVDEAEKALTH  121

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            YNSLST +TQ+PIWAVAENYRFEPAF E K++I+E
Sbjct  122  YNSLSTTLTQQPIWAVAENYRFEPAFIEGKRLISE  156



>ref|XP_009588958.1| PREDICTED: uncharacterized protein YMR315W [Nicotiana tomentosiformis]
Length=361

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA+SQ+PQIAILG+GIFVKTQYIPRLAEI  LFVL+AIWSRSEESARSAVE+AR HFP+V
Sbjct  1    MAQSQVPQIAILGAGIFVKTQYIPRLAEIPDLFVLRAIWSRSEESARSAVEIARKHFPDV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            ECKWG AGLE+IIKD+SI GVAVV+AGQT V+MSL+LLK GKHVLQEKPAAA + EAE A
Sbjct  61   ECKWGDAGLEDIIKDSSITGVAVVLAGQTMVDMSLKLLKAGKHVLQEKPAAATVDEAETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L HYNSLST +T +PIWAVAENYRFEPAF E KK+I+E
Sbjct  121  LTHYNSLSTTLTHQPIWAVAENYRFEPAFIEGKKLISE  158



>ref|XP_009773348.1| PREDICTED: uncharacterized protein LOC104223588 [Nicotiana sylvestris]
Length=361

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA+SQ+PQIAILG+GIFVKTQYIPRLAEI  LFVL+AIWSRSEESARSAVE+AR HFP+V
Sbjct  1    MAQSQVPQIAILGAGIFVKTQYIPRLAEIPHLFVLRAIWSRSEESARSAVEIARKHFPDV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            ECKWG AGLE+IIKD+SI GVAVV+AGQT V+MSLRLLK GKHVLQEKPAAA + EAE A
Sbjct  61   ECKWGDAGLEDIIKDSSITGVAVVLAGQTMVDMSLRLLKAGKHVLQEKPAAATVDEAETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L HYNSLS  +T +P+WAVAENYRFEPAF E +K+I+E
Sbjct  121  LTHYNSLSATLTHQPLWAVAENYRFEPAFIEGRKLISE  158



>ref|XP_006348416.1| PREDICTED: uncharacterized protein YMR315W-like [Solanum tuberosum]
Length=359

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +Q PQIAILG+GIFVKTQYIPRLAEIS LF+L+AIWSR+EESARSAVE+A+ HFPNVECK
Sbjct  2    AQHPQIAILGAGIFVKTQYIPRLAEISNLFILRAIWSRTEESARSAVEIAQKHFPNVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG AGLEEIIKD+SI GVAVV+AGQT V+MSLRLLK GKHVLQEKPA+A + EAE AL H
Sbjct  62   WGDAGLEEIIKDSSITGVAVVLAGQTMVDMSLRLLKAGKHVLQEKPASATVDEAEKALTH  121

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            YNSLS  +TQ+PIWAVAENYRFEPAF E K++I+E
Sbjct  122  YNSLSATLTQQPIWAVAENYRFEPAFIEGKRLISE  156



>ref|XP_010651283.1| PREDICTED: uncharacterized protein LOC100245027 isoform X2 [Vitis 
vinifera]
Length=322

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL+EII D+SI GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65   DGLDEIINDSSITGVAVVLAGQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  ++  +PIWAVAENYRFEPAF ECKK++ E
Sbjct  125  ICASIPGQPIWAVAENYRFEPAFVECKKLMEE  156



>ref|XP_010651284.1| PREDICTED: uncharacterized protein LOC100245027 isoform X3 [Vitis 
vinifera]
Length=309

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL+EII D+SI GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65   DGLDEIINDSSITGVAVVLAGQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  ++  +PIWAVAENYRFEPAF ECKK++ E
Sbjct  125  ICASIPGQPIWAVAENYRFEPAFVECKKLMEE  156



>emb|CBI16434.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL+EII D+SI GVAVV+AGQ +VEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65   DGLDEIINDSSITGVAVVLAGQMKVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  ++  +PIWAVAENYRFEPAF ECKK++ E
Sbjct  125  ICASIPGQPIWAVAENYRFEPAFVECKKLMEE  156



>ref|XP_008449757.1| PREDICTED: uncharacterized protein YMR315W [Cucumis melo]
Length=355

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++AR +FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARKYFPTVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG AGL++II+D SI+GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA  +E E AL +
Sbjct  62   WGDAGLDDIIQDNSILGVAVVLAGQAQVEMSLRLLKAGKHVLQEKPAAASTSELEYALSN  121

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            YNSLS N  ++P+WAVAENYRFEPA  ECK +IA+
Sbjct  122  YNSLSANFLRQPLWAVAENYRFEPALVECKNLIAD  156



>ref|XP_002285606.1| PREDICTED: uncharacterized protein LOC100245027 isoform X1 [Vitis 
vinifera]
Length=359

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL+EII D+SI GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65   DGLDEIINDSSITGVAVVLAGQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  ++  +PIWAVAENYRFEPAF ECKK++ E
Sbjct  125  ICASIPGQPIWAVAENYRFEPAFVECKKLMEE  156



>ref|XP_002513445.1| oxidoreductase, putative [Ricinus communis]
 gb|EEF48848.1| oxidoreductase, putative [Ricinus communis]
Length=359

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA S  PQIAILG+GIFV+TQYIPRLAEIS LFVLKA+WSRSEESA+ AVE+AR HFP V
Sbjct  1    MANS--PQIAILGAGIFVRTQYIPRLAEISNLFVLKAVWSRSEESAQGAVEIARKHFPGV  58

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            ECKWG  GL+EII D SI+ VAVV+AGQTQV+MSL+LLK GKHVLQEKPAAA I+E E A
Sbjct  59   ECKWGDEGLDEIIHDHSILAVAVVLAGQTQVDMSLKLLKAGKHVLQEKPAAASISELEIA  118

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L  Y SL  N   +PIWAVAENYRFEPAF EC+K++AE
Sbjct  119  LSSYKSLCANSPGQPIWAVAENYRFEPAFVECRKLLAE  156



>gb|KCW51233.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=270

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  292
            QIAILG+GIFV+TQYIPRLAEISQL ++K+IWSR++ESA  AVE+AR HFP VECKWG  
Sbjct  6    QIAILGAGIFVRTQYIPRLAEISQLVLVKSIWSRTQESATGAVEIARKHFPEVECKWGDE  65

Query  293  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  472
            GL+EII+D SI  VAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA   + E AL  Y +L
Sbjct  66   GLDEIIRDDSIPAVAVVLAGQAQVEMSLRLLKAGKHVLQEKPAAASTTDIEMALSRYRAL  125

Query  473  STNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
              +   KPIWAVAENYRFEPAF ECKK++A+
Sbjct  126  CASSPSKPIWAVAENYRFEPAFVECKKLLAD  156



>emb|CDP14087.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +QLP IAI+G+GIFVKTQYIPRLAEIS LFVLKAIWSRSEESAR AVE+AR  FP VECK
Sbjct  2    AQLPNIAIIGAGIFVKTQYIPRLAEISNLFVLKAIWSRSEESARGAVEVARKFFPEVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL+EIIKD+SIIGVAVV+AGQ QV+MSLRLLK GKHVLQEKPA A I EAE AL  
Sbjct  62   WGDGGLDEIIKDSSIIGVAVVLAGQIQVDMSLRLLKEGKHVLQEKPATASIDEAEAALSS  121

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            Y+SL T++  +P+WAVAENYRFEPAF E KK++AE
Sbjct  122  YHSLRTHLPFQPVWAVAENYRFEPAFEESKKLMAE  156



>ref|XP_010031848.1| PREDICTED: uncharacterized protein YMR315W [Eucalyptus grandis]
 gb|KCW51232.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=359

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  292
            QIAILG+GIFV+TQYIPRLAEISQL ++K+IWSR++ESA  AVE+AR HFP VECKWG  
Sbjct  6    QIAILGAGIFVRTQYIPRLAEISQLVLVKSIWSRTQESATGAVEIARKHFPEVECKWGDE  65

Query  293  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  472
            GL+EII+D SI  VAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA   + E AL  Y +L
Sbjct  66   GLDEIIRDDSIPAVAVVLAGQAQVEMSLRLLKAGKHVLQEKPAAASTTDIEMALSRYRAL  125

Query  473  STNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
              +   KPIWAVAENYRFEPAF ECKK++A+
Sbjct  126  CASSPSKPIWAVAENYRFEPAFVECKKLLAD  156



>gb|KGN54119.1| hypothetical protein Csa_4G286920 [Cucumis sativus]
Length=175

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG AGL++II+D+SI+GVAVV+AGQ QV+MSLRLLK GKHVLQEKPAAA  +E E AL +
Sbjct  62   WGDAGLDDIIQDSSILGVAVVLAGQAQVDMSLRLLKAGKHVLQEKPAAASTSELEYALSN  121

