BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024A15

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009785111.1|  PREDICTED: heat shock cognate protein 80           377   2e-123   Nicotiana sylvestris
gb|ADU04386.1|  heat shock protein 90-1                                 377   2e-123   Nicotiana attenuata
gb|ADX06844.1|  molecular chaperone Hsp90                               377   2e-123   Nicotiana tabacum [American tobacco]
ref|XP_009591410.1|  PREDICTED: heat shock cognate protein 80           377   2e-123   Nicotiana tomentosiformis
gb|KJB81564.1|  hypothetical protein B456_013G150300                    373   4e-123   Gossypium raimondii
gb|AAS79798.1|  heat shock protein 90                                   376   5e-123   Nicotiana tabacum [American tobacco]
gb|AAR12193.1|  molecular chaperone Hsp90-1                             375   1e-122   Nicotiana benthamiana
gb|AGA62462.1|  heat shock protein 90                                   375   1e-122   Gossypium hirsutum [American cotton]
ref|XP_011089536.1|  PREDICTED: heat shock cognate protein 80           375   1e-122   Sesamum indicum [beniseed]
gb|AFK35835.1|  unknown                                                 357   2e-122   Lotus japonicus
gb|AEC11021.1|  heat shock protein 90                                   358   3e-122   Camellia sinensis [black tea]
ref|XP_011097724.1|  PREDICTED: heat shock cognate protein 80-like      374   5e-122   Sesamum indicum [beniseed]
gb|KJB81563.1|  hypothetical protein B456_013G150300                    373   5e-122   Gossypium raimondii
gb|KJB22184.1|  hypothetical protein B456_004G033900                    374   5e-122   Gossypium raimondii
gb|KJB81562.1|  hypothetical protein B456_013G150300                    373   8e-122   Gossypium raimondii
emb|CBI25731.3|  unnamed protein product                                369   8e-122   Vitis vinifera
gb|AAR12194.1|  molecular chaperone Hsp90-2                             373   1e-121   Nicotiana benthamiana
ref|XP_004169769.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    369   1e-121   
dbj|BAD95030.1|  heat-shock protein                                     357   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539340.1|  PREDICTED: heat shock protein 90-2-like            372   2e-121   Tarenaya hassleriana [spider flower]
gb|ADU04387.1|  heat shock protein 90-2                                 372   3e-121   Nicotiana attenuata
ref|XP_009758556.1|  PREDICTED: heat shock cognate protein 80-like      371   4e-121   Nicotiana sylvestris
ref|XP_009594054.1|  PREDICTED: heat shock cognate protein 80-like      371   4e-121   Nicotiana tomentosiformis
gb|KHN43913.1|  Heat shock cognate protein 80                           365   4e-121   Glycine soja [wild soybean]
gb|KGN66052.1|  hypothetical protein Csa_1G569290                       369   5e-121   Cucumis sativus [cucumbers]
dbj|BAG16518.1|  putative Hsp90-2                                       371   6e-121   Capsicum chinense [bonnet pepper]
ref|NP_001234436.1|  molecular chaperone Hsp90-1                        370   9e-121   Solanum lycopersicum
ref|XP_009607645.1|  PREDICTED: heat shock cognate protein 80-like      370   1e-120   Nicotiana tomentosiformis
gb|KDP32613.1|  hypothetical protein JCGZ_13163                         370   1e-120   Jatropha curcas
emb|CAN62488.1|  hypothetical protein VITISV_029391                     370   1e-120   Vitis vinifera
ref|XP_003635036.1|  PREDICTED: heat shock cognate protein 80           370   2e-120   Vitis vinifera
gb|KHG19401.1|  Heat shock cognate 80                                   370   2e-120   Gossypium arboreum [tree cotton]
gb|KHG22758.1|  Heat shock cognate 80                                   370   2e-120   Gossypium arboreum [tree cotton]
gb|KJB22185.1|  hypothetical protein B456_004G034000                    369   2e-120   Gossypium raimondii
ref|XP_009763345.1|  PREDICTED: heat shock cognate protein 80-like      369   2e-120   Nicotiana sylvestris
