BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024B02

Length=700
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KEH40770.1|  long-chain fatty acyl CoA ligase                      81.6    3e-14   Medicago truncatula
emb|CDO97106.1|  unnamed protein product                              81.3    4e-14   Coffea canephora [robusta coffee]
gb|KDO51414.1|  hypothetical protein CISIN_1g010455mg                 79.3    5e-14   Citrus sinensis [apfelsine]
ref|XP_009618633.1|  PREDICTED: long chain acyl-CoA synthetase 2      80.9    6e-14   Nicotiana tomentosiformis
ref|XP_006423162.1|  hypothetical protein CICLE_v10027967mg           79.7    8e-14   
ref|XP_009803020.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...  79.7    9e-14   Nicotiana sylvestris
gb|KDO51413.1|  hypothetical protein CISIN_1g010455mg                 79.3    9e-14   Citrus sinensis [apfelsine]
ref|XP_006423160.1|  hypothetical protein CICLE_v10027967mg           79.7    1e-13   
gb|KDO51411.1|  hypothetical protein CISIN_1g010455mg                 79.3    1e-13   Citrus sinensis [apfelsine]
ref|XP_009803019.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...  79.7    1e-13   Nicotiana sylvestris
gb|KDO51412.1|  hypothetical protein CISIN_1g010455mg                 79.3    1e-13   Citrus sinensis [apfelsine]
gb|KDO51409.1|  hypothetical protein CISIN_1g010455mg                 79.3    2e-13   Citrus sinensis [apfelsine]
ref|XP_006423161.1|  hypothetical protein CICLE_v10027967mg           79.7    2e-13   Citrus clementina [clementine]
ref|XP_002313075.1|  LONG-CHAIN ACYL-COA SYNTHETASE 2 family protein  77.8    5e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010999563.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...  77.8    6e-13   Populus euphratica
ref|XP_010999571.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...  77.8    6e-13   Populus euphratica
ref|XP_008236729.1|  PREDICTED: long chain acyl-CoA synthetase 2      77.4    8e-13   Prunus mume [ume]
ref|XP_006365488.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  77.4    8e-13   Solanum tuberosum [potatoes]
ref|XP_007201738.1|  hypothetical protein PRUPE_ppa002568mg           77.4    8e-13   Prunus persica
gb|KDP46197.1|  hypothetical protein JCGZ_10037                       76.3    2e-12   Jatropha curcas
ref|XP_003530335.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  74.7    6e-12   Glycine max [soybeans]
ref|XP_004230844.1|  PREDICTED: long chain acyl-CoA synthetase 2      74.7    7e-12   Solanum lycopersicum
ref|XP_007153144.1|  hypothetical protein PHAVU_003G010600g           74.3    7e-12   Phaseolus vulgaris [French bean]
ref|XP_009375321.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  74.3    8e-12   Pyrus x bretschneideri [bai li]
ref|XP_009375329.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  74.3    9e-12   
ref|XP_011088325.1|  PREDICTED: long chain acyl-CoA synthetase 2      73.6    1e-11   Sesamum indicum [beniseed]
ref|XP_009345813.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  73.6    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_009345814.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  73.6    2e-11   Pyrus x bretschneideri [bai li]
gb|KEH30360.1|  long-chain fatty acyl CoA ligase                      73.2    2e-11   Medicago truncatula
ref|XP_004309440.1|  PREDICTED: long chain acyl-CoA synthetase 2      73.2    2e-11   Fragaria vesca subsp. vesca
ref|XP_009345786.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  72.4    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_009411351.1|  PREDICTED: long chain acyl-CoA synthetase 2      72.4    3e-11   
ref|XP_008387336.1|  PREDICTED: long chain acyl-CoA synthetase 2      72.4    4e-11   Malus domestica [apple tree]
ref|XP_008776876.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...  72.0    5e-11   
ref|XP_008776875.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...  72.0    5e-11   Phoenix dactylifera
ref|XP_007131884.1|  hypothetical protein PHAVU_011G049400g           72.0    5e-11   Phaseolus vulgaris [French bean]
ref|XP_004507386.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  71.6    7e-11   Cicer arietinum [garbanzo]
ref|XP_004507385.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  71.6    7e-11   
ref|XP_010909564.1|  PREDICTED: long chain acyl-CoA synthetase 2      70.9    1e-10   Elaeis guineensis
ref|XP_010255020.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...  70.9    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_003555665.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  70.5    1e-10   Glycine max [soybeans]
gb|KHM99019.1|  Long chain acyl-CoA synthetase 2                      70.5    1e-10   Glycine soja [wild soybean]
ref|XP_003540684.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  70.1    2e-10   Glycine max [soybeans]
gb|KHN25339.1|  Long chain acyl-CoA synthetase 2                      70.1    2e-10   Glycine soja [wild soybean]
ref|XP_003539030.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  69.3    3e-10   Glycine max [soybeans]
dbj|BAJ88162.1|  predicted protein                                    69.3    4e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004498183.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  69.3    4e-10   
ref|XP_007041379.1|  Long-chain acyl-CoA synthetase 2 isoform 2       68.9    4e-10   
ref|XP_004498184.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  68.9    4e-10   Cicer arietinum [garbanzo]
ref|XP_006856178.1|  hypothetical protein AMTR_s00059p00179300        68.9    4e-10   Amborella trichopoda
ref|XP_007041378.1|  Long-chain acyl-CoA synthetase 2 isoform 1       68.9    4e-10   Theobroma cacao [chocolate]
ref|XP_004979485.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  68.6    6e-10   Setaria italica
gb|AGA17923.1|  CCL6                                                  68.2    7e-10   Humulus lupulus [common hop]
gb|KJB16145.1|  hypothetical protein B456_002G214200                  68.6    7e-10   Gossypium raimondii
gb|KJB16144.1|  hypothetical protein B456_002G214200                  68.2    7e-10   Gossypium raimondii
gb|KJB16142.1|  hypothetical protein B456_002G214200                  68.2    8e-10   Gossypium raimondii
ref|XP_010096242.1|  Long chain acyl-CoA synthetase 2                 67.8    1e-09   Morus notabilis
gb|EYU37741.1|  hypothetical protein MIMGU_mgv1a002552mg              66.6    3e-09   Erythranthe guttata [common monkey flower]
ref|XP_002519120.1|  acyl CoA synthetase, putative                    65.9    5e-09   
ref|XP_002281151.1|  PREDICTED: long chain acyl-CoA synthetase 2      65.5    6e-09   Vitis vinifera
ref|XP_006663529.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  65.1    8e-09   Oryza brachyantha
ref|XP_003577452.1|  PREDICTED: long chain acyl-CoA synthetase 2      64.3    1e-08   Brachypodium distachyon [annual false brome]
gb|ABG22526.1|  AMP-binding enzyme family protein, expressed          64.3    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001068097.1|  Os11g0558300                                     64.3    2e-08   
gb|EMT18517.1|  Fatty acyl-CoA synthetase B                           63.9    2e-08   
ref|XP_002449702.1|  hypothetical protein SORBIDRAFT_05g021840        63.2    3e-08   
gb|KFK36012.1|  hypothetical protein AALP_AA4G066600                  63.2    4e-08   Arabis alpina [alpine rockcress]
ref|XP_006393257.1|  hypothetical protein EUTSA_v10011292mg           62.8    5e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010690967.1|  PREDICTED: long chain acyl-CoA synthetase 2      62.8    5e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010479377.1|  PREDICTED: long chain acyl-CoA synthetase 2      62.8    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002891504.1|  long-chain acyl-CoA synthetase 2                 62.4    5e-08   
gb|ACL54548.1|  unknown                                               62.0    7e-08   Zea mays [maize]
ref|NP_001148177.1|  LOC100281785                                     62.0    7e-08   Zea mays [maize]
gb|KHG27706.1|  Long chain acyl-CoA synthetase 2 -like protein        62.0    9e-08   Gossypium arboreum [tree cotton]
ref|NP_175368.2|  long-chain acyl-CoA synthetase 2                    61.6    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010065425.1|  PREDICTED: long chain acyl-CoA synthetase 2      61.6    1e-07   Eucalyptus grandis [rose gum]
emb|CAA96523.1|  acyl CoA synthetase                                  61.6    1e-07   Brassica napus [oilseed rape]
gb|KCW62899.1|  hypothetical protein EUGRSUZ_G00490                   61.2    1e-07   Eucalyptus grandis [rose gum]
emb|CDY59237.1|  BnaC05g51350D                                        61.2    1e-07   Brassica napus [oilseed rape]
ref|XP_010501911.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  61.2    1e-07   
ref|XP_010461777.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  61.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006303931.1|  hypothetical protein CARUB_v10008590mg           61.2    1e-07   
ref|XP_009144978.1|  PREDICTED: long chain acyl-CoA synthetase 2      60.1    4e-07   Brassica rapa
ref|XP_008459243.1|  PREDICTED: long chain acyl-CoA synthetase 2      59.7    5e-07   Cucumis melo [Oriental melon]
ref|XP_004145346.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  59.7    5e-07   
gb|EPS68372.1|  hypothetical protein M569_06390                       59.7    5e-07   Genlisea aurea
ref|XP_004154333.1|  PREDICTED: long chain acyl-CoA synthetase 2-...  59.7    5e-07   
ref|XP_011093712.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  56.2    7e-06   Sesamum indicum [beniseed]
ref|XP_011093703.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  56.2    7e-06   Sesamum indicum [beniseed]
ref|XP_006285040.1|  hypothetical protein CARUB_v10006348mg           55.1    2e-05   
ref|XP_010525687.1|  PREDICTED: long chain acyl-CoA synthetase 2      55.1    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_001777237.1|  predicted protein                                54.7    2e-05   
ref|XP_006850521.1|  hypothetical protein AMTR_s00159p00012160        54.3    3e-05   Amborella trichopoda
ref|XP_006413507.1|  hypothetical protein EUTSA_v10024614mg           54.3    3e-05   Eutrema salsugineum [saltwater cress]
ref|XP_004298900.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  54.3    3e-05   Fragaria vesca subsp. vesca
ref|XP_010439129.1|  PREDICTED: long chain acyl-CoA synthetase 4      54.3    3e-05   Camelina sativa [gold-of-pleasure]
gb|ACC91252.1|  long-chain-fatty-acid-CoA ligase                      53.9    4e-05   Arabidopsis halleri
ref|XP_002867687.1|  long-chain-fatty-acid--CoA ligase                53.9    4e-05   
ref|XP_010448651.1|  PREDICTED: long chain acyl-CoA synthetase 4      53.5    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010433854.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  53.5    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009783796.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  53.5    5e-05   Nicotiana sylvestris
ref|XP_011101042.1|  PREDICTED: long chain acyl-CoA synthetase 4      53.5    6e-05   Sesamum indicum [beniseed]
ref|XP_009137437.1|  PREDICTED: long chain acyl-CoA synthetase 4      53.1    7e-05   Brassica rapa
ref|XP_008783866.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  52.8    1e-04   
dbj|BAF02671.1|  acyl-CoA synthetase                                  52.8    1e-04   Beta vulgaris [beet]
ref|XP_010668007.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  52.8    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_194116.1|  long chain acyl-CoA synthetase 4                    52.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EPS67806.1|  hypothetical protein M569_06966                       50.8    2e-04   Genlisea aurea
gb|KCW77383.1|  hypothetical protein EUGRSUZ_D01734                   51.6    2e-04   Eucalyptus grandis [rose gum]
gb|KCW77382.1|  hypothetical protein EUGRSUZ_D01734                   51.6    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010053129.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  51.6    3e-04   
gb|EYU32231.1|  hypothetical protein MIMGU_mgv1a002558mg              51.6    3e-04   Erythranthe guttata [common monkey flower]
gb|KCW77379.1|  hypothetical protein EUGRSUZ_D01734                   51.6    3e-04   Eucalyptus grandis [rose gum]
emb|CDY47618.1|  BnaA01g13470D                                        51.2    3e-04   Brassica napus [oilseed rape]
emb|CDP12153.1|  unnamed protein product                              51.2    3e-04   Coffea canephora [robusta coffee]
emb|CAA64327.1|  acyl-CoA synthetase                                  51.2    3e-04   Brassica napus [oilseed rape]
ref|XP_009627714.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  51.2    4e-04   Nicotiana tomentosiformis
ref|XP_008364587.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  50.1    6e-04   
ref|XP_002973766.1|  hypothetical protein SELMODRAFT_99821            50.4    7e-04   
ref|XP_002975814.1|  hypothetical protein SELMODRAFT_442966           50.4    7e-04   Selaginella moellendorffii
emb|CDM82121.1|  unnamed protein product                              50.1    8e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009786376.1|  PREDICTED: long chain acyl-CoA synthetase 4-...  50.1    8e-04   Nicotiana sylvestris
gb|ABK96686.1|  unknown                                               50.1    0.001   Populus trichocarpa x Populus deltoides