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTE  544
            Y SLS N +++ +WAVAENYRFEPAF E
Sbjct  122  YKSLSANFSRQRLWAVAENYRFEPAFVE  149



>ref|XP_011025251.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Populus 
euphratica]
Length=360

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63   WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            Y S+  N    PIWAVAENYRFEPA  E KK++A+
Sbjct  123  YKSICANSPGYPIWAVAENYRFEPALVESKKLLAD  157



>ref|XP_009364727.1| PREDICTED: uncharacterized protein LOC103954617 [Pyrus x bretschneideri]
Length=357

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            PQIAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PQIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GLEEII D+SI+GVAVV+AGQ QV+ SLR+LKGGKHVLQEKPAAA  +E E AL  Y S
Sbjct  63   KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKGGKHVLQEKPAAASTSELETALSSYKS  122

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  N   KPIWAVAENYRFEPAF E +K++ E
Sbjct  123  IVDNAPDKPIWAVAENYRFEPAFVEGRKLMTE  154



>ref|XP_011025252.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Populus 
euphratica]
Length=359

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63   WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            Y S+  N    PIWAVAENYRFEPA  E KK++A+
Sbjct  123  YKSICANSPGYPIWAVAENYRFEPALVESKKLLAD  157



>ref|XP_006386094.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63891.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=359

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63   WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            Y S+  N    PIWAVAENYRFEPA  E KK++A+
Sbjct  123  YKSICANSPGYPIWAVAENYRFEPALVESKKLLAD  157



>ref|XP_006386095.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63892.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=360

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63   WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            Y S+  N    PIWAVAENYRFEPA  E KK++A+
Sbjct  123  YKSICANSPGYPIWAVAENYRFEPALVESKKLLAD  157



>gb|ABK96297.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63   WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            Y S+  N    PIWAVAENYRFEPA  E KK++A+
Sbjct  123  YKSICANSPGYPIWAVAENYRFEPALVESKKLLAD  157



>emb|CAN75498.1| hypothetical protein VITISV_020272 [Vitis vinifera]
Length=364

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 114/152 (75%), Gaps = 13/152 (9%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL+EII D         + G   VEMSLRLLK GKHVLQ       I+EAE AL HYNS
Sbjct  65   DGLDEIIND-------SSITGVAVVEMSLRLLKAGKHVLQ------AISEAETALSHYNS  111

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  ++  +PIWAVAENYRFEPAF ECKK++ E
Sbjct  112  ICASIPGQPIWAVAENYRFEPAFVECKKLMEE  143



>gb|ACU17312.1| unknown [Glycine max]
Length=225

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA  QLPQIAILG+GIFVKTQY+PRL+EIS LF+LK+IWSR++ESA +AV++AR HFP V
Sbjct  1    MATKQLPQIAILGAGIFVKTQYLPRLSEISHLFILKSIWSRTQESATAAVDIARKHFPQV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            E KWG  G ++II D SI  VAVV+AGQ QV++SLRLLK GKHVLQEKPAA+C +E E A
Sbjct  61   ETKWGDNGFDDIIHDGSIDAVAVVLAGQNQVDISLRLLKAGKHVLQEKPAASCTSELEAA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
            L  Y S+S++   + IW+VAENYRFEP   ECKK+IA
Sbjct  121  LSSYKSISSDAPGQLIWSVAENYRFEPGLVECKKLIA  157



>ref|XP_009364714.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
 ref|XP_009364715.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
Length=357

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            PQIAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PQIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GLEEII D+SI+GVAVV+AGQ QV+ SLR+LKGGKHVLQEKPAAA  +E E AL  Y S
Sbjct  63   KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKGGKHVLQEKPAAASTSELETALSSYKS  122

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  N   KPIWAVAENYRFEP F E +K++ E
Sbjct  123  IVDNAPDKPIWAVAENYRFEPTFVEGRKLMTE  154



>gb|KFK39395.1| hypothetical protein AALP_AA3G239500 [Arabis alpina]
Length=356

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            S  P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESAR AVE+AR HFP V+CK
Sbjct  5    SSPPGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESARGAVEIARKHFPEVKCK  64

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL EII+D+SI+GVAVVVAG +QVEMSLR+LK GKHVLQEKPAAA I+E E A+  
Sbjct  65   WGDEGLNEIIQDSSIVGVAVVVAGHSQVEMSLRMLKAGKHVLQEKPAAASISEIETAMSS  124

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            Y ++S + T+ PIWAVAENYRFEPAF E KK+I E
Sbjct  125  YKNISADSTRCPIWAVAENYRFEPAFVELKKLIGE  159



>gb|KDP20201.1| hypothetical protein JCGZ_07921 [Jatropha curcas]
Length=359

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P +AILG+GIFV+TQY+PRLAEIS LFVLKAIWSR+EESAR AVE+AR HFP VE KWG 
Sbjct  5    PHLAILGAGIFVRTQYLPRLAEISDLFVLKAIWSRTEESAREAVEIARKHFPGVEYKWGD  64

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL+EII+D SI+GVAVV+AGQ QV++SL+LLK GKHVLQEKPAAA  +E E AL  Y S
Sbjct  65   KGLDEIIQDESILGVAVVLAGQAQVDISLKLLKAGKHVLQEKPAAASASEIETALSSYKS  124

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  N   +PIWAVAENYRFEPAF ECKK++AE
Sbjct  125  IYANSPGQPIWAVAENYRFEPAFVECKKLLAE  156



>emb|CDY06381.1| BnaC05g31490D [Brassica napus]
Length=348

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA    P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1    MANPSPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            ECKWG  GL EII+DTSI+GVAVV+AGQTQVEMSL++LK GKHVLQEKPAAA I E E A
Sbjct  61   ECKWGDEGLNEIIQDTSILGVAVVIAGQTQVEMSLKMLKAGKHVLQEKPAAASIGEIETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  Y ++ST+   +PIWAVAENYRFEPAF E KK++ E
Sbjct  121  MTSYKNISTDSPCRPIWAVAENYRFEPAFVELKKLVEE  158



>ref|XP_008358862.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
 ref|XP_008358863.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
Length=357

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P IAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PHIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GLEEII D+SI+GVAVV+AGQ QV+ SLR+LK GKHVLQEKPAAA  +E E AL  Y S
Sbjct  63   KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKAGKHVLQEKPAAASTSELETALSSYKS  122

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  N   KPIWAVAENYRFEPAF E +K++ E
Sbjct  123  IVDNAPDKPIWAVAENYRFEPAFVEGRKLMTE  154



>ref|XP_011090402.1| PREDICTED: uncharacterized protein YMR315W-like [Sesamum indicum]
Length=358

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            PQIAILG+GIFVKT+YIPRL+EI  LFVLKAIWSR+EESAR AV++A+  FP VECKWG 
Sbjct  4    PQIAILGAGIFVKTEYIPRLSEIPDLFVLKAIWSRTEESARGAVDIAKKFFPRVECKWGD  63

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
            AGL EII+D SI+ V VV+A Q QV++SL+LL+ GKHVLQEKPAA+ I E + AL  YNS
Sbjct  64   AGLNEIIQDASIVAVLVVLAAQFQVDLSLKLLRSGKHVLQEKPAASSINEVKTALSSYNS  123

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            LST++ ++PIWA+AENYRFEPA  E KK++ +
Sbjct  124  LSTSLPRQPIWAIAENYRFEPAILEGKKLMPD  155



>emb|CDY19604.1| BnaA05g20120D [Brassica napus]
Length=347

 Score =   155 bits (391),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA +  P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1    MANASPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            ECKWG  GL EII+D+SI+GVAVV+AGQTQVEMSL++LK GKHVLQEKPAAA I E E A
Sbjct  61   ECKWGDEGLNEIIQDSSILGVAVVIAGQTQVEMSLKMLKAGKHVLQEKPAAASIGEIETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  Y ++S++   +PIWAVAENYRFEPAF E KK++ E
Sbjct  121  MTSYKNISSDSPCRPIWAVAENYRFEPAFVELKKLVEE  158



>ref|XP_009145584.1| PREDICTED: uncharacterized protein YMR315W [Brassica rapa]
Length=355

 Score =   155 bits (391),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA +  P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1    MANASPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            ECKWG  GL EII+D+SI+GVAVV+AGQTQVEMSL++LK GKHVLQEKPAAA I E E A
Sbjct  61   ECKWGDEGLNEIIQDSSILGVAVVIAGQTQVEMSLKMLKVGKHVLQEKPAAASIGEIETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  Y ++ST+   +PIWAVAENYRFEPAF E KK++ E
Sbjct  121  MTSYKNISTDSPCRPIWAVAENYRFEPAFVELKKLVEE  158



>ref|XP_003543553.1| PREDICTED: uncharacterized protein YMR315W [Glycine max]
 gb|KHN30111.1| Hypothetical protein glysoja_010489 [Glycine soja]
Length=360