gb|KGN66050.1|  hypothetical protein Csa_1G569270                       369   2e-120   Cucumis sativus [cucumbers]
gb|ACX31585.1|  molecular chaperone Hsp90-3                             369   2e-120   Nicotiana benthamiana
ref|XP_004135593.1|  PREDICTED: heat shock cognate protein 80-like      369   3e-120   
gb|ACR35758.1|  unknown                                                 358   3e-120   Zea mays [maize]
gb|AAN61003.1|  putative heat shock protein 90                          363   3e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010910639.1|  PREDICTED: heat shock protein 81-1                 365   4e-120   Elaeis guineensis
emb|CBI34381.3|  unnamed protein product                                356   4e-120   Vitis vinifera
pdb|2XCM|A  Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar...    352   5e-120   Arabidopsis thaliana [mouse-ear cress]
emb|CDP13679.1|  unnamed protein product                                368   5e-120   Coffea canephora [robusta coffee]
gb|EAZ43234.1|  hypothetical protein OsJ_27834                          359   5e-120   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001274833.1|  Hsp90-2-like                                       368   6e-120   Solanum tuberosum [potatoes]
ref|XP_010252844.1|  PREDICTED: heat shock cognate protein 80-like      368   7e-120   Nelumbo nucifera [Indian lotus]
ref|XP_006857538.1|  hypothetical protein AMTR_s00061p00036160          368   7e-120   Amborella trichopoda
gb|AAK91366.1|  AT5g56010/MDA7_5                                        362   8e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010246543.1|  PREDICTED: heat shock cognate protein 80           368   9e-120   Nelumbo nucifera [Indian lotus]
gb|ABW96308.1|  heat shock protein 90                                   367   1e-119   Vitis pseudoreticulata
gb|KJB13949.1|  hypothetical protein B456_002G103000                    367   1e-119   Gossypium raimondii
ref|XP_011030250.1|  PREDICTED: heat shock protein 81-1-like            367   1e-119   Populus euphratica
gb|KHN31689.1|  Heat shock cognate protein 80                           367   1e-119   Glycine soja [wild soybean]
gb|ADC45395.1|  HSP90-1                                                 367   1e-119   Glycine max [soybeans]
ref|XP_006344905.1|  PREDICTED: heat shock cognate protein 80-like      367   1e-119   Solanum tuberosum [potatoes]
ref|XP_009126978.1|  PREDICTED: heat shock protein 90-2-like            367   2e-119   Brassica rapa
ref|XP_010552350.1|  PREDICTED: heat shock protein 90-2                 367   2e-119   Tarenaya hassleriana [spider flower]
pdb|2JKI|A  Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain     351   2e-119   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61618.1|  hypothetical protein M569_13176                         367   2e-119   Genlisea aurea
ref|XP_006401391.1|  hypothetical protein EUTSA_v10012832mg             366   3e-119   Eutrema salsugineum [saltwater cress]
ref|XP_010675973.1|  PREDICTED: heat shock cognate protein 80           366   3e-119   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006287183.1|  hypothetical protein CARUB_v10000353mg             366   4e-119   Capsella rubella
ref|XP_002273244.1|  PREDICTED: heat shock cognate protein 80-like      366   4e-119   Vitis vinifera
gb|ABX76302.1|  heat shock protein 90                                   366   5e-119   Ageratina adenophora
ref|XP_010928158.1|  PREDICTED: heat shock protein 81-1-like            366   5e-119   Elaeis guineensis
ref|XP_002300303.1|  HSP80 family protein                               366   5e-119   Populus trichocarpa [western balsam poplar]
gb|KFK40163.1|  hypothetical protein AALP_AA3G338900                    366   5e-119   Arabis alpina [alpine rockcress]
ref|XP_008811147.1|  PREDICTED: heat shock protein 81-1-like            366   5e-119   Phoenix dactylifera
ref|XP_007020406.1|  Heat shock protein 81.4                            365   5e-119   Theobroma cacao [chocolate]
ref|XP_006280101.1|  hypothetical protein CARUB_v10025990mg             365   6e-119   Capsella rubella