>gb|KEH40770.1| long-chain fatty acyl CoA ligase [Medicago truncatula]
Length=661

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = +1

Query  568  YVVKVEEGKPA-GDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEEG+PA  DG+PSAGPVYRCIYAKD LME+P GLESPWDF
Sbjct  5    YTVKVEEGRPATSDGRPSAGPVYRCIYAKDGLMELPTGLESPWDF  49



>emb|CDO97106.1| unnamed protein product [Coffea canephora]
Length=659

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y+V+VEEG+PA DG PSAGPVYRCIYAKD L+E+P G+ESPWDF
Sbjct  4    YIVQVEEGRPATDGMPSAGPVYRCIYAKDGLLEIPEGMESPWDF  47



>gb|KDO51414.1| hypothetical protein CISIN_1g010455mg [Citrus sinensis]
Length=341

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA DGKPS GPVYRCIYAKD L+E PAGLESPW F
Sbjct  5    YTVKVEEARPAADGKPSGGPVYRCIYAKDGLLESPAGLESPWQF  48



>ref|XP_009618633.1| PREDICTED: long chain acyl-CoA synthetase 2 [Nicotiana tomentosiformis]
Length=659

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA DGKPSAGPVYRCIYAKD LMEMP   ESPWDF
Sbjct  4    YTVKVEESRPAVDGKPSAGPVYRCIYAKDGLMEMPVSFESPWDF  47



>ref|XP_006423162.1| hypothetical protein CICLE_v10027967mg [Citrus clementina]
 gb|ESR36402.1| hypothetical protein CICLE_v10027967mg [Citrus clementina]
Length=419