 Score =   155 bits (391),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA  QLPQIAILG+GIFVKTQY+PRL+EIS LF+LK+IWSR++ESA +AV++AR HFP V
Sbjct  1    MATKQLPQIAILGAGIFVKTQYLPRLSEISHLFILKSIWSRTQESATAAVDIARKHFPQV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            E KWG  G ++II D SI  VAVV+AGQ QV++SLRLLK GKHVLQEKPAA+C +E E A
Sbjct  61   ETKWGDNGFDDIIHDGSIDAVAVVLAGQNQVDISLRLLKAGKHVLQEKPAASCTSELEAA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
            L  Y S+S++   + IW+VAENYRFEP   ECKK+IA
Sbjct  121  LSSYKSISSDAPGQLIWSVAENYRFEPGLVECKKLIA  157



>ref|XP_007014900.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
 gb|EOY32519.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
Length=344

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            PQIA+LG+GIFVKTQYIPRLAEIS L  LK IWSR++ESAR AVELA+ HFP VECKWG 
Sbjct  5    PQIAVLGAGIFVKTQYIPRLAEISHLLCLKYIWSRTQESARGAVELAKQHFPGVECKWGD  64

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL +II+D SI+GVAVV+AGQ QV+MSL+LLKGGKHV+QEKPAAA   E E AL  Y S
Sbjct  65   QGLNDIIQDASILGVAVVLAGQAQVDMSLKLLKGGKHVIQEKPAAASTTETETALSSYKS  124

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            + +N  Q PIWAVAENYRFEPAF E KK+IA+
Sbjct  125  ICSNPGQ-PIWAVAENYRFEPAFVESKKLIAD  155



>ref|XP_008243595.1| PREDICTED: uncharacterized protein YMR315W [Prunus mume]
Length=360

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  104  QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW  283
            ++PQIAILG+G F++TQYIPRLAEIS+L +LK+IWSR+EESAR AVE+A+ HFP VECKW
Sbjct  3    EVPQIAILGAGTFMRTQYIPRLAEISKLLLLKSIWSRTEESARGAVEIAQEHFPGVECKW  62

Query  284  GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHY  463
            G  GL+EII+D+SI+GVAVV+AGQ QV+ SLRLLK GKHVLQEKPAAA  +E E AL  Y
Sbjct  63   GDKGLQEIIEDSSILGVAVVLAGQAQVDFSLRLLKAGKHVLQEKPAAASTSELETALSSY  122

Query  464  NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
             S+  N+  KPIWAVAENYRFEPAF E KK++ +
Sbjct  123  RSIFANIPDKPIWAVAENYRFEPAFVEGKKLVND  156



>ref|XP_006298014.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
 gb|EOA30912.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
Length=355

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V+CKWG 
Sbjct  6    PGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEIARKHFPDVKCKWGD  65

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL EI++D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A++ Y  
Sbjct  66   EGLNEIMEDSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIEAAMLSYRI  125

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +S +   +PIWAVAENYRFEPAF E KK+IAE
Sbjct  126  ISADTPCRPIWAVAENYRFEPAFVELKKLIAE  157



>ref|XP_002883268.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59527.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=360

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP V+CKWG 
Sbjct  6    PGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEIARKHFPEVKCKWGD  65

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL EII+D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A+  Y +
Sbjct  66   DGLNEIIQDSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIETAMSSYRN  125

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +S +   +PIWAVAENYRFEPAF E KK+IAE
Sbjct  126  ISADSPCRPIWAVAENYRFEPAFVELKKLIAE  157



>ref|XP_007014899.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
 gb|EOY32518.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
Length=358

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            PQIA+LG+GIFVKTQYIPRLAEIS L  LK IWSR++ESAR AVELA+ HFP VECKWG 
Sbjct  5    PQIAVLGAGIFVKTQYIPRLAEISHLLCLKYIWSRTQESARGAVELAKQHFPGVECKWGD  64

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL +II+D SI+GVAVV+AGQ QV+MSL+LLKGGKHV+QEKPAAA   E E AL  Y S
Sbjct  65   QGLNDIIQDASILGVAVVLAGQAQVDMSLKLLKGGKHVIQEKPAAASTTETETALSSYKS  124

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            + +N  Q PIWAVAENYRFEPAF E KK+IA+
Sbjct  125  ICSNPGQ-PIWAVAENYRFEPAFVESKKLIAD  155



>ref|XP_006406349.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
 gb|ESQ47802.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
Length=356

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            M     P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1    MTNPSPPAIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEVARKHFPEV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            +CKWG  GL EII+D+SI+GVAVVVAGQ QVEMSL++LK GKHVLQEKPAAA I+E E A
Sbjct  61   KCKWGDEGLNEIIQDSSIVGVAVVVAGQNQVEMSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  Y ++  +   +PIWAVAENYRFEPAF E KK++AE
Sbjct  121  ISSYRNIPADSPSRPIWAVAENYRFEPAFVELKKLVAE  158



>ref|XP_007205433.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
 gb|EMJ06632.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
Length=356

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  104  QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW  283
            + PQIAILG+G F++TQYIPRLAEIS+L +LK+IWSR+EESAR AVE+A+ HFP VECKW
Sbjct  3    EAPQIAILGAGTFMRTQYIPRLAEISKLLLLKSIWSRTEESARGAVEIAQKHFPGVECKW  62

Query  284  GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHY  463
            G  GL+EII+D+SI+GVAVV+AGQ QV+ SLRLLK GKHVLQEKPAAA  +E E AL  Y
Sbjct  63   GDKGLQEIIEDSSILGVAVVLAGQAQVDFSLRLLKAGKHVLQEKPAAASTSELETALSSY  122

Query  464  NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
             S+  N+  KPIWAVAENYRFEPAF E KK++ +
Sbjct  123  RSIFANIPDKPIWAVAENYRFEPAFVEGKKLVND  156



>ref|XP_010091995.1| Uncharacterized protein L484_007981 [Morus notabilis]
 gb|EXB48401.1| Uncharacterized protein L484_007981 [Morus notabilis]
Length=352

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 119/155 (77%), Gaps = 6/155 (4%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            ++ PQIAI+G+GIFV+TQYIPRL+EIS L  LKAIWSRSEESAR AVE+A+  FP VECK
Sbjct  2    AKAPQIAIVGAGIFVRTQYIPRLSEISDLVSLKAIWSRSEESARGAVEIAQKFFPGVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  G +EI++D SI+GVAVV+AGQ QV+ SLRLLK GKHVLQ              L  
Sbjct  62   WGDKGFDEIVQDNSILGVAVVLAGQAQVDFSLRLLKAGKHVLQATSELEAA------LAG  115

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            YNS+S N+  KPIWAVAENYRFEPAF E KK++AE
Sbjct  116  YNSISVNVPSKPIWAVAENYRFEPAFVESKKLVAE  150



>ref|XP_010488066.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=355

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            M     P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V
Sbjct  1    MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLLVLKAIWSRTEESAKGAVEIARKHFPDV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            +CKWG  GL EII D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A
Sbjct  61   KCKWGDEGLNEIIADSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  Y ++S +   +PIWAVAENYRFEPAF E KK++ E
Sbjct  121  MSSYRNISADSPCRPIWAVAENYRFEPAFVELKKLVVE  158



>gb|KJB66095.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62   WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
            Y S+STN  Q PIWAVAENYRFEPAF E KK++A
Sbjct  122  YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVA  154



>ref|XP_010544236.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Tarenaya 
hassleriana]
Length=355

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P +AILG+GIFV+TQYIPRLAEIS LFVL+AIWSR+EESA+ AVE+AR HFP+VECKWG 
Sbjct  6    PGLAILGAGIFVRTQYIPRLAEISDLFVLRAIWSRTEESAKGAVEIARKHFPDVECKWGE  65

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL+EII+D SI+GV VV+AGQ QVEMSL++LK GKHVLQEKPAAA I+E E A+  Y +
Sbjct  66   EGLDEIIRDNSIVGVGVVLAGQIQVEMSLKMLKAGKHVLQEKPAAASISEIETAISSYKN  125

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +ST      IWAVAENYRFEPAF E KK++ E
Sbjct  126  ISTGSPSPSIWAVAENYRFEPAFVELKKLVGE  157



>ref|XP_010544235.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Tarenaya 
hassleriana]
Length=356

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P +AILG+GIFV+TQYIPRLAEIS LFVL+AIWSR+EESA+ AVE+AR HFP+VECKWG 
Sbjct  6    PGLAILGAGIFVRTQYIPRLAEISDLFVLRAIWSRTEESAKGAVEIARKHFPDVECKWGE  65

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL+EII+D SI+GV VV+AGQ QVEMSL++LK GKHVLQEKPAAA I+E E A+  Y +
Sbjct  66   EGLDEIIRDNSIVGVGVVLAGQIQVEMSLKMLKAGKHVLQEKPAAASISEIETAISSYKN  125