ref|XP_011039800.1|  PREDICTED: heat shock protein 90-2                 365   6e-119   Populus euphratica
ref|NP_200414.1|  heat shock protein 81-2                               365   6e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450563.1|  PREDICTED: heat shock protein 90-3-like            365   6e-119   Camelina sativa [gold-of-pleasure]
gb|EYU33725.1|  hypothetical protein MIMGU_mgv1a002215mg                365   6e-119   Erythranthe guttata [common monkey flower]
ref|XP_010443242.1|  PREDICTED: heat shock protein 90-2                 365   7e-119   Camelina sativa [gold-of-pleasure]
dbj|BAE71229.1|  putative HEAT SHOCK PROTEIN 81-2                       358   7e-119   Trifolium pratense [peavine clover]
ref|XP_003544594.1|  PREDICTED: heat shock cognate protein 80-like      365   7e-119   Glycine max [soybeans]
gb|AEK20869.1|  heat shock protein 90-2                                 365   8e-119   Cryptocoryne ciliata
gb|AAN31859.1|  putative heat shock protein 81-2 (HSP81-2)              365   8e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001236599.1|  heat shock protein 90-2                            365   9e-119   
ref|XP_010103960.1|  Heat shock cognate protein 80                      366   1e-118   
gb|KFK27172.1|  hypothetical protein AALP_AA8G344900                    365   1e-118   Arabis alpina [alpine rockcress]
gb|KEH26332.1|  heat shock protein 81-2                                 365   1e-118   Medicago truncatula
ref|NP_001234439.1|  heat shock cognate protein 80                      365   1e-118   Solanum lycopersicum
ref|XP_002866122.1|  heat shock protein 81-4                            365   1e-118   
ref|XP_009391803.1|  PREDICTED: heat shock protein 81-1-like            364   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010537148.1|  PREDICTED: heat shock protein 83                   364   2e-118   Tarenaya hassleriana [spider flower]
ref|XP_008234835.1|  PREDICTED: heat shock protein 83                   364   2e-118   Prunus mume [ume]
ref|XP_006280103.1|  hypothetical protein CARUB_v10025991mg             364   3e-118   Capsella rubella
ref|XP_010483071.1|  PREDICTED: heat shock protein 90-3-like            363   3e-118   Camelina sativa [gold-of-pleasure]
ref|XP_008439282.1|  PREDICTED: heat shock protein 83                   364   3e-118   Cucumis melo [Oriental melon]
ref|XP_007220219.1|  hypothetical protein PRUPE_ppa002187mg             364   3e-118   Prunus persica
ref|XP_004234218.1|  PREDICTED: heat shock protein 83                   364   3e-118   Solanum lycopersicum
ref|XP_010483070.1|  PREDICTED: heat shock protein 90-3-like            363   3e-118   Camelina sativa [gold-of-pleasure]
ref|XP_004491531.1|  PREDICTED: heat shock cognate protein 80-lik...    362   3e-118   
ref|XP_011040123.1|  PREDICTED: heat shock protein 81-1                 363   3e-118   Populus euphratica
ref|XP_006373573.1|  HSP80 family protein                               363   3e-118   Populus trichocarpa [western balsam poplar]
ref|XP_006352548.1|  PREDICTED: heat shock cognate protein 80-like      363   3e-118   Solanum tuberosum [potatoes]
ref|XP_011005759.1|  PREDICTED: heat shock cognate protein 80-like      363   4e-118   Populus euphratica
gb|AHB36893.1|  heat shock protein 90                                   363   4e-118   Matricaria chamomilla var. recutita [German chamomile]
ref|NP_001236612.1|  heat shock protein 90-1                            363   4e-118   
ref|NP_001240230.1|  uncharacterized protein LOC100819568               363   4e-118   Glycine max [soybeans]
gb|AAB33937.1|  heat-shock Protein                                      363   4e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002307846.1|  HSP80 family protein                               363   4e-118   Populus trichocarpa [western balsam poplar]
ref|XP_010913224.1|  PREDICTED: heat shock protein 81-1-like            363   5e-118   Elaeis guineensis
ref|XP_007152171.1|  hypothetical protein PHAVU_004G107700g             363   5e-118   Phaseolus vulgaris [French bean]