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA DGKPSAGPVYRCIYAKD L+E P GLESPW F
Sbjct  5    YTVKVEEARPAADGKPSAGPVYRCIYAKDGLLESPVGLESPWQF  48



>ref|XP_009803020.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X2 [Nicotiana 
sylvestris]
Length=443

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y  KVEE +PA DGKPSAGPVYRCIYAKD LM+MP G ESPWDF
Sbjct  31   YTAKVEESRPAFDGKPSAGPVYRCIYAKDGLMDMPVGFESPWDF  74



>gb|KDO51413.1| hypothetical protein CISIN_1g010455mg [Citrus sinensis]
Length=419

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA DGKPS GPVYRCIYAKD L+E PAGLESPW F
Sbjct  5    YTVKVEEARPAADGKPSGGPVYRCIYAKDGLLESPAGLESPWQF  48



>ref|XP_006423160.1| hypothetical protein CICLE_v10027967mg [Citrus clementina]
 gb|ESR36400.1| hypothetical protein CICLE_v10027967mg [Citrus clementina]
Length=565

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA DGKPSAGPVYRCIYAKD L+E P GLESPW F
Sbjct  5    YTVKVEEARPAADGKPSAGPVYRCIYAKDGLLESPVGLESPWQF  48



>gb|KDO51411.1| hypothetical protein CISIN_1g010455mg [Citrus sinensis]
Length=501

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA DGKPS GPVYRCIYAKD L+E PAGLESPW F
Sbjct  5    YTVKVEEARPAADGKPSGGPVYRCIYAKDGLLESPAGLESPWQF  48



>ref|XP_009803019.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X1 [Nicotiana 
sylvestris]
Length=686

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y  KVEE +PA DGKPSAGPVYRCIYAKD LM+MP G ESPWDF
Sbjct  31   YTAKVEESRPAFDGKPSAGPVYRCIYAKDGLMDMPVGFESPWDF  74



>gb|KDO51412.1| hypothetical protein CISIN_1g010455mg [Citrus sinensis]
Length=510

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA DGKPS GPVYRCIYAKD L+E PAGLESPW F
Sbjct  5    YTVKVEEARPAADGKPSGGPVYRCIYAKDGLLESPAGLESPWQF  48



>gb|KDO51409.1| hypothetical protein CISIN_1g010455mg [Citrus sinensis]
 gb|KDO51410.1| hypothetical protein CISIN_1g010455mg [Citrus sinensis]
Length=508

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA DGKPS GPVYRCIYAKD L+E PAGLESPW F
Sbjct  5    YTVKVEEARPAADGKPSGGPVYRCIYAKDGLLESPAGLESPWQF  48



>ref|XP_006423161.1| hypothetical protein CICLE_v10027967mg [Citrus clementina]
 ref|XP_006479352.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Citrus sinensis]
 gb|ESR36401.1| hypothetical protein CICLE_v10027967mg [Citrus clementina]
Length=661

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA DGKPSAGPVYRCIYAKD L+E P GLESPW F
Sbjct  5    YTVKVEEARPAADGKPSAGPVYRCIYAKDGLLESPVGLESPWQF  48



>ref|XP_002313075.1| LONG-CHAIN ACYL-COA SYNTHETASE 2 family protein [Populus trichocarpa]
 gb|EEE87030.1| LONG-CHAIN ACYL-COA SYNTHETASE 2 family protein [Populus trichocarpa]
Length=658

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++VKVEE +PA DGKPSAGPVYR IYAKD LM++PAGLESPW F
Sbjct  3    FIVKVEESRPASDGKPSAGPVYRSIYAKDGLMDLPAGLESPWQF  46



>ref|XP_010999563.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X1 [Populus 
euphratica]
Length=661

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++VKVEE +PA DGKPSAGPVYR IYAKD LM++PAGLESPW F
Sbjct  5    FIVKVEESRPASDGKPSAGPVYRSIYAKDGLMDLPAGLESPWQF  48



>ref|XP_010999571.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X2 [Populus 
euphratica]
Length=660

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++VKVEE +PA DGKPSAGPVYR IYAKD LM++PAGLESPW F
Sbjct  5    FIVKVEESRPASDGKPSAGPVYRSIYAKDGLMDLPAGLESPWQF  48



>ref|XP_008236729.1| PREDICTED: long chain acyl-CoA synthetase 2 [Prunus mume]
Length=658

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++VKVEE +PA DG+PSAGPVYR IYAKD LME+P GLESPW F
Sbjct  3    FIVKVEESRPAADGRPSAGPVYRSIYAKDGLMELPEGLESPWQF  46



>ref|XP_006365488.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365489.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006365490.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X3 [Solanum 
tuberosum]
Length=659

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA DGKPSAGPVYR IYAKD LMEMP   ESPWDF
Sbjct  4    YTVKVEESRPAADGKPSAGPVYRNIYAKDGLMEMPTRFESPWDF  47



>ref|XP_007201738.1| hypothetical protein PRUPE_ppa002568mg [Prunus persica]
 gb|EMJ02937.1| hypothetical protein PRUPE_ppa002568mg [Prunus persica]
Length=658

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++VKVEE +PA DG+PSAGPVYR IYAKD LME+P GLESPW F
Sbjct  3    FIVKVEESRPAADGRPSAGPVYRSIYAKDGLMELPEGLESPWQF  46



>gb|KDP46197.1| hypothetical protein JCGZ_10037 [Jatropha curcas]
Length=660

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y+VKVEE K + DGKPS GPV+RCIYAKD L+E+PAGL+SPW F
Sbjct  5    YIVKVEEAKASSDGKPSTGPVFRCIYAKDGLLEVPAGLDSPWQF  48



>ref|XP_003530335.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Glycine max]
 gb|KHN42564.1| Long chain acyl-CoA synthetase 2 [Glycine soja]
Length=660

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEEG+PA D KPSAGPVYR IYAKD L+E+P+  ESPWDF
Sbjct  5    YTVKVEEGRPATDAKPSAGPVYRSIYAKDGLLEVPSDFESPWDF  48



>ref|XP_004230844.1| PREDICTED: long chain acyl-CoA synthetase 2 [Solanum lycopersicum]
Length=659

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +P  DGKPSAGPVYR IYAKD LMEMP   ESPWDF
Sbjct  4    YTVKVEETRPPSDGKPSAGPVYRNIYAKDGLMEMPTRFESPWDF  47



>ref|XP_007153144.1| hypothetical protein PHAVU_003G010600g [Phaseolus vulgaris]
 gb|ESW25138.1| hypothetical protein PHAVU_003G010600g [Phaseolus vulgaris]
Length=660

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            + VKVEEG PA DGKPSAGPVYR IYAK+ L+E+P+ LESPWDF
Sbjct  5    FTVKVEEGSPATDGKPSAGPVYRSIYAKEGLLEVPSDLESPWDF  48



>ref|XP_009375321.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Pyrus x bretschneideri]
Length=658

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++VKVEE +PA +G+P+AGPVYR IYAKD LME+P GLESPW F
Sbjct  3    FIVKVEESRPAANGRPAAGPVYRSIYAKDGLMELPEGLESPWQF  46



>ref|XP_009375329.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Pyrus x bretschneideri]
Length=659

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++VKVEE +PA +G+P+AGPVYR IYAKD LME+P GLESPW F
Sbjct  3    FIVKVEESRPAANGRPAAGPVYRSIYAKDGLMELPEGLESPWQF  46