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +ST      IWAVAENYRFEPAF E KK++ E
Sbjct  126  ISTGSPSPSIWAVAENYRFEPAFVELKKLVGE  157



>gb|KJB66099.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62   WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
            Y S+STN  Q PIWAVAENYRFEPAF E KK++A
Sbjct  122  YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVA  154



>gb|EYU18011.1| hypothetical protein MIMGU_mgv1a008840mg [Erythranthe guttata]
Length=360

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P+IAILG+GIFV+T+YIPRL+EISQLF LKAIWSR+EESA+ AVE+A+  FP VECKWG 
Sbjct  4    PKIAILGAGIFVRTEYIPRLSEISQLFSLKAIWSRTEESAKGAVEIAKEFFPEVECKWGD  63

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL+++I+D+SI  V VV+A Q QV++SLR+LK GKHVLQEKPAAA I + E AL  YNS
Sbjct  64   DGLDDVIEDSSIDAVLVVLAAQFQVDLSLRILKSGKHVLQEKPAAASITKVETALSSYNS  123

Query  470  L-STNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L ST +  KPIWAVAENYRFEPAF E KK++ +
Sbjct  124  LTSTGLPSKPIWAVAENYRFEPAFLEGKKLMGD  156



>gb|KJB66097.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=357

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62   WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
            Y S+STN  Q PIWAVAENYRFEPAF E KK++A
Sbjct  122  YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVA  154



>ref|XP_010509356.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=354

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V+CKWG 
Sbjct  6    PGIAILGAGIFVKTQYIPRLAEISDLLVLKAIWSRTEESAKGAVEIARKHFPDVKCKWGD  65

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL EII+D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A+  Y  
Sbjct  66   EGLNEIIEDSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIETAMSSYRE  125

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +S +   +PIWAVAENYRFEPAF E KK++ E
Sbjct  126  ISADSPCRPIWAVAENYRFEPAFVELKKLMVE  157



>dbj|BAB02487.1| unnamed protein product [Arabidopsis thaliana]
Length=316

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            M     P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1    MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLVDLKAIWSRTEESAKGAVEIARKHFPEV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            +CKWG  GL EII+D+SI+GVAVVVA +T VE+SL++LK GKHVLQEKPAAA I+E E A
Sbjct  61   KCKWGDEGLNEIIQDSSIVGVAVVVAAETMVELSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  Y ++S +   +PIWAVAENYRFEPAF E KK+IAE
Sbjct  121  MSSYRNISADSPCRPIWAVAENYRFEPAFVELKKLIAE  158



>ref|NP_188715.2| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAM12966.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15398.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76423.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            M     P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1    MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLVDLKAIWSRTEESAKGAVEIARKHFPEV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            +CKWG  GL EII+D+SI+GVAVVVA +T VE+SL++LK GKHVLQEKPAAA I+E E A
Sbjct  61   KCKWGDEGLNEIIQDSSIVGVAVVVAAETMVELSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  Y ++S +   +PIWAVAENYRFEPAF E KK+IAE
Sbjct  121  MSSYRNISADSPCRPIWAVAENYRFEPAFVELKKLIAE  158



>ref|XP_008358864.1| PREDICTED: uncharacterized protein YMR315W-like isoform X2 [Malus 
domestica]
Length=351

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 119/152 (78%), Gaps = 6/152 (4%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P IAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PHIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GLEEII D+SI+GVAVV+AGQ QV+ SLR+LK GKHVLQ        +E E AL  Y S
Sbjct  63   KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKAGKHVLQ------ATSELETALSSYKS  116

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  N   KPIWAVAENYRFEPAF E +K++ E
Sbjct  117  IVDNAPDKPIWAVAENYRFEPAFVEGRKLMTE  148



>ref|XP_010257400.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010257401.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
Length=359

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  2    TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL+ II+D+S+ GVAVV+AGQTQV++SLRLL+ GKHVLQEKPAAA ++EA++AL  
Sbjct  62   WGDEGLDAIIQDSSLHGVAVVLAGQTQVDISLRLLRAGKHVLQEKPAAASVSEAKSALSC  121

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            YNSL  N  ++P+WAVAENYRFEPAF ECKK++ +
Sbjct  122  YNSLCANYPRQPLWAVAENYRFEPAFVECKKLMND  156



>ref|XP_011080243.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080244.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080245.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
Length=356

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 124/156 (79%), Gaps = 4/156 (3%)
 Frame = +2

Query  98   ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC  277
            E   PQIAI+G+GIFV+  YIPRLAEIS L VL+AIWSRSEESAR AVE A+  FPNVEC
Sbjct  2    EQTPPQIAIIGAGIFVRNTYIPRLAEISNLLVLRAIWSRSEESARGAVETAKKFFPNVEC  61

Query  278  KWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLM  457
            KWG AGLEEII+D SIIGVAVV+AGQ QV+MSLRLLK GKHVLQEKPAAA   E   A+ 
Sbjct  62   KWGEAGLEEIIQDASIIGVAVVLAGQAQVDMSLRLLKSGKHVLQEKPAAASGTELNAAIS  121

Query  458  HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
             Y+SL       PIWAVAENYRFEPAF E KK++AE
Sbjct  122  SYSSLQP----APIWAVAENYRFEPAFVEGKKLMAE  153



>ref|XP_010257398.1| PREDICTED: uncharacterized protein LOC104597515 isoform X1 [Nelumbo 
nucifera]
Length=382

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  25   TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  84

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL+ II+D+S+ GVAVV+AGQTQV++SLRLL+ GKHVLQEKPAAA ++EA++AL  
Sbjct  85   WGDEGLDAIIQDSSLHGVAVVLAGQTQVDISLRLLRAGKHVLQEKPAAASVSEAKSALSC  144

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            YNSL  N  ++P+WAVAENYRFEPAF ECKK++ +
Sbjct  145  YNSLCANYPRQPLWAVAENYRFEPAFVECKKLMND  179



>ref|XP_006494722.1| PREDICTED: uncharacterized protein YMR315W-like [Citrus sinensis]
 gb|KDO64912.1| hypothetical protein CISIN_1g018445mg [Citrus sinensis]
Length=355

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GKHV+QEKPAAA I+E ENAL  YNS
Sbjct  63   NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKHVIQEKPAAANISEIENALSRYNS  122

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  +   +PIWAVAENYRFEPAF ECKK+IAE
Sbjct  123  ICPDPPGQPIWAVAENYRFEPAFVECKKLIAE  154



>ref|XP_006445972.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59212.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=219

 Score =   146 bits (369),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS
Sbjct  63   NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNS  122

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  +   +PIWAVAENYRFEPAF ECKK+IAE
Sbjct  123  ICPDPPGQPIWAVAENYRFEPAFVECKKLIAE  154



>ref|XP_006445973.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59213.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=268

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS
Sbjct  63   NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNS  122

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  +   +PIWAVAENYRFEPAF ECKK+IAE
Sbjct  123  ICPDPPGQPIWAVAENYRFEPAFVECKKLIAE  154



>ref|XP_007150403.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
 gb|ESW22397.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
Length=383

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +++PQIAILG+GIFVK+QYIPRL+EIS LF LKAIWSRS+ESA +AVE+AR HFP VECK
Sbjct  27   TKVPQIAILGAGIFVKSQYIPRLSEISHLFHLKAIWSRSQESATAAVEVARKHFPGVECK  86

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GLE+II+D SI  VAVV+A Q QV++SLR+LK GKHVLQEKPAA+C +E E AL  
Sbjct  87   WGDCGLEDIIQDGSIDAVAVVLAVQNQVDISLRVLKAGKHVLQEKPAASCTSELETALSS  146

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
            Y S+S +   + IW+VAENYRFE    ECKK+I 
Sbjct  147  YRSISADAPSQLIWSVAENYRFESGLLECKKLIG  180



>ref|XP_011461910.1| PREDICTED: uncharacterized protein YMR315W [Fragaria vesca subsp. 
vesca]
Length=359

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 127/158 (80%), Gaps = 2/158 (1%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MAE+  PQIAI G+G FVKTQYIPRLAEIS L  LKAIWSRSEESAR AVE+AR HFP V
Sbjct  1    MAEA--PQIAICGAGTFVKTQYIPRLAEISNLVNLKAIWSRSEESARGAVEIARKHFPGV  58

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            ECKWG  GLEEII D+SI+GVAVV+AGQ QV+ SL+LL+ GK+VLQEKPAAA  +E E A
Sbjct  59   ECKWGDQGLEEIIADSSILGVAVVLAGQAQVDFSLKLLRAGKNVLQEKPAAATTSELEIA  118

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L  Y S+  N   KPIWA+AENYRFEPAF E KK++ E
Sbjct  119  LSSYKSIVANTPNKPIWAIAENYRFEPAFVEGKKLMTE  156



>gb|EYU46309.1| hypothetical protein MIMGU_mgv1a0096471mg, partial [Erythranthe 
guttata]
Length=147