ref|XP_009417329.1|  PREDICTED: heat shock protein 81-1                 363   6e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010443241.1|  PREDICTED: heat shock protein 90-3-like            363   6e-118   Camelina sativa [gold-of-pleasure]
ref|XP_002869603.1|  early-responsive to dehydration 8                  363   6e-118   Arabidopsis lyrata subsp. lyrata
ref|XP_010536759.1|  PREDICTED: heat shock protein 90-2-like            363   6e-118   Tarenaya hassleriana [spider flower]
gb|AGU99972.1|  HSP90                                                   363   6e-118   Populus tomentosa [Chinese white poplar]
ref|NP_200412.1|  Heat shock protein 90-3                               363   6e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009768512.1|  PREDICTED: heat shock protein 82                   363   7e-118   Nicotiana sylvestris
ref|NP_200411.1|  Heat shock protein 90-4                               363   7e-118   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA61990.1|  TPA: putative heat shock protein 90 family protein     361   7e-118   
ref|XP_010047845.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    363   7e-118   Eucalyptus grandis [rose gum]
ref|XP_002532177.1|  heat shock protein, putative                       363   7e-118   Ricinus communis
gb|AAL49788.1|  putative heat shock protein 90                          363   7e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008776162.1|  PREDICTED: heat shock protein 81-1                 363   8e-118   Phoenix dactylifera
gb|KDP22224.1|  hypothetical protein JCGZ_26055                         363   8e-118   Jatropha curcas
ref|XP_002513649.1|  heat shock protein, putative                       362   1e-117   Ricinus communis
ref|XP_009132345.1|  PREDICTED: heat shock protein 90-2                 362   1e-117   Brassica rapa
ref|XP_004491530.1|  PREDICTED: heat shock cognate protein 80-lik...    362   1e-117   Cicer arietinum [garbanzo]
gb|KFK29176.1|  hypothetical protein AALP_AA7G099100                    362   1e-117   Arabis alpina [alpine rockcress]
ref|XP_011076104.1|  PREDICTED: heat shock protein 83                   362   1e-117   Sesamum indicum [beniseed]
ref|XP_003533977.1|  PREDICTED: heat shock protein 83-like              362   1e-117   
gb|EYU31897.1|  hypothetical protein MIMGU_mgv1a002208mg                362   1e-117   Erythranthe guttata [common monkey flower]
ref|XP_009390627.1|  PREDICTED: heat shock protein 81-1-like            362   1e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275844.1|  HSP90 protein                                      362   1e-117   Citrus sinensis [apfelsine]
ref|XP_006452664.1|  hypothetical protein CICLE_v10007633mg             362   1e-117   Citrus clementina [clementine]
ref|XP_009383207.1|  PREDICTED: heat shock protein 81-1-like            362   2e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009368732.1|  PREDICTED: heat shock protein 83                   362   2e-117   Pyrus x bretschneideri [bai li]
ref|XP_006362664.1|  PREDICTED: heat shock protein 83-like              362   2e-117   Solanum tuberosum [potatoes]
ref|XP_006599549.1|  PREDICTED: heat shock protein 83-like              362   2e-117   Glycine max [soybeans]
ref|XP_010671625.1|  PREDICTED: heat shock protein 83                   362   2e-117   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN09298.1|  Heat shock protein 83                                   362   2e-117   Glycine soja [wild soybean]
ref|XP_004140753.1|  PREDICTED: heat shock protein 83-like              362   2e-117   Cucumis sativus [cucumbers]
ref|XP_006413166.1|  hypothetical protein EUTSA_v10024564mg             361   3e-117   Eutrema salsugineum [saltwater cress]
emb|CBI22652.3|  unnamed protein product                                357   3e-117   Vitis vinifera
ref|XP_002299048.1|  hypothetical protein POPTR_0001s47020g             361   3e-117   Populus trichocarpa [western balsam poplar]
ref|XP_002460433.1|  hypothetical protein SORBIDRAFT_02g028050          361   3e-117   Sorghum bicolor [broomcorn]