>ref|XP_011088325.1| PREDICTED: long chain acyl-CoA synthetase 2 [Sesamum indicum]
Length=659

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            YVVKVE+G+ A DGKPSAGPVYRCIYAKD L+++P   +SPW+F
Sbjct  4    YVVKVEDGRGASDGKPSAGPVYRCIYAKDGLLDIPTHFDSPWNF  47



>ref|XP_009345813.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=658

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +VVKVEE +PA D +PSAGPVYR IYAKD LME+P GLESPW F
Sbjct  3    FVVKVEESRPAADERPSAGPVYRGIYAKDGLMELPEGLESPWQF  46



>ref|XP_009345814.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=641

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +VVKVEE +PA D +PSAGPVYR IYAKD LME+P GLESPW F
Sbjct  3    FVVKVEESRPAADERPSAGPVYRGIYAKDGLMELPEGLESPWQF  46



>gb|KEH30360.1| long-chain fatty acyl CoA ligase [Medicago truncatula]
Length=659

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA   KPSAGPVYRCIYAKD L+E+P+  +SPWDF
Sbjct  5    YTVKVEEARPASHEKPSAGPVYRCIYAKDGLLELPSHFQSPWDF  48



>ref|XP_004309440.1| PREDICTED: long chain acyl-CoA synthetase 2 [Fragaria vesca subsp. 
vesca]
Length=659

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            + VKVEE +PA DG+PSAGPVYR IYAKD L+E+P GL+SPW F
Sbjct  4    FAVKVEEARPAADGRPSAGPVYRSIYAKDGLLELPEGLDSPWQF  47



>ref|XP_009345786.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Pyrus x bretschneideri]
Length=658

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++VKVEE +PA +G+P+AGP YR IYAKD LME+P GLESPW F
Sbjct  3    FIVKVEESRPAANGRPAAGPAYRSIYAKDGLMELPEGLESPWQF  46



>ref|XP_009411351.1| PREDICTED: long chain acyl-CoA synthetase 2 [Musa acuminata subsp. 
malaccensis]
Length=654

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y ++VEEGKP    KPS GPVYRCIYAKD L+E P G++SPWDF
Sbjct  4    YTIQVEEGKPTVGNKPSCGPVYRCIYAKDGLLESPVGIDSPWDF  47



>ref|XP_008387336.1| PREDICTED: long chain acyl-CoA synthetase 2 [Malus domestica]
Length=658

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++VKVEE +PA +G+PSAGP YR IYAKD LME+P GLESPW F
Sbjct  3    FIVKVEEPRPAANGRPSAGPAYRSIYAKDGLMELPEGLESPWQF  46



>ref|XP_008776876.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X2 [Phoenix 
dactylifera]
Length=622

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA   KPSAGPVYR IYA+D L+E+PAG++SPWDF
Sbjct  4    YSVKVEESRPAAGNKPSAGPVYRSIYARDGLLELPAGIDSPWDF  47



>ref|XP_008776875.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X1 [Phoenix 
dactylifera]
Length=659

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA   KPSAGPVYR IYA+D L+E+PAG++SPWDF
Sbjct  4    YSVKVEESRPAAGNKPSAGPVYRSIYARDGLLELPAGIDSPWDF  47



>ref|XP_007131884.1| hypothetical protein PHAVU_011G049400g [Phaseolus vulgaris]
 gb|ESW03878.1| hypothetical protein PHAVU_011G049400g [Phaseolus vulgaris]
Length=656

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +   D KPSAGPVYRCIYA+D LME+P+  ESPWDF
Sbjct  5    YTVKVEEARLETDEKPSAGPVYRCIYARDGLMELPSHFESPWDF  48



>ref|XP_004507386.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X2 [Cicer 
arietinum]
Length=660

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA   KPSAGPVYRCIYAKD L+E+P   +SPWDF
Sbjct  6    YTVKVEEARPATHEKPSAGPVYRCIYAKDGLLELPPHFQSPWDF  49



>ref|XP_004507385.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X1 [Cicer 
arietinum]
Length=692

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA   KPSAGPVYRCIYAKD L+E+P   +SPWDF
Sbjct  6    YTVKVEEARPATHEKPSAGPVYRCIYAKDGLLELPPHFQSPWDF  49



>ref|XP_010909564.1| PREDICTED: long chain acyl-CoA synthetase 2 [Elaeis guineensis]
Length=659

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA   KPSAGPVYR IYA+D L+E+P+G++SPWDF
Sbjct  4    YSVKVEESRPAAGNKPSAGPVYRSIYARDGLLELPSGIDSPWDF  47



>ref|XP_010255020.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X1 [Nelumbo 
nucifera]
Length=661

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIY--AKDALMEMPAGLESPWDF  699
            + VKVEE +PA  GKPSAGPVYRCIY  AKD LME P G+ESPW+F
Sbjct  4    FTVKVEEARPALGGKPSAGPVYRCIYANAKDGLMEFPTGMESPWEF  49



>ref|XP_003555665.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Glycine max]
Length=660

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEEG+ A DGKPS GPVYR IYAKD L+E+P+  +SPWDF
Sbjct  5    YTVKVEEGRLATDGKPSVGPVYRSIYAKDGLLEVPSDFKSPWDF  48



>gb|KHM99019.1| Long chain acyl-CoA synthetase 2 [Glycine soja]
Length=602

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEEG+ A DGKPS GPVYR IYAKD L+E+P+  +SPWDF
Sbjct  5    YTVKVEEGRLATDGKPSVGPVYRSIYAKDGLLEVPSDFKSPWDF  48



>ref|XP_003540684.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X1 [Glycine 
max]
Length=656

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA   KPSAGPVYRCIYAKDAL  +P+  ESPW+F
Sbjct  5    YTVKVEEARPATHEKPSAGPVYRCIYAKDALTVLPSHFESPWEF  48



>gb|KHN25339.1| Long chain acyl-CoA synthetase 2 [Glycine soja]
Length=656

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA   KPSAGPVYRCIYAKDAL  +P+  ESPW+F
Sbjct  5    YTVKVEEARPATHEKPSAGPVYRCIYAKDALTVLPSHFESPWEF  48



>ref|XP_003539030.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Glycine max]
Length=656

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA   KPSAGPVYRCIYAKDAL ++P+  +SPW F
Sbjct  5    YSVKVEEARPATHEKPSAGPVYRCIYAKDALTQLPSHFQSPWQF  48



>dbj|BAJ88162.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=662

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKV EG PAG G+P+AGPVYR IYAKD LM++P  + SPWDF
Sbjct  6    YTVKVGEGTPAGGGRPAAGPVYRSIYAKDGLMQLPQEIHSPWDF  49



>ref|XP_004498183.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X1 [Cicer 
arietinum]
Length=666

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +1

Query  568  YVVKVEEGKPA-GDGK-PSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEEG+ A  DG  PS GPVYRCIYAKD L+E+P+GL+SPWDF
Sbjct  5    YTVKVEEGRSATSDGMLPSVGPVYRCIYAKDGLLELPSGLDSPWDF  50



>ref|XP_007041379.1| Long-chain acyl-CoA synthetase 2 isoform 2 [Theobroma cacao]
 gb|EOX97210.1| Long-chain acyl-CoA synthetase 2 isoform 2 [Theobroma cacao]
Length=689