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 123/151 (81%), Gaps = 4/151 (3%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MAE + PQIAILG+GIFV+  YIPRLAEIS L VL+AIWSR++ESAR AVE+A+ +FP+V
Sbjct  1    MAEQRPPQIAILGAGIFVRNTYIPRLAEISNLLVLRAIWSRTQESARGAVEIAKQYFPDV  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            ECKWG AGL +II D SI+GVAVV+AGQTQV+MSLR LK GKHVLQEKPAAA + E E A
Sbjct  61   ECKWGEAGLNDIILDASIVGVAVVLAGQTQVDMSLRFLKAGKHVLQEKPAAASVNELETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTE  544
            +  YNS +      PIWAVAENYRFEPAF E
Sbjct  121  ISSYNSFNP----APIWAVAENYRFEPAFVE  147



>gb|KJB66096.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=352

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 123/154 (80%), Gaps = 7/154 (5%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+Q       I E E AL  
Sbjct  62   WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQ------GIPEIETALAS  115

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
            Y S+STN  Q PIWAVAENYRFEPAF E KK++A
Sbjct  116  YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVA  148



>ref|XP_006445974.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59214.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=355

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS
Sbjct  63   NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNS  122

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  +   +PIWAVAENYRFEPAF ECKK+IAE
Sbjct  123  ICPDPPGQPIWAVAENYRFEPAFVECKKLIAE  154



>gb|KJB66098.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=356

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62   WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
            Y S+STN  Q PIWAVAENYRFEPAF E  K++A
Sbjct  122  YKSVSTNPGQ-PIWAVAENYRFEPAFVE--KLVA  152



>gb|AFK46300.1| unknown [Lotus japonicus]
Length=359

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  98   ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC  277
            E++ P+IAILG+G FVK+QY+PRL+EIS LF+LKAIWSR++ESARSAVE+A  +F  VEC
Sbjct  2    ETKRPEIAILGAGTFVKSQYLPRLSEISHLFILKAIWSRTQESARSAVEIAHRNFAGVEC  61

Query  278  KWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLM  457
            KWG  GL++II D SI  VAVV+AGQ QVE+SLR+LK GKH+LQEKPAA+CI+E E AL 
Sbjct  62   KWGDDGLDDIIHDGSITAVAVVLAGQNQVEISLRMLKAGKHILQEKPAASCISELETALS  121

Query  458  HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +Y S+  +  ++ +W+VAENYRFEPA  ECKK+IA+
Sbjct  122  NYKSICADAPRQLVWSVAENYRFEPALVECKKLIAD  157



>ref|XP_010257399.1| PREDICTED: uncharacterized protein LOC104597515 isoform X2 [Nelumbo 
nucifera]
Length=376

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 121/155 (78%), Gaps = 6/155 (4%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  25   TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  84

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
            WG  GL+ II+D+S+ GVAVV+AGQTQV++SLRLL+ GKHVLQ    A         L  
Sbjct  85   WGDEGLDAIIQDSSLHGVAVVLAGQTQVDISLRLLRAGKHVLQAVSEAKSA------LSC  138

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            YNSL  N  ++P+WAVAENYRFEPAF ECKK++ +
Sbjct  139  YNSLCANYPRQPLWAVAENYRFEPAFVECKKLMND  173



>ref|XP_009385566.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1 [Musa acuminata subsp. malaccensis]
Length=364

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  86   LPMAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFP  265
            +  +++  PQIAI+G+GIFV+TQYIPRL EI+   ++K+IWSR+EESA++A ELA++  P
Sbjct  1    MAASDAAPPQIAIIGAGIFVRTQYIPRLREIADHLIIKSIWSRTEESAKAAAELAQDFAP  60

Query  266  NVECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeae  445
            N+ECKWG +GLEEII+D+SI  VAVV+A Q QVE+SLR+LK GKHV+QEKPAA  ++EAE
Sbjct  61   NIECKWGDSGLEEIIQDSSITAVAVVLAAQVQVEISLRMLKAGKHVIQEKPAAGTVSEAE  120

Query  446  naLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
             A+  YNS   N   +P+WA+AENYRFEPAF E +K++ +
Sbjct  121  TAISCYNSFCNNFPHQPVWALAENYRFEPAFVESRKLLND  160



>ref|XP_010913920.1| PREDICTED: uncharacterized protein LOC105039462 isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +2

Query  107  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  286
            LPQIAI+G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8    LPQIAIIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPQVECKWG  67

Query  287  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  466
             +GLE+II+D+SI GV VV+AGQ QV++SL++LK GKHV+QEKPAA   +EA+ AL  Y 
Sbjct  68   DSGLEDIIQDSSIKGVVVVLAGQVQVDISLKMLKMGKHVIQEKPAAESTSEADTALSRYK  127

Query  467  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            SL  +   +PIWAVAENYRFEPAF E +K+I E
Sbjct  128  SLCDHFRSQPIWAVAENYRFEPAFVEARKLINE  160



>ref|XP_010913917.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913918.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913919.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
Length=364

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +2

Query  107  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  286
            LPQIAI+G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8    LPQIAIIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPQVECKWG  67

Query  287  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  466
             +GLE+II+D+SI GV VV+AGQ QV++SL++LK GKHV+QEKPAA   +EA+ AL  Y 
Sbjct  68   DSGLEDIIQDSSIKGVVVVLAGQVQVDISLKMLKMGKHVIQEKPAAESTSEADTALSRYK  127

Query  467  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            SL  +   +PIWAVAENYRFEPAF E +K+I E
Sbjct  128  SLCDHFRSQPIWAVAENYRFEPAFVEARKLINE  160



>ref|XP_003577920.1| PREDICTED: uncharacterized protein LOC100827110 [Brachypodium 
distachyon]
Length=360

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +2

Query  95   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  274
             E  LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSRS+ESA +AVELAR+  P++E
Sbjct  3    GEGDLPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRSQESAEAAVELARDFVPDIE  62

Query  275  CKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaL  454
            CKWG  GLEEI+ D SI+GVAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL
Sbjct  63   CKWGDVGLEEIMGDRSIMGVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAEAAL  122

Query  455  MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
              YNS       KPIWA+AENYRFEPAF E  K++++
Sbjct  123  SIYNSFPKQFPYKPIWALAENYRFEPAFVESNKLMSD  159



>ref|XP_002459955.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
 gb|EER96476.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
Length=364

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +2

Query  95   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  274
              ++LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P++E
Sbjct  7    GRAELPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPDIE  66

Query  275  CKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaL  454
            CKWG  GLEEI+ D+SI+GVAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL
Sbjct  67   CKWGDVGLEEIMGDSSIMGVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETAL  126

Query  455  MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
              YNS       KPIWAV ENYRFEPAF E  K+I +
Sbjct  127  SIYNSFPNQFPHKPIWAVGENYRFEPAFIESSKLIND  163



>gb|KHG07862.1| Uncharacterized protein F383_13730 [Gossypium arboreum]
Length=353

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 115/155 (74%), Gaps = 8/155 (5%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavel-arNHFPNVEC  277
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSE+ +       A+ HFP VEC
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEKESSRGAVEIAKQHFPGVEC  61

Query  278  KWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLM  457
            KWG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK  KHV+Q       I E E AL 
Sbjct  62   KWGDQGLNDIVQDSSLIGTAVVLAGQVQVDISLKLLKAAKHVIQ------GIPEIETALA  115

Query  458  HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
             Y S+ TN  Q PIWAVAENYRFEPAF E KK++A
Sbjct  116  SYKSVCTNPGQ-PIWAVAENYRFEPAFVESKKLVA  149



>ref|XP_008787293.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787294.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787295.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787297.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787298.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787299.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787300.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
Length=364

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +2

Query  107  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  286
            LPQIA++G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8    LPQIAVIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPKVECKWG  67

Query  287  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  466
             +GLE+II+D+SI GVAVV+AGQ QV++SL+LL+ GKHV+QEKPAA    EA+ AL  Y 
Sbjct  68   DSGLEDIIQDSSIKGVAVVLAGQVQVDISLKLLRMGKHVIQEKPAAESTIEADTALSCYK  127

Query  467  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            SL  +   +PIWAVAENYRFEPAF E +K++ E
Sbjct  128  SLCDHFPSQPIWAVAENYRFEPAFVEARKLVNE  160



>ref|XP_006850072.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
 gb|ERN11653.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
Length=368

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  98   ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC  277
            E  LP IA+LG GIFV++QYIPRL EISQ  VL+ IWSRSEESA++A ELA    PNVE 
Sbjct  10   EKMLPHIALLGGGIFVRSQYIPRLKEISQTVVLRVIWSRSEESAKAAAELAHEFSPNVEY  69

Query  278  KWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLM  457
            KWG AGL +II+D+SI GV +V+  Q QV++SLR+L+ GKHVLQEKPAA+ ++EAENA++
Sbjct  70   KWGDAGLNDIIQDSSIHGVLIVLTAQVQVDISLRMLRAGKHVLQEKPAASSLSEAENAML  129