ref|XP_009420064.1|  PREDICTED: heat shock protein 81-1-like            361   3e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008652859.1|  PREDICTED: heat shock protein 81-1                 361   3e-117   
ref|XP_008355028.1|  PREDICTED: heat shock protein 90-2                 361   3e-117   
ref|XP_010060433.1|  PREDICTED: heat shock protein 83-like              361   4e-117   Eucalyptus grandis [rose gum]
ref|XP_004516872.1|  PREDICTED: heat shock protein 83-like              361   4e-117   Cicer arietinum [garbanzo]
ref|XP_008811143.1|  PREDICTED: heat shock protein 81-1-like            361   4e-117   Phoenix dactylifera
gb|EYU19581.1|  hypothetical protein MIMGU_mgv1a002166mg                361   4e-117   Erythranthe guttata [common monkey flower]
ref|XP_009132299.1|  PREDICTED: heat shock protein 90-2-like            361   4e-117   Brassica rapa
gb|EEC84771.1|  hypothetical protein OsI_31801                          343   4e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_010913223.1|  PREDICTED: heat shock protein 81-1-like            361   4e-117   Elaeis guineensis
gb|AFQ94045.1|  heat shock protein 90                                   361   4e-117   Lactuca sativa [cultivated lettuce]
ref|XP_004500151.1|  PREDICTED: heat shock cognate protein 80-like      361   4e-117   Cicer arietinum [garbanzo]
emb|CDY27839.1|  BnaC09g28660D                                          361   4e-117   Brassica napus [oilseed rape]
ref|XP_006659612.1|  PREDICTED: heat shock protein 81-1-like            360   4e-117   Oryza brachyantha
dbj|BAO20259.1|  heat shock protein                                     360   5e-117   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_002462554.1|  hypothetical protein SORBIDRAFT_02g028020          360   5e-117   Sorghum bicolor [broomcorn]
ref|XP_006372391.1|  hypothetical protein POPTR_0017s01160g             361   5e-117   
ref|XP_003617873.1|  Heat shock protein                                 360   5e-117   Medicago truncatula
ref|XP_004240717.1|  PREDICTED: heat shock protein 83-like              361   5e-117   
ref|XP_007142446.1|  hypothetical protein PHAVU_008G281300g             360   5e-117   Phaseolus vulgaris [French bean]
emb|CDP05141.1|  unnamed protein product                                360   5e-117   Coffea canephora [robusta coffee]
ref|XP_010483069.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    360   6e-117   
gb|KFK26865.1|  hypothetical protein AALP_AA8G303900                    360   6e-117   Arabis alpina [alpine rockcress]
ref|XP_011046024.1|  PREDICTED: heat shock protein 83                   360   7e-117   Populus euphratica
ref|XP_002305263.1|  hypothetical protein POPTR_0004s07190g             360   8e-117   Populus trichocarpa [western balsam poplar]
gb|KFK25886.1|  hypothetical protein AALP_AA8G175000                    360   8e-117   Arabis alpina [alpine rockcress]
ref|XP_008376647.1|  PREDICTED: heat shock protein 83 isoform X1        360   9e-117   
dbj|BAD04054.1|  heat shock protein 90                                  360   9e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010545291.1|  PREDICTED: heat shock protein 90-2-like            360   1e-116   Tarenaya hassleriana [spider flower]
ref|XP_009375529.1|  PREDICTED: heat shock protein 83-like              360   1e-116   Pyrus x bretschneideri [bai li]
ref|XP_010438732.1|  PREDICTED: heat shock protein 90-2-like            360   1e-116   Camelina sativa [gold-of-pleasure]
ref|NP_001063503.1|  Os09g0482400                                       360   1e-116   
ref|NP_001063500.1|  Os09g0482100                                       360   1e-116   
ref|XP_009367265.1|  PREDICTED: heat shock protein 90-2                 360   1e-116   Pyrus x bretschneideri [bai li]
ref|XP_008380194.1|  PREDICTED: heat shock protein 83-like              360   1e-116   
sp|P51819.1|HSP83_IPONI  RecName: Full=Heat shock protein 83            360   1e-116   Ipomoea nil [qian niu]