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y V+VEE +PA + KPSAGPVYRCIYAKD L+++P G  SPW+F
Sbjct  5    YAVEVEESRPATEKKPSAGPVYRCIYAKDGLLDLPEGKHSPWEF  48



>ref|XP_004498184.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X2 [Cicer 
arietinum]
Length=662

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +1

Query  568  YVVKVEEGKPA-GDGK-PSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEEG+ A  DG  PS GPVYRCIYAKD L+E+P+GL+SPWDF
Sbjct  5    YTVKVEEGRSATSDGMLPSVGPVYRCIYAKDGLLELPSGLDSPWDF  50



>ref|XP_006856178.1| hypothetical protein AMTR_s00059p00179300 [Amborella trichopoda]
 gb|ERN17645.1| hypothetical protein AMTR_s00059p00179300 [Amborella trichopoda]
Length=658

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKV E +PA   +PSAGPVYRCIYAKD LME+P G ESPWD 
Sbjct  4    YTVKVGEAEPAQGERPSAGPVYRCIYAKDGLMEVPEGFESPWDL  47



>ref|XP_007041378.1| Long-chain acyl-CoA synthetase 2 isoform 1 [Theobroma cacao]
 gb|EOX97209.1| Long-chain acyl-CoA synthetase 2 isoform 1 [Theobroma cacao]
Length=661

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y V+VEE +PA + KPSAGPVYRCIYAKD L+++P G  SPW+F
Sbjct  5    YAVEVEESRPATEKKPSAGPVYRCIYAKDGLLDLPEGKHSPWEF  48



>ref|XP_004979485.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Setaria italica]
Length=661

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            + VKVEE  PA  G+PSAGPVYR IYA+D LME+P  ++SPWDF
Sbjct  5    FTVKVEEAAPAAGGRPSAGPVYRSIYARDGLMELPQDIQSPWDF  48



>gb|AGA17923.1| CCL6 [Humulus lupulus]
Length=658

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +PA +  PSAGPVYR IYA+D L+E+P GL+SPW+F
Sbjct  3    YTVKVEEARPATEKMPSAGPVYRSIYARDGLLELPEGLQSPWEF  46



>gb|KJB16145.1| hypothetical protein B456_002G214200 [Gossypium raimondii]
Length=687

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVE+ +P    KPSAGPVYRCIYAKD L+++P G+ SPW+F
Sbjct  5    YTVKVEDSRPESGKKPSAGPVYRCIYAKDGLLDLPDGMHSPWEF  48



>gb|KJB16144.1| hypothetical protein B456_002G214200 [Gossypium raimondii]
Length=548

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVE+ +P    KPSAGPVYRCIYAKD L+++P G+ SPW+F
Sbjct  5    YTVKVEDSRPESGKKPSAGPVYRCIYAKDGLLDLPDGMHSPWEF  48



>gb|KJB16142.1| hypothetical protein B456_002G214200 [Gossypium raimondii]
Length=661

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVE+ +P    KPSAGPVYRCIYAKD L+++P G+ SPW+F
Sbjct  5    YTVKVEDSRPESGKKPSAGPVYRCIYAKDGLLDLPDGMHSPWEF  48



>ref|XP_010096242.1| Long chain acyl-CoA synthetase 2 [Morus notabilis]
 gb|EXB63637.1| Long chain acyl-CoA synthetase 2 [Morus notabilis]
Length=660

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE +P  + KPSAGP YR IYAKD L+E+P GL SPW+F
Sbjct  5    YTVKVEEARPVTEDKPSAGPAYRSIYAKDGLLELPEGLHSPWEF  48



>gb|EYU37741.1| hypothetical protein MIMGU_mgv1a002552mg [Erythranthe guttata]
Length=660

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE + AG+GKPSAGPV+R I+AK  LME+P  +ESPW+F
Sbjct  5    YTVKVEEAREAGEGKPSAGPVFRSIFAKHGLMEIPPQMESPWEF  48



>ref|XP_002519120.1| acyl CoA synthetase, putative [Ricinus communis]
 gb|EEF43331.1| acyl CoA synthetase, putative [Ricinus communis]
Length=660

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  568  YVVKVEEGKPAG-DGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y+VKVEE +PA  DGKPSAGPV+R IYAKD L+E+ A L+SPW F
Sbjct  5    YLVKVEESRPAASDGKPSAGPVFRSIYAKDGLLEVSAELDSPWQF  49



>ref|XP_002281151.1| PREDICTED: long chain acyl-CoA synthetase 2 [Vitis vinifera]
 emb|CBI32531.3| unnamed protein product [Vitis vinifera]
Length=659

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKV +  PA + +PSAGPVYRCIYA++ L+E+P G+ESPW+F
Sbjct  4    YTVKVADSIPATEERPSAGPVYRCIYAENGLLEVPKGMESPWEF  47



>ref|XP_006663529.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Oryza brachyantha]
Length=661

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKV E  PA  GKPSAGPVYR IYA+D LM++P  + SPWDF
Sbjct  5    YTVKVGEATPAAGGKPSAGPVYRSIYARDGLMQLPEDILSPWDF  48



>ref|XP_003577452.1| PREDICTED: long chain acyl-CoA synthetase 2 [Brachypodium distachyon]
Length=662

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKV E  PAG G+PSAGPVYR IYAKD LM +P  ++SPWDF
Sbjct  6    YSVKVGEPTPAGGGRPSAGPVYRSIYAKDGLMPLPKEIQSPWDF  49



>gb|ABG22526.1| AMP-binding enzyme family protein, expressed [Oryza sativa Japonica 
Group]
Length=647

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKV E  PA  GKPSAGPVYR IY+KD LM++P  + SPWDF
Sbjct  5    YTVKVGEATPAAGGKPSAGPVYRSIYSKDGLMKLPEDILSPWDF  48



>ref|NP_001068097.1| Os11g0558300 [Oryza sativa Japonica Group]
 gb|ABA94294.1| AMP-binding enzyme family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28460.1| Os11g0558300 [Oryza sativa Japonica Group]
 dbj|BAG98895.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52279.1| hypothetical protein OsJ_34263 [Oryza sativa Japonica Group]
Length=661

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKV E  PA  GKPSAGPVYR IY+KD LM++P  + SPWDF
Sbjct  5    YTVKVGEATPAAGGKPSAGPVYRSIYSKDGLMKLPEDILSPWDF  48



>gb|EMT18517.1| Fatty acyl-CoA synthetase B [Aegilops tauschii]
Length=656

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKV E  PA  G+P+AGPVYR IYAKD LM +P  + SPWDF
Sbjct  6    YTVKVGEATPAAGGRPAAGPVYRSIYAKDGLMRLPQEIHSPWDF  49



>ref|XP_002449702.1| hypothetical protein SORBIDRAFT_05g021840 [Sorghum bicolor]
 gb|EES08690.1| hypothetical protein SORBIDRAFT_05g021840 [Sorghum bicolor]
Length=663

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            + VKV E  PA  G+PSAGPVYR IYAKD LM +P  + SPWDF
Sbjct  5    FTVKVGEATPAAGGRPSAGPVYRSIYAKDGLMVLPQDIHSPWDF  48



>gb|KFK36012.1| hypothetical protein AALP_AA4G066600 [Arabis alpina]
Length=666

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +VV VEEG+PA    PSAGPVYRC YAKD L+++   LESPW F
Sbjct  7    HVVVVEEGRPATAEHPSAGPVYRCKYAKDGLLDLTNDLESPWQF  50