Query  458  HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
             Y+SL  N   +PIWAVAENYRFEPAF E +++  E
Sbjct  130  FYHSLHANFPHRPIWAVAENYRFEPAFVESQRLAKE  165



>ref|NP_001149836.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
 gb|ACG36942.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  95   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  274
              ++LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P++E
Sbjct  7    GRAELPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPDIE  66

Query  275  CKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaL  454
            CKWG AGLEEI+ D+SI+GVA+V+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL
Sbjct  67   CKWGDAGLEEIMGDSSIMGVAIVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETAL  126

Query  455  MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
              Y+S       KPIWAV ENYRFEPAF E  K+I +
Sbjct  127  SIYHSFQNLFPHKPIWAVGENYRFEPAFIESSKLIND  163



>ref|XP_004956459.1| PREDICTED: uncharacterized protein YMR315W-like [Setaria italica]
Length=365

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +2

Query  107  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  286
            LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P +ECKWG
Sbjct  11   LPRIAVVGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPEIECKWG  70

Query  287  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  466
             AGLEEI+ D+SI+GVAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL  YN
Sbjct  71   DAGLEEIMGDSSIMGVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETALSIYN  130

Query  467  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            S       KPIWA+ ENYRFEPAF E  K+I +
Sbjct  131  SFPNQFPYKPIWALGENYRFEPAFVESSKLIKD  163



>ref|XP_008668038.1| PREDICTED: NAD-dependent dyhydrogenase, Gfo/Idh/MocA family isoform 
X1 [Zea mays]
 tpg|DAA39396.1| TPA: NAD-dependent dihydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  95   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  274
              ++LP+IA++G+GIF +TQYIPRL EI+ L VLK+IWSR++ESA++A ELAR+  P++E
Sbjct  7    GRAELPRIAVIGAGIFARTQYIPRLREIAHLVVLKSIWSRTQESAKAAAELARDFAPDIE  66

Query  275  CKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaL  454
            CKWG AGLEEI+ D+SI+GVA+V+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL
Sbjct  67   CKWGDAGLEEIMGDSSIMGVAIVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETAL  126

Query  455  MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
              Y+S       KPIWAV ENYRFEPAF E  K+I +
Sbjct  127  SIYHSFQNLFPHKPIWAVGENYRFEPAFIESSKLIND  163



>ref|XP_006660493.1| PREDICTED: uncharacterized protein YMR315W-like [Oryza brachyantha]
Length=359

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA   LP+IA+LG+G F +TQYIPRL EI+ L +L+AIWSR++ESA +A ELAR+  P +
Sbjct  1    MAADGLPRIAVLGAGTFARTQYIPRLREIAHLVLLRAIWSRTQESAEAAAELARDFAPEI  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            EC+WG AGL EI++D SI  VAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE A
Sbjct  61   ECRWGDAGLAEIMEDASISAVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTMEAETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L  YNS       +PIWA+AENYRFEPAF E +K++ +
Sbjct  121  LSVYNSFPNQPPYRPIWALAENYRFEPAFVESRKLMND  158



>gb|EMT01460.1| hypothetical protein F775_26364 [Aegilops tauschii]
Length=355

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 6/153 (4%)
 Frame = +2

Query  107  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  286
            LP+IA++G+GIF +TQYIPRL EIS L VLKAIWSR++ESA +A ELAR+  P +ECKWG
Sbjct  8    LPRIAVVGAGIFARTQYIPRLREISHLVVLKAIWSRTQESAEAAAELARDFAPGIECKWG  67

Query  287  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  466
             AGLEEI+ D SI+GVAVV+AGQ QVE+SL++LK GKHV+Q         EAE AL  YN
Sbjct  68   DAGLEEIMGDPSILGVAVVLAGQVQVELSLKMLKAGKHVIQ------ASTEAETALSVYN  121

Query  467  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            S    +  KPIWAV ENYRFEPAF E  K++ +
Sbjct  122  SFPNKLPCKPIWAVGENYRFEPAFVESSKLMDD  154



>ref|XP_010673578.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=360

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  292
            QI I+G+G FVK QYIPRL+EIS L  ++ IWSRSEESARSAVELA   FP VECKWG  
Sbjct  11   QITIIGAGTFVKNQYIPRLSEISHLVSIRYIWSRSEESARSAVELASKSFPEVECKWGDV  70

Query  293  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  472
            G++EIIKD+S++GVAVV+AGQ QV+M+LRLLK GKHV+QEKPAAA   EAE AL  Y+ +
Sbjct  71   GIDEIIKDSSVVGVAVVLAGQIQVDMALRLLKAGKHVIQEKPAAASNEEAELALSSYDLV  130

Query  473  STNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
              + + KPIWAVAENYRFEP F E +K++ E
Sbjct  131  CPSNSSKPIWAVAENYRFEPGFIEGRKLVEE  161



>ref|XP_010673579.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  292
            QI I+G+G FVK QYIPRL+EIS L  ++ IWSRSEESARSAVELA   FP VECKWG  
Sbjct  6    QITIIGAGTFVKNQYIPRLSEISHLVSIRYIWSRSEESARSAVELASKSFPEVECKWGDV  65

Query  293  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  472
            G++EIIKD+S++GVAVV+AGQ QV+M+LRLLK GKHV+QEKPAAA   EAE AL  Y+ +
Sbjct  66   GIDEIIKDSSVVGVAVVLAGQIQVDMALRLLKAGKHVIQEKPAAASNEEAELALSSYDLV  125

Query  473  STNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
              + + KPIWAVAENYRFEP F E +K++ E
Sbjct  126  CPSNSSKPIWAVAENYRFEPGFIEGRKLVEE  156



>gb|EEE69341.1| hypothetical protein OsJ_28659 [Oryza sativa Japonica Group]
Length=364

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA   LP+IA++G+GIF +TQYIPRL EI+ L +LK IWSR++ESA +A ELAR+  P +
Sbjct  1    MAGDGLPRIAVVGAGIFARTQYIPRLREIAHLVLLKTIWSRTKESAEAAAELARDFAPEI  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            + +WG AGLEEI+ D SI  VAVV+AGQ QV++SL++LK GKHV+QEKPA+    EAE A
Sbjct  61   QPRWGDAGLEEIMGDASISAVAVVLAGQVQVDLSLKMLKAGKHVIQEKPASGSTMEAETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L  YNS       KPIWA+AENYRFEPAF E +K++++
Sbjct  121  LSVYNSFPNQFPYKPIWALAENYRFEPAFVESRKLMSD  158



>ref|NP_001062764.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAD26513.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24678.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAG93408.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84244.1| hypothetical protein OsI_30682 [Oryza sativa Indica Group]
Length=359

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  271
            MA   LP+IA++G+GIF +TQYIPRL EI+ L +LK IWSR++ESA +A ELAR+  P +
Sbjct  1    MAGDGLPRIAVVGAGIFARTQYIPRLREIAHLVLLKTIWSRTKESAEAAAELARDFAPEI  60

Query  272  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  451
            + +WG AGLEEI+ D SI  VAVV+AGQ QV++SL++LK GKHV+QEKPA+    EAE A
Sbjct  61   QPRWGDAGLEEIMGDASISAVAVVLAGQVQVDLSLKMLKAGKHVIQEKPASGSTMEAETA  120

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L  YNS       KPIWA+AENYRFEPAF E +K++++
Sbjct  121  LSVYNSFPNQFPYKPIWALAENYRFEPAFVESRKLMSD  158



>ref|XP_004486934.1| PREDICTED: uncharacterized protein YMR315W-like [Cicer arietinum]
Length=361

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 122/158 (77%), Gaps = 1/158 (1%)
 Frame = +2

Query  92   MAESQ-LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPN  268
            MA  Q  PQIAILG+G FVK+QY+PRL+EIS LF LKAIWSR+EESA +AVE+A  HF  
Sbjct  1    MATKQGTPQIAILGAGTFVKSQYLPRLSEISNLFHLKAIWSRTEESATAAVEIANKHFSG  60

Query  269  VECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaen  448
            V  KWG  GL +II+D SI  VA+V+AGQ QV++SL+LLK GKHVLQEKPAA+C +E E 
Sbjct  61   VHSKWGDNGLHDIIQDPSISAVAIVLAGQNQVDISLKLLKAGKHVLQEKPAASCTSELET  120

Query  449  aLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
            AL +Y  +S +   + IW+VAENYRFEPA  E KK+IA
Sbjct  121  ALSNYKLISADAPGQVIWSVAENYRFEPALVEGKKLIA  158



>gb|EPS68382.1| hypothetical protein M569_06387, partial [Genlisea aurea]
Length=340

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 117/151 (77%), Gaps = 5/151 (3%)
 Frame = +2