ref|XP_009607669.1|  PREDICTED: heat shock protein 82                   360   1e-116   Nicotiana tomentosiformis
ref|XP_009362097.1|  PREDICTED: heat shock protein 90-2                 360   1e-116   Pyrus x bretschneideri [bai li]
ref|XP_010261331.1|  PREDICTED: heat shock protein 83                   360   1e-116   Nelumbo nucifera [Indian lotus]
ref|XP_008218765.1|  PREDICTED: heat shock protein 90-2                 360   1e-116   Prunus mume [ume]
ref|XP_010433476.1|  PREDICTED: heat shock protein 90-2-like            360   1e-116   Camelina sativa [gold-of-pleasure]
gb|KJB52728.1|  hypothetical protein B456_008G274600                    360   1e-116   Gossypium raimondii
ref|XP_002864186.1|  heat shock protein 81-1                            360   1e-116   
dbj|BAJ34368.1|  unnamed protein product                                359   1e-116   Eutrema halophilum
gb|AAQ08597.1|  heat shock protein                                      359   2e-116   Hevea brasiliensis [jebe]
ref|XP_006280097.1|  hypothetical protein CARUB_v10025984mg             359   2e-116   Capsella rubella
ref|XP_010035175.1|  PREDICTED: heat shock protein 83                   359   2e-116   Eucalyptus grandis [rose gum]
ref|XP_010442803.1|  PREDICTED: heat shock protein 90-1-like            359   2e-116   Camelina sativa [gold-of-pleasure]
gb|AGC60019.1|  heat shock protein 90                                   359   2e-116   Saccharum hybrid cultivar SP80-3280
ref|XP_010482633.1|  PREDICTED: heat shock protein 90-1                 359   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_009132342.1|  PREDICTED: heat shock protein 90-2-like            359   2e-116   Brassica rapa
ref|XP_006659552.1|  PREDICTED: heat shock protein 81-1-like isof...    359   2e-116   
dbj|BAA00615.1|  81kDa heat-shock protein                               359   2e-116   Arabidopsis thaliana [mouse-ear cress]
sp|P27323.3|HS901_ARATH  RecName: Full=Heat shock protein 90-1; S...    359   2e-116   Arabidopsis thaliana [mouse-ear cress]
sp|A2YWQ1.1|HSP81_ORYSI  RecName: Full=Heat shock protein 81-1; S...    359   2e-116   Oryza sativa Indica Group [Indian rice]
ref|NP_200076.1|  heat shock protein 90.1                               359   2e-116   
prf||1908431A  heat shock protein HSP81-1                               359   2e-116
ref|XP_002278894.1|  PREDICTED: heat shock protein 83                   359   2e-116   Vitis vinifera
ref|XP_009377558.1|  PREDICTED: heat shock protein 83-like              359   2e-116   Pyrus x bretschneideri [bai li]
ref|XP_002444804.1|  hypothetical protein SORBIDRAFT_07g028270          358   3e-116   Sorghum bicolor [broomcorn]
ref|XP_009802902.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    359   3e-116   Nicotiana sylvestris
gb|EEC83017.1|  hypothetical protein OsI_28083                          341   3e-116   Oryza sativa Indica Group [Indian rice]
ref|XP_006439485.1|  hypothetical protein CICLE_v10019095mg             358   3e-116   Citrus clementina [clementine]
ref|XP_003592196.1|  Heat shock protein                                 358   3e-116   
gb|AIZ68157.1|  heat shock protein 83                                   358   3e-116   Ornithogalum longebracteatum [sea-onion]
ref|XP_010941080.1|  PREDICTED: heat shock protein 83                   358   4e-116   Elaeis guineensis
ref|XP_004308051.1|  PREDICTED: heat shock protein 83                   358   4e-116   Fragaria vesca subsp. vesca
ref|NP_001170475.1|  LOC100384473                                       358   4e-116   Zea mays [maize]
ref|XP_006413591.1|  hypothetical protein EUTSA_v10024561mg             358   4e-116   Eutrema salsugineum [saltwater cress]
ref|XP_008801780.1|  PREDICTED: heat shock protein 83                   358   4e-116   Phoenix dactylifera
ref|XP_007208337.1|  hypothetical protein PRUPE_ppa002220mg             358   4e-116   Prunus persica
ref|XP_001779443.1|  predicted protein                                  358   5e-116   
ref|XP_010063241.1|  PREDICTED: heat shock cognate protein 80-like      358   5e-116   Eucalyptus grandis [rose gum]