>ref|XP_006393257.1| hypothetical protein EUTSA_v10011292mg [Eutrema salsugineum]
 gb|ESQ30543.1| hypothetical protein EUTSA_v10011292mg [Eutrema salsugineum]
Length=666

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +VV VEEG+PA    PSAGPVYRC YAKD L+++P  L+SPW  
Sbjct  7    HVVVVEEGRPATAEHPSAGPVYRCNYAKDGLLDLPTDLDSPWQL  50



>ref|XP_010690967.1| PREDICTED: long chain acyl-CoA synthetase 2 [Beta vulgaris subsp. 
vulgaris]
Length=658

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEE + A +  PSAG VYRCIYAKD L  +P G+ESPWD 
Sbjct  4    YTVKVEEARAATEKMPSAGAVYRCIYAKDGLTGVPDGVESPWDL  47



>ref|XP_010479377.1| PREDICTED: long chain acyl-CoA synthetase 2 [Camelina sativa]
Length=665

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +V+ VE+G+PA    PSAGPVYRC YAKD L+++PA + SPW F
Sbjct  7    HVLVVEDGRPATADNPSAGPVYRCKYAKDGLLDLPADINSPWQF  50



>ref|XP_002891504.1| long-chain acyl-CoA synthetase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67763.1| long-chain acyl-CoA synthetase 2 [Arabidopsis lyrata subsp. lyrata]
Length=665

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +V+ VEEG+PA    PSAGPVYRC YAKD L+++P  ++SPW F
Sbjct  7    HVLLVEEGRPATAEHPSAGPVYRCKYAKDGLLDLPTDIDSPWQF  50



>gb|ACL54548.1| unknown [Zea mays]
Length=662

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            + +KV E  PA  G+PSAGPVYR IYAKD LM++P  ++SPWD 
Sbjct  5    FTLKVGEATPAAAGRPSAGPVYRSIYAKDGLMDLPQDIQSPWDL  48



>ref|NP_001148177.1| LOC100281785 [Zea mays]
 gb|ACG30068.1| acyl CoA synthetase [Zea mays]
 gb|ACR36229.1| unknown [Zea mays]
 gb|AFW65554.1| putative AMP-dependent synthetase and ligase superfamily protein 
[Zea mays]
Length=664

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            + +KV E  PA  G+PSAGPVYR IYAKD LM++P  ++SPWD 
Sbjct  7    FTLKVGEATPAAAGRPSAGPVYRSIYAKDGLMDLPQDIQSPWDL  50



>gb|KHG27706.1| Long chain acyl-CoA synthetase 2 -like protein [Gossypium arboreum]
Length=661

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVE+ +P    KPSAGPVYRCIYAKD  +++P  + SPW+F
Sbjct  5    YTVKVEDSRPESGKKPSAGPVYRCIYAKDGPLDLPDRMHSPWEF  48



>ref|NP_175368.2| long-chain acyl-CoA synthetase 2 [Arabidopsis thaliana]
 sp|Q9XIA9.1|LACS2_ARATH RecName: Full=Long chain acyl-CoA synthetase 2; AltName: Full=Protein 
Botrytis resistant 1; AltName: Full=Protein LATERAL 
ROOT DEVELOPMENT 2 [Arabidopsis thaliana]
 gb|AAD43157.1|AC007504_12 Putative acyl CoA synthetase [Arabidopsis thaliana]
 gb|AAM28869.1|AF503752_1 long chain acyl-CoA synthetase 2 [Arabidopsis thaliana]
 gb|AAL38865.1| putative acyl CoA synthetase [Arabidopsis thaliana]
 gb|AAM19793.1| At1g49430/F13F21_14 [Arabidopsis thaliana]
 gb|AAN71969.1| putative acyl CoA synthetase [Arabidopsis thaliana]
 gb|AEE32429.1| long-chain acyl-CoA synthetase 2 [Arabidopsis thaliana]
Length=665

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  571  VVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            V+ VEEG+PA    PSAGPVYRC YAKD L+++P  ++SPW F
Sbjct  8    VLLVEEGRPATAEHPSAGPVYRCKYAKDGLLDLPTDIDSPWQF  50



>ref|XP_010065425.1| PREDICTED: long chain acyl-CoA synthetase 2 [Eucalyptus grandis]
 gb|KCW62898.1| hypothetical protein EUGRSUZ_G00490 [Eucalyptus grandis]
Length=661

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEEGK   +G+PS GPVYR  YA+D L+E+  G+ESPW F
Sbjct  7    YTVKVEEGKEGVNGRPSVGPVYRGTYAEDGLVELEPGMESPWQF  50



>emb|CAA96523.1| acyl CoA synthetase [Brassica napus]
Length=666

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +VV VEEG+ A    PSAGPVYRC YAKD L+++PA L+SPW  
Sbjct  7    HVVIVEEGRQATAEHPSAGPVYRCKYAKDGLLDLPADLDSPWQL  50



>gb|KCW62899.1| hypothetical protein EUGRSUZ_G00490 [Eucalyptus grandis]
Length=659

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y VKVEEGK   +G+PS GPVYR  YA+D L+E+  G+ESPW F
Sbjct  7    YTVKVEEGKEGVNGRPSVGPVYRGTYAEDGLVELEPGMESPWQF  50



>emb|CDY59237.1| BnaC05g51350D [Brassica napus]
Length=666

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +VV VEEG+ A    PSAGPVYRC YAKD L+++PA L+SPW  
Sbjct  7    HVVIVEEGRQATAEHPSAGPVYRCKYAKDGLLDLPADLDSPWQL  50



>ref|XP_010501911.1| PREDICTED: long chain acyl-CoA synthetase 2-like, partial [Camelina 
sativa]
Length=663

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +V+ VE+G+PA    PSAGPVYRC YAKD L+++P  + SPW F
Sbjct  7    HVLVVEDGRPATADNPSAGPVYRCKYAKDGLLDLPTDINSPWQF  50



>ref|XP_010461777.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Camelina sativa]
Length=665

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +V+ VE+G+PA    PSAGPVYRC YAKD L+++P  + SPW F
Sbjct  7    HVLVVEDGRPATADNPSAGPVYRCKYAKDGLLDLPTDINSPWQF  50



>ref|XP_006303931.1| hypothetical protein CARUB_v10008590mg [Capsella rubella]
 gb|EOA36829.1| hypothetical protein CARUB_v10008590mg [Capsella rubella]
Length=623

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +V+ VE+G+PA    PSAGPVYRC YAKD L+++P  ++SPW F
Sbjct  7    HVLVVEKGRPATADSPSAGPVYRCKYAKDGLLDLPTDIDSPWQF  50



>ref|XP_009144978.1| PREDICTED: long chain acyl-CoA synthetase 2 [Brassica rapa]
 emb|CDY29350.1| BnaA05g16170D [Brassica napus]
Length=666

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +VV +EEG+ A    PSAGPVYRC YAKD L+++PA L+SPW  
Sbjct  7    HVVIMEEGRQATAEHPSAGPVYRCKYAKDGLLDLPADLDSPWQL  50



>ref|XP_008459243.1| PREDICTED: long chain acyl-CoA synthetase 2 [Cucumis melo]
Length=661

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y V VE   P   G+PSAGPVYR IYAKD L+++P  LESPW F
Sbjct  5    YTVVVEAETPETGGRPSAGPVYRSIYAKDGLLQLPDELESPWQF  48