Query  116  IAILGSGIFVKTQYIPRLAEI-SQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  292
            +AI+G+GIFV++ YIPRLAEI +  FVL+AIWSRSE+SA+SA  +A+  FP VECKWG A
Sbjct  4    VAIVGAGIFVRSTYIPRLAEIGNNSFVLRAIWSRSEDSAKSAHAIAKPFFPGVECKWGEA  63

Query  293  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  472
            GL++I+ D SI  V VV+AGQ QV+MSLRLL  GKHVLQEKPAAA + E + A+  Y SL
Sbjct  64   GLDDIVGDASIAAVMVVIAGQAQVDMSLRLLSAGKHVLQEKPAAASVNELQKAISGYQSL  123

Query  473  STNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
             +     PIWAVAENYRFEPAF E +K++ E
Sbjct  124  PS----APIWAVAENYRFEPAFVEGRKLMTE  150



>ref|XP_004169964.1| PREDICTED: uncharacterized protein LOC101228167 [Cucumis sativus]
Length=110

 Score =   117 bits (292),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQ  409
            WG AGL++II+D+SI+GVAVV+AGQ QV+MSLRLLK GKHVLQ
Sbjct  62   WGDAGLDDIIQDSSILGVAVVLAGQAQVDMSLRLLKAGKHVLQ  104



>ref|XP_003597479.1| Oxidoreductase, putative [Medicago truncatula]
 gb|AES67730.1| oxidoreductase family, NAD-binding rossmann fold protein [Medicago 
truncatula]
Length=356

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +2

Query  113  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFP-NVECKWGG  289
            QIAILG+G FVK QY+PRL+EIS LF LK+IWSR+++SA +AVE+A   F  NVE K+G 
Sbjct  5    QIAILGAGTFVKHQYLPRLSEISHLFNLKSIWSRTQDSANAAVEIANKLFGGNVESKFGD  64

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GL +II+D+SI  V VV+AGQ QV++SL+LLK GKHVLQEKPAA+ I E E AL +Y S
Sbjct  65   NGLNDIIQDSSITAVLVVLAGQYQVDISLKLLKAGKHVLQEKPAASGINELETALSNYKS  124

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +S +   + IW+VAENYRFEPA  E KK+IA+
Sbjct  125  ISADAPGQIIWSVAENYRFEPALVEGKKLIAD  156



>ref|XP_004142242.1| PREDICTED: uncharacterized LOC101204258 [Cucumis sativus]
Length=220

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  101  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  281  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQ  409
            WG AGL++II+D+SI+GVAVV+AGQ QV+MSLRLLK GKHVLQ
Sbjct  62   WGDAGLDDIIQDSSILGVAVVLAGQAQVDMSLRLLKAGKHVLQ  104



>ref|XP_001754780.1| predicted protein [Physcomitrella patens]
 gb|EDQ80234.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  289
            P +A+LGSGIF  +QY+P+L E+S++  L+ IWSRSE+ A+ A+  AR++ PNVE KWG 
Sbjct  6    PGLALLGSGIFASSQYLPKLGELSEVISLRVIWSRSEDGAKKALLSARSYAPNVEAKWGQ  65

Query  290  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  469
             GLE I++D SI  VA+V+  Q Q+E+ LR L+ GKHV+QEKP  A +A+   A   Y +
Sbjct  66   EGLEAILQDKSIQAVAIVLPAQHQLELVLRALEAGKHVIQEKPVGASVADVRKAWSTYQA  125

Query  470  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L+ N  + PIWAVAENYRFEPA  +  K   E
Sbjct  126  LAVNDKKLPIWAVAENYRFEPALIQTGKFAKE  157



>ref|XP_001762266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73058.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 107/153 (70%), Gaps = 0/153 (0%)
 Frame = +2

Query  107  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  286
            +P +A+LGSGIF  +QYIP+L E+  +  L  IWSRSE+ A+ A++LA+++ PN E KWG
Sbjct  5    IPGLALLGSGIFASSQYIPKLGELGGIVSLNTIWSRSEDGAKKALQLAKSYAPNAEAKWG  64

Query  287  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  466
              GLE I++D SI  VAVV+  Q Q+E+ LR L+ GKHV+QEKP    +A+  +A   Y 
Sbjct  65   QEGLESILQDKSIHAVAVVLPAQHQLEIVLRALEAGKHVIQEKPVGPSVADVRSAWSAYQ  124

Query  467  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +L+ N T+ PIWAVAENYRFEPA  +  K + E
Sbjct  125  ALAKNDTKLPIWAVAENYRFEPALIQAGKFVKE  157



>ref|XP_001776337.1| predicted protein [Physcomitrella patens]
 gb|EDQ58836.1| predicted protein [Physcomitrella patens]
Length=366

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  104  QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW  283
            +LP IA+LG G+F +  YIP L+ +S +  L+ +WSRSE  AR   E   +  P+VE +W
Sbjct  9    RLPAIALLGCGVFARDAYIPVLSSLSPIASLRYVWSRSEFKARQMQENVLHFAPDVEAEW  68

Query  284  GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHY  463
            G AGLE I+    +   AV +   TQ  +  R L+ GKHVLQEKP A  +     ++  Y
Sbjct  69   GDAGLEIILSSQLVHCCAVALPILTQPAVVTRALRAGKHVLQEKPVAGSVEIGLKSMSFY  128

Query  464  NSLSTNMTQKPIWAVAENYRFEPAFTECKKMI  559
            +SL +     PIW VAENYRFEPAF +   M+
Sbjct  129  HSLPS---PAPIWTVAENYRFEPAFHDAAAMV  157



>ref|XP_002981277.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
 gb|EFJ17465.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
Length=338

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 92/157 (59%), Gaps = 14/157 (9%)
 Frame = +2

Query  104  QLPQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECK  280
             +P +AILG+GIF  +QY+P L+ + S   +LKAIWSRS+++A +A       FP+V  K
Sbjct  3    SVPGVAILGAGIFTTSQYLPILSNQSSTAPILKAIWSRSKDAAENAASSVAKFFPDVVAK  62

Query  281  WGGAGLEEIIKDtsiigva----vvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaen  448
            WG  GL +I++D+SI  VA      V    +  +SLR LK GKHVLQ             
Sbjct  63   WGEDGLIQILEDSSIHAVAIVLPAQVQVFKRYSISLRALKSGKHVLQALSDVRD------  116

Query  449  aLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMI  559
             ++ Y+S     +Q P+WAVAENYRFEP   E  +++
Sbjct  117  -VLSYHS--GMGSQAPVWAVAENYRFEPGLIEAARLV  150



>ref|XP_002969664.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
 gb|EFJ28788.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
Length=348

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 92/157 (59%), Gaps = 14/157 (9%)
 Frame = +2

Query  104  QLPQIAILGSGIFVKTQYIPRLAEISQLF-VLKAIWsrseesarsavelarNHFPNVECK  280
             +P +AILG+GIF  +QY+P L++ S    +LKAIWSRS+++A +A  L    FP+V  K
Sbjct  3    SVPGVAILGAGIFTTSQYLPILSKQSSTAPILKAIWSRSKDAAENAASLVAKFFPDVVAK  62

Query  281  WGGAGLEEIIKDtsiigva----vvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaen  448
            WG  GL +I++D+SI  VA      V       +SLR LK GKHVLQ             
Sbjct  63   WGEDGLIQILEDSSIHAVAIVLPAQVQVFKLYSISLRALKSGKHVLQALSDVRD------  116

Query  449  aLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMI  559
             ++ Y+S     +Q P+WAVAENYRFEP   E  +++
Sbjct  117  -VLSYHS--GMGSQAPVWAVAENYRFEPGLIEAARLV  150



>ref|XP_002973220.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
 gb|EFJ25594.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
Length=349

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  286
            P +A++G G F + QY P  + +++ +  LKA+WSRS+ESA  +V L ++  P V+ KWG
Sbjct  3    PSLALIGVGNFAQKQYFPLFSTKLTDVVSLKALWSRSQESAERSVSLIKDCVPGVQAKWG  62

Query  287  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  466
              GL++I+ D +I+GVA+V+  Q Q E  ++ LK GKHV+QEKP A    +A++    Y 
Sbjct  63   QQGLDDILNDDTILGVAIVLQPQVQGEFVMQALKAGKHVIQEKPIAPSTQQAQSLTSFYE  122

Query  467  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            SL T    +P+WA+AENYRFE A  E  K++ +
Sbjct  123  SLGT---MRPVWAIAENYRFERALVEAHKLVKD  152



>ref|XP_002976631.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
 gb|EFJ22300.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
Length=341

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  286
            P +A++G G F + QY P  + +++ +  LKA+WSRS+ESA  +V L ++  P V+ KWG
Sbjct  3    PSLALIGVGNFAQKQYFPLFSTKLTDVVSLKALWSRSQESAERSVSLIKDCVPGVQPKWG  62

Query  287  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  466
              GL++I+ D +I+ VA+V+  Q Q E  ++ LK GKHV+QEKP A    +A+     Y 
Sbjct  63   QQGLDDILSDDTILAVAIVLQPQVQGEFVMQALKAGKHVIQEKPIAPSTQQAQGLTSFYE  122