ref|XP_010276895.1|  PREDICTED: heat shock protein 83-like              358   5e-116   Nelumbo nucifera [Indian lotus]
gb|AGB76029.1|  heat shock protein 90                                   358   6e-116   Salicornia europaea [chicken-claws]
ref|XP_006659551.1|  PREDICTED: heat shock protein 81-1-like isof...    358   6e-116   
ref|XP_001777414.1|  predicted protein                                  358   6e-116   
emb|CAA72513.1|  heat shock protein                                     358   7e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007038813.1|  Heat shock protein 90.1 isoform 1                  358   7e-116   
gb|EAZ29453.1|  hypothetical protein OsJ_13528                          349   7e-116   Oryza sativa Japonica Group [Japonica rice]
emb|CAN73318.1|  hypothetical protein VITISV_007727                     358   7e-116   Vitis vinifera
ref|XP_002274022.1|  PREDICTED: heat shock protein 83-like              358   8e-116   Vitis vinifera
gb|AAA32822.1|  heat shock protein 83                                   357   9e-116   Arabidopsis thaliana [mouse-ear cress]
prf||1710352A  heat shock protein 83                                    357   1e-115
gb|KJB24312.1|  hypothetical protein B456_004G138600                    352   1e-115   Gossypium raimondii
ref|XP_001777383.1|  predicted protein                                  357   1e-115   
emb|CAA68885.1|  heat shock protein 90A                                 357   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008670278.1|  PREDICTED: heat shock protein 81-1-like            357   1e-115   Zea mays [maize]
ref|XP_006476504.1|  PREDICTED: heat shock protein 83-like              357   1e-115   Citrus sinensis [apfelsine]
ref|XP_004308050.1|  PREDICTED: heat shock protein 83-like              357   2e-115   Fragaria vesca subsp. vesca
ref|XP_004973824.1|  PREDICTED: heat shock protein 81-1-like            357   2e-115   
gb|KDO76323.1|  hypothetical protein CISIN_1g005321mg                   357   2e-115   Citrus sinensis [apfelsine]
gb|ADP89125.1|  heat shock protein 90                                   356   2e-115   Cenchrus americanus [bulrush millet]
ref|XP_007040338.1|  Heat shock protein 90.1                            357   2e-115   Theobroma cacao [chocolate]
ref|XP_010445119.1|  PREDICTED: heat shock protein 90-1-like            356   3e-115   Camelina sativa [gold-of-pleasure]
ref|NP_001170480.1|  HSP protein                                        356   3e-115   Zea mays [maize]
ref|XP_011080917.1|  PREDICTED: heat shock protein 83-like              356   3e-115   Sesamum indicum [beniseed]
ref|XP_004294900.1|  PREDICTED: heat shock protein 90-2                 356   4e-115   Fragaria vesca subsp. vesca
ref|XP_008797179.1|  PREDICTED: heat shock protein 83-like              356   4e-115   Phoenix dactylifera
ref|XP_006422036.1|  hypothetical protein CICLE_v10004456mg             355   4e-115   Citrus clementina [clementine]
gb|KHG00618.1|  Heat shock 90-1 -like protein                           356   4e-115   Gossypium arboreum [tree cotton]
gb|EYU25148.1|  hypothetical protein MIMGU_mgv1a002213mg                355   5e-115   Erythranthe guttata [common monkey flower]
gb|KJB20596.1|  hypothetical protein B456_003G155600                    355   5e-115   Gossypium raimondii
ref|XP_001780981.1|  predicted protein                                  355   5e-115   
gb|KDO56796.1|  hypothetical protein CISIN_1g005370mg                   355   6e-115   Citrus sinensis [apfelsine]
ref|XP_006659553.1|  PREDICTED: heat shock protein 81-1-like            355   6e-115   
ref|XP_010934626.1|  PREDICTED: heat shock protein 83-like              355   8e-115   Elaeis guineensis
gb|ACN36206.1|  unknown                                                 354   1e-114   Zea mays [maize]
ref|XP_001766228.1|  predicted protein                                  354   2e-114   
gb|ACX37413.1|  cytosolic heat shock protein 90.1                       353   2e-114   Dactylis glomerata [cocksfoot]