>ref|XP_004145346.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Cucumis sativus]
 gb|KGN61759.1| hypothetical protein Csa_2G238260 [Cucumis sativus]
Length=661

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y V VE   P   G+PSAGPVYR IYAKD L+++P  L+SPW F
Sbjct  5    YTVVVEADTPQSGGRPSAGPVYRSIYAKDGLLQLPDELQSPWQF  48



>gb|EPS68372.1| hypothetical protein M569_06390, partial [Genlisea aurea]
Length=658

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y V+V    PA  GKPSAGPVYRC+Y+++ALM +P    SPWDF
Sbjct  1    YTVEVAASTPAAAGKPSAGPVYRCVYSENALMAIPPPFNSPWDF  44



>ref|XP_004154333.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Cucumis sativus]
Length=661

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y V VE   P   G+PSAGPVYR IYAKD L+++P  L+SPW F
Sbjct  5    YTVVVEADTPQSGGRPSAGPVYRSIYAKDGLLQLPDELQSPWQF  48



>ref|XP_011093712.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X2 [Sesamum 
indicum]
Length=662

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            ++V++EE K A DGKPS GPVYR +  KD    +P GLES WD
Sbjct  9    FIVEIEEAKEAKDGKPSVGPVYRNVLVKDGFRPLPQGLESCWD  51



>ref|XP_011093703.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Sesamum 
indicum]
Length=665

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            ++V++EE K A DGKPS GPVYR +  KD    +P GLES WD
Sbjct  9    FIVEIEEAKEAKDGKPSVGPVYRNVLVKDGFRPLPQGLESCWD  51



>ref|XP_006285040.1| hypothetical protein CARUB_v10006348mg [Capsella rubella]
 gb|EOA17938.1| hypothetical protein CARUB_v10006348mg [Capsella rubella]
Length=687

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+ KVEEGK   DG+PS GPVYR I+AKD   E   G++S WD
Sbjct  7    YIFKVEEGKEGSDGRPSVGPVYRSIFAKDGFPEPIEGMDSCWD  49



>ref|XP_010525687.1| PREDICTED: long chain acyl-CoA synthetase 2 [Tarenaya hassleriana]
Length=665

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            + VK EEG+PA   +PSAGPV+RC YA + L+E P  L+SPW  
Sbjct  7    HTVKAEEGRPATAERPSAGPVFRCKYAVNGLLEPPPELQSPWQL  50



>ref|XP_001777237.1| predicted protein [Physcomitrella patens]
 gb|EDQ57892.1| predicted protein [Physcomitrella patens]
Length=665

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            ++VKV +     DG PS GP+YR +YAKD L+ +PAG++S WD
Sbjct  10   FIVKVGDAVLGKDGVPSKGPIYRSVYAKDGLVSLPAGMQSTWD  52



>ref|XP_006850521.1| hypothetical protein AMTR_s00159p00012160 [Amborella trichopoda]
 gb|ERN12102.1| hypothetical protein AMTR_s00159p00012160 [Amborella trichopoda]
Length=659

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++V+VE  K   +G+PSAGPVYR I+AKD   E P GLES WD 
Sbjct  7    FLVEVERAKEGREGRPSAGPVYRSIFAKDGFPEPPQGLESCWDI  50



>ref|XP_006413507.1| hypothetical protein EUTSA_v10024614mg [Eutrema salsugineum]
 ref|XP_006413508.1| hypothetical protein EUTSA_v10024614mg [Eutrema salsugineum]
 gb|ESQ54960.1| hypothetical protein EUTSA_v10024614mg [Eutrema salsugineum]
 gb|ESQ54961.1| hypothetical protein EUTSA_v10024614mg [Eutrema salsugineum]
Length=666

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+ +VEEGK   DGKPS GPVYR I+AKD   E   G++S WD
Sbjct  7    YIFEVEEGKEGSDGKPSVGPVYRSIFAKDGFPEPIEGMDSCWD  49



>ref|XP_004298900.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Fragaria vesca 
subsp. vesca]
Length=666

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  562  FYYVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            + Y+++VE+GKPA DG+PS GPVYR ++AKD      AG++S WD
Sbjct  6    YKYLIEVEKGKPAKDGRPSLGPVYRSVFAKDGFPPPIAGMDSCWD  50



>ref|XP_010439129.1| PREDICTED: long chain acyl-CoA synthetase 4 [Camelina sativa]
Length=666

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+ +VEEGK   DG+PS GPVYR I+AKD   E   G++S WD
Sbjct  7    YIFQVEEGKQGSDGRPSVGPVYRSIFAKDGFPEPIQGMDSCWD  49



>gb|ACC91252.1| long-chain-fatty-acid-CoA ligase [Arabidopsis halleri]
Length=666

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            ++ +VEEGK   DG+PS GPVYR IYAKD   E   G++S WD
Sbjct  7    FIFQVEEGKEGSDGRPSVGPVYRSIYAKDGFPEPIEGMDSCWD  49



>ref|XP_002867687.1| long-chain-fatty-acid--CoA ligase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43946.1| long-chain-fatty-acid--CoA ligase [Arabidopsis lyrata subsp. 
lyrata]
Length=666

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            ++ +VEEGK   DG+PS GPVYR IYAKD   E   G++S WD
Sbjct  7    FIFQVEEGKEGSDGRPSVGPVYRSIYAKDGFPEPIEGMDSCWD  49



>ref|XP_010448651.1| PREDICTED: long chain acyl-CoA synthetase 4 [Camelina sativa]
Length=666

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+ +VEEGK   DG+PS GPVYR I+AKD   E   G++S WD
Sbjct  7    YIFQVEEGKEGTDGRPSVGPVYRSIFAKDGFPEPIQGMDSCWD  49



>ref|XP_010433854.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Camelina 
sativa]
Length=666

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+ +VEEGK   DG+PS GPVYR I+AKD   E   G++S WD
Sbjct  7    YIFQVEEGKEGTDGRPSVGPVYRSIFAKDGFPEPIQGMDSCWD  49



>ref|XP_009783796.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana sylvestris]
Length=658

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            YVV+VE+GK   +G+PS GPVYR + AKD    +  GLES WD 
Sbjct  6    YVVEVEKGKEGRNGRPSIGPVYRNVLAKDGFRPLSHGLESCWDI  49



>ref|XP_011101042.1| PREDICTED: long chain acyl-CoA synthetase 4 [Sesamum indicum]
Length=658

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y V+VE GKPA DGKPS GPVYR  +AKD   E   GL+S WD 
Sbjct  6    YTVEVEPGKPAKDGKPSVGPVYRSKFAKDGFPEPIPGLDSCWDI  49



>ref|XP_009137437.1| PREDICTED: long chain acyl-CoA synthetase 4 [Brassica rapa]
Length=667

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            ++ +VEEGK   DG+PS GPVYR +YAKD   E   G++S WD
Sbjct  8    FIFQVEEGKEGSDGRPSVGPVYRSVYAKDGFPEPIEGMDSCWD  50



>ref|XP_008783866.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Phoenix dactylifera]
Length=349

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            +VV+VE+G+  GDG+PS GP YR ++AKD   +   GLES WD
Sbjct  3    HVVEVEKGREGGDGRPSVGPAYRSVFAKDGFPQPVPGLESCWD  45