Query  467  SLSTNMTQKPIWAVAENYRFEPAFTECKKM  556
            SL T    +P+WA+AENYRFE A  E  K+
Sbjct  123  SLGT---MRPVWAIAENYRFERALVEAHKL  149



>ref|XP_002973823.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
 ref|XP_002983567.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ15468.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ24778.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
Length=341

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 95/153 (62%), Gaps = 4/153 (3%)
 Frame = +2

Query  110  PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  286
            P  A++G+G F K QY+P L+ ++      KAIWSRS+ESA SAV L ++  P V+ KWG
Sbjct  3    PGFALIGAGGFAKKQYLPLLSTKLMDRVSFKAIWSRSQESAESAVSLIKDRVPEVQPKWG  62

Query  287  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  466
              G  +I+ D SIIGVA+V+  + Q   +++ L  GKHVLQEKP A    +A++ +  Y 
Sbjct  63   EEGFNDILMDNSIIGVAIVLEPEIQGTYAIQALTAGKHVLQEKPLAPSTQKAQSLVNLYK  122

Query  467  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
             L  +   K +WA+ ENYRFE A  E  K++ +
Sbjct  123  GLDND---KLVWAIGENYRFEQALAEASKLVKD  152



>gb|KJB66094.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=288

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +2

Query  365  EMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFTE  544
            ++SL+LLK GKHV+QEKPAA  I E E AL  Y S+STN  Q PIWAVAENYRFEPAF E
Sbjct  20   DISLKLLKAGKHVIQEKPAATSIPEIETALASYKSVSTNPGQ-PIWAVAENYRFEPAFVE  78

Query  545  CKKMIA  562
             KK++A
Sbjct  79   SKKLVA  84



>ref|XP_004152962.1| PREDICTED: uncharacterized protein LOC101204258, partial [Cucumis 
sativus]
Length=81

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L +Y SLS N +++ +WAVAENYRFEPAF ECK +IA+
Sbjct  8    LSNYKSLSANFSRQRLWAVAENYRFEPAFVECKNLIAD  45



>ref|XP_004162028.1| PREDICTED: uncharacterized LOC101204258, partial [Cucumis sativus]
Length=244

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            L +Y SLS N +++ +WAVAENYRFEPAF ECK +IA+
Sbjct  8    LSNYKSLSANFSRQRLWAVAENYRFEPAFVECKNLIAD  45



>gb|KJB66101.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=259

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +2

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  562
            L  Y S+STN  Q PIWAVAENYRFEPAF E KK++A
Sbjct  20   LASYKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVA  55



>gb|ERT01696.1| hypothetical protein HMPREF1624_02949 [Sporothrix schenckii ATCC 
58251]
Length=369

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 81/142 (57%), Gaps = 12/142 (8%)
 Frame = +2

Query  116  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW----  283
            IA+LG+GIF + Q++P + + S L  LKA++SRS+ SA +    A    P ++  W    
Sbjct  5    IALLGAGIFAQAQHLPAI-KASDLLALKAVYSRSQASAEAFASKA--GVPGLDVYWDEPA  61

Query  284  -GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
              G GL +++  + +  V+V +    Q +     L  GKHV+ EKP A  +A A+  +  
Sbjct  62   AAGRGLADLLARSDVAAVSVCMPINLQPQAIRAALAAGKHVISEKPVADTVAHAQALIAD  121

Query  461  YNSLSTNMTQKPIWAVAENYRF  526
            Y++L     +KPIWAVAENYR+
Sbjct  122  YDALP----RKPIWAVAENYRY  139



>gb|KIH93169.1| hypothetical protein SPBR_02922 [Sporothrix brasiliensis 5110]
Length=369

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 81/142 (57%), Gaps = 12/142 (8%)
 Frame = +2

Query  116  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW----  283
            IA+LG+GIF + Q++P + + S L  LKA++SRS+ SA +    A    P ++  W    
Sbjct  5    IALLGAGIFAQAQHLPAI-KASDLLALKAVYSRSQASAEAFASKA--GVPGLDVYWDEPA  61

Query  284  -GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  460
              G GL +++  + +  V+V +    Q +     L  GKHV+ EKP A  +A A+  +  
Sbjct  62   AAGRGLADLLARSDVAAVSVCMPINLQPQAIRAALAAGKHVISEKPVADTVAHAQALIAD  121

Query  461  YNSLSTNMTQKPIWAVAENYRF  526
            Y++L     +KPIWAVAENYR+
Sbjct  122  YDALP----RKPIWAVAENYRY  139



>gb|EFQ28397.1| oxidoreductase family protein [Colletotrichum graminicola M1.001]
Length=347

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 83/151 (55%), Gaps = 6/151 (4%)
 Frame = +2

Query  116  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHF-PNVECKWGGA  292
            +AI+G GIF K Q++P + E S    LKAI+SRS +SA    +LA N   P++     G 
Sbjct  6    VAIVGGGIFAKEQHLPAV-EASDQLTLKAIYSRSRKSAEDTAKLATNSASPDLYSDDSGD  64

Query  293  G--LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  466
            G   E+++    I  + + +    Q E   + L  GKHVL EKP A  +A A+  + +YN
Sbjct  65   GKSFEDLLARDDIQALILALPIVNQPEYIEKALAAGKHVLAEKPIAPDVARAQKLIDYYN  124

Query  467  SLSTNMTQKPIWAVAENYRFEPAFTECKKMI  559
             +S    +   +AVAENYRF+P +T  +  +
Sbjct  125  KVSAE--KGVTFAVAENYRFQPRYTAARDEV  153



>ref|XP_010466287.1| PREDICTED: uncharacterized protein LOC104746495 [Camelina sativa]
Length=235

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE  565
            +  Y  +S +   +PIWAVAENYRFEPAF E KK++ E
Sbjct  1    MSSYREISADSPSRPIWAVAENYRFEPAFVELKKLMVE  38



>ref|XP_571074.1| hypothetical protein [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_775145.1| hypothetical protein CNBE4190 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL20498.1| hypothetical protein CNBE4190 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW43767.1| conserved hypothetical protein [Cryptococcus neoformans var. 
neoformans JEC21]
Length=400

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 81/157 (52%), Gaps = 11/157 (7%)
 Frame = +2

Query  113  QIAILGSGIFVKTQYIPRLAEISQL--FVLKAIWsrseesarsavelarN-HFPNVECKW  283
             +A+LGSG+F +  Y+P L  +++    VL  IWSRSE SA++  +   +   P+ +  +
Sbjct  4    NVALLGSGVFAQASYVPALLSLARFRTLVLHTIWSRSESSAQTLHDKYTSVGAPSPQLLY  63

Query  284  GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHY  463
            G  GLE ++ +  I  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y
Sbjct  64   GDDGLEAVLANKEIDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVKEAMELIEEY  123

Query  464  NSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE  565
                     KP   IW VAENY  EPA      ++A+
Sbjct  124  ER-----DYKPKGLIWRVAENYAHEPALRFAGDILAK  155



>gb|KIR84978.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
IND107]
Length=400

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 80/157 (51%), Gaps = 11/157 (7%)
 Frame = +2

Query  113  QIAILGSGIFVKTQYIPRLAEISQL--FVLKAIWsrseesarsavelarNH-FPNVECKW  283
             +A+LGSG+F +  Y+P L  +++    VL  IWSRSE SA++      +   P+ +  +
Sbjct  4    NVALLGSGVFAQASYVPALLSLARFKTLVLHTIWSRSESSAQTLHAKYTSSGAPSPQLLY  63

Query  284  GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHY  463
            G  GLE ++ +  I  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y
Sbjct  64   GEDGLEAVLANKEIDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVQEAMELIEEY  123

Query  464  NSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE  565
                     KP   IW VAENY  EPA      ++A+
Sbjct  124  ER-----DYKPKGLIWRVAENYAHEPALRFAGDILAK  155



>gb|KIR46111.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1280]
 gb|KIR58861.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1873]
Length=400

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 80/157 (51%), Gaps = 11/157 (7%)
 Frame = +2

Query  113  QIAILGSGIFVKTQYIPRLAEISQL--FVLKAIWsrseesarsavelarNH-FPNVECKW  283
             +A+LGSG+F +  Y+P L  +++    VL  IWSRSE SA++      +   P+ +  +
Sbjct  4    NVALLGSGVFAQASYVPALLSLARFKTLVLHTIWSRSESSAQTLHAKYTSSGAPSPQLLY  63

Query  284  GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHY  463
            G  GLE ++ +  I  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y
Sbjct  64   GEDGLEAVLANKEIDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVKEAMELIEEY  123

Query  464  NSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE  565
                     KP   IW VAENY  EPA      ++A+
Sbjct  124  -----ERDYKPKGLIWRVAENYAHEPALRFAGDILAK  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920