>dbj|BAF02671.1| acyl-CoA synthetase [Beta vulgaris]
Length=500

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            YVV+VE+GK A DG+PS GPVYR + AKD    +  G+E+ WD 
Sbjct  6    YVVEVEKGKEAKDGRPSVGPVYRSVTAKDGFPPLLPGMETCWDI  49



>ref|XP_010668007.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=664

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            YVV+VE+GK A DG+PS GPVYR + AKD    +  G+E+ WD 
Sbjct  6    YVVEVEKGKEAKDGRPSVGPVYRSVTAKDGFPPLLPGMETCWDI  49



>ref|NP_194116.1| long chain acyl-CoA synthetase 4 [Arabidopsis thaliana]
 sp|Q9T0A0.1|LACS4_ARATH RecName: Full=Long chain acyl-CoA synthetase 4 [Arabidopsis thaliana]
 gb|AAM28871.1|AF503754_1 long chain acyl-CoA synthetase 4 [Arabidopsis thaliana]
 emb|CAB43885.1| acyl-CoA synthetase-like protein [Arabidopsis thaliana]
 emb|CAB81303.1| acyl-CoA synthetase-like protein [Arabidopsis thaliana]
 gb|AAK83581.1| AT4g23850/T32A16_20 [Arabidopsis thaliana]
 gb|AEE84812.1| long chain acyl-CoA synthetase 4 [Arabidopsis thaliana]
Length=666

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+ +VEEGK   DG+PS GPVYR I+AKD   +   G++S WD
Sbjct  7    YIFQVEEGKEGSDGRPSVGPVYRSIFAKDGFPDPIEGMDSCWD  49



>gb|EPS67806.1| hypothetical protein M569_06966, partial [Genlisea aurea]
Length=205

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++V+VE GKPA DG PS GPVYR ++AKD   +   G++S WD 
Sbjct  3    FIVEVEPGKPASDGGPSIGPVYRSVFAKDGFPKPTPGIDSCWDI  46



>gb|KCW77383.1| hypothetical protein EUGRSUZ_D01734 [Eucalyptus grandis]
Length=447

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+++VE+GK A DG+PS GPVYR ++AKD       GLES WD
Sbjct  3    YLIEVEKGKEARDGRPSVGPVYRSVFAKDGFPPPVPGLESCWD  45



>gb|KCW77382.1| hypothetical protein EUGRSUZ_D01734 [Eucalyptus grandis]
Length=570

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+++VE+GK A DG+PS GPVYR ++AKD       GLES WD
Sbjct  3    YLIEVEKGKEARDGRPSVGPVYRSVFAKDGFPPPVPGLESCWD  45



>ref|XP_010053129.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Eucalyptus 
grandis]
 gb|KCW77380.1| hypothetical protein EUGRSUZ_D01734 [Eucalyptus grandis]
 gb|KCW77381.1| hypothetical protein EUGRSUZ_D01734 [Eucalyptus grandis]
Length=659

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+++VE+GK A DG+PS GPVYR ++AKD       GLES WD
Sbjct  3    YLIEVEKGKEARDGRPSVGPVYRSVFAKDGFPPPVPGLESCWD  45



>gb|EYU32231.1| hypothetical protein MIMGU_mgv1a002558mg [Erythranthe guttata]
Length=659

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+V++E  + A DGKPS GPVYR    KD    +P GL S WD
Sbjct  7    YIVEIENAREAKDGKPSVGPVYRNALVKDGFRPLPQGLHSCWD  49



>gb|KCW77379.1| hypothetical protein EUGRSUZ_D01734 [Eucalyptus grandis]
Length=654

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            Y+++VE+GK A DG+PS GPVYR ++AKD       GLES WD
Sbjct  3    YLIEVEKGKEARDGRPSVGPVYRSVFAKDGFPPPVPGLESCWD  45



>emb|CDY47618.1| BnaA01g13470D [Brassica napus]
Length=667

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            ++ +VEEG+   DG+PS GPVYR ++AKD   E   G++S WD
Sbjct  8    FIFQVEEGREGSDGRPSVGPVYRSVFAKDGFPEPIEGMDSCWD  50



>emb|CDP12153.1| unnamed protein product [Coffea canephora]
Length=658

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y+++VE  KPA DGKPS GPVYR ++AKD       GL+S WD 
Sbjct  6    YIIEVEPAKPAKDGKPSIGPVYRSVFAKDGFPPPIEGLDSCWDI  49



>emb|CAA64327.1| acyl-CoA synthetase [Brassica napus]
 emb|CDY03515.1| BnaC01g15670D [Brassica napus]
Length=667

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            ++ +VEEG+   DG+PS GPVYR ++AKD   E   G++S WD
Sbjct  8    FIFQVEEGREGSDGRPSVGPVYRSVFAKDGFPEPIEGMDSCWD  50



>ref|XP_009627714.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana tomentosiformis]
Length=658

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            YVV+VE+ K   DG+PS GPVYR + A D+   +  GLES WD 
Sbjct  6    YVVEVEKAKEGKDGRPSIGPVYRNVLATDSFRPLSYGLESCWDI  49



>ref|XP_008364587.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Malus domestica]
Length=344

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  553  ALFFYYVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWD  696
            A  + Y+++VE+ K A DGKPS GPVYR ++AKD      +G++S WD
Sbjct  3    ATKYKYLIEVEKAKEAKDGKPSQGPVYRSLFAKDGFPPAISGMDSCWD  50



>ref|XP_002973766.1| hypothetical protein SELMODRAFT_99821 [Selaginella moellendorffii]
 gb|EFJ25426.1| hypothetical protein SELMODRAFT_99821 [Selaginella moellendorffii]
Length=714

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 2/44 (5%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y+VKVEE K   DG  S GPVYR +YAKD L+E P G  + W+ 
Sbjct  8    YIVKVEEAKR--DGSASMGPVYRSVYAKDGLVEAPEGARTCWEL  49



>ref|XP_002975814.1| hypothetical protein SELMODRAFT_442966 [Selaginella moellendorffii]
 gb|EFJ23443.1| hypothetical protein SELMODRAFT_442966 [Selaginella moellendorffii]
Length=657

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 2/44 (5%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y+VKVEE K   DG  S GPVYR +YAKD L+E P G  + W+ 
Sbjct  8    YIVKVEEAKR--DGSASMGPVYRSVYAKDGLVEAPEGARTCWEL  49



>emb|CDM82121.1| unnamed protein product [Triticum aestivum]
Length=658

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            +VVKVEEG+PA DG+PS GP YR  +A+D       GL+S +D 
Sbjct  6    HVVKVEEGRPAADGRPSVGPTYRSAFARDGFPAPVDGLDSCYDI  49



>ref|XP_009786376.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana sylvestris]
Length=657

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            ++++VE  KPA DGKPS GPVYR ++AKD       GL+S WD 
Sbjct  5    FIIEVEPAKPAKDGKPSVGPVYRSLFAKDGFPPPVEGLDSCWDI  48



>gb|ABK96686.1| unknown [Populus trichocarpa x Populus deltoides]
Length=662

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  568  YVVKVEEGKPAGDGKPSAGPVYRCIYAKDALMEMPAGLESPWDF  699
            Y+V+VE+ K A DGKPS GPVYR ++AKD       GLES WD 
Sbjct  6    YLVEVEKAKEAIDGKPSTGPVYRSLFAKDGFPPPVPGLESCWDI  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320