ref|XP_007142447.1|  hypothetical protein PHAVU_008G281400g             353   3e-114   Phaseolus vulgaris [French bean]
ref|XP_009413748.1|  PREDICTED: heat shock protein 83                   353   3e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010089052.1|  Heat shock protein 83                              353   4e-114   Morus notabilis
gb|AIZ68152.1|  heat shock protein 81-1                                 353   4e-114   Ornithogalum longebracteatum [sea-onion]
gb|EAY92778.1|  hypothetical protein OsI_14582                          353   4e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_011035346.1|  PREDICTED: heat shock protein 83-like isofor...    353   4e-114   Populus euphratica
gb|ABG57075.1|  heat shock protein 90                                   353   4e-114   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006828794.1|  hypothetical protein AMTR_s00001p00118120          353   5e-114   Amborella trichopoda
gb|KJB24311.1|  hypothetical protein B456_004G138600                    353   6e-114   Gossypium raimondii
ref|XP_010089053.1|  Heat shock protein 83                              352   8e-114   Morus notabilis
gb|ADF31778.1|  heat shock protein 90                                   352   9e-114   Triticum dicoccoides [wild emmer wheat]
gb|KFK38607.1|  hypothetical protein AALP_AA3G136000                    351   1e-113   Arabis alpina [alpine rockcress]
gb|ADF31755.1|  heat shock protein 90                                   352   2e-113   Triticum aestivum [Canadian hard winter wheat]
gb|EMS59444.1|  Heat shock protein 81-3                                 351   2e-113   Triticum urartu
gb|ADF31779.1|  heat shock protein 90                                   351   2e-113   Triticum dicoccoides [wild emmer wheat]
gb|AFR60309.1|  HSP90                                                   351   3e-113   Pelargonium peltatum
dbj|BAJ86355.1|  predicted protein                                      351   3e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADF31759.1|  heat shock protein 90                                   351   3e-113   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99646.1|  predicted protein                                      351   3e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAP87284.1|  cytosolic heat shock protein 90                         351   3e-113   Hordeum vulgare [barley]
gb|ADF31760.1|  heat shock protein 90                                   351   3e-113   Triticum aestivum [Canadian hard winter wheat]
gb|ADF31757.1|  heat shock protein 90                                   350   4e-113   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ85535.1|  predicted protein                                      351   4e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADF31756.1|  heat shock protein 90                                   351   4e-113   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010235286.1|  PREDICTED: heat shock protein 81-1-like            350   5e-113   Brachypodium distachyon [annual false brome]
gb|ADF31772.1|  heat shock protein 90                                   350   6e-113   Triticum urartu
emb|CAE02770.2|  OSJNBb0085F13.17                                       350   9e-113   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001190553.1|  heat shock protein 81-2                            350   9e-113   
gb|ADF31754.1|  heat shock protein 90                                   349   1e-112   
gb|ADF31775.1|  heat shock protein 90                                   349   2e-112   
ref|XP_010235281.1|  PREDICTED: heat shock protein 81-1-like            348   2e-112   
ref|XP_003574727.1|  PREDICTED: heat shock protein 81-1                 348   2e-112   
ref|XP_009628903.1|  PREDICTED: heat shock protein 83-like              348   3e-112   
gb|ADF31773.1|  heat shock protein 90                                   348   3e-112   
gb|ADF31758.1|  heat shock protein 90                                   348   4e-112   
ref|XP_011084460.1|  PREDICTED: heat shock protein 83-like              348   4e-112   
gb|KHN23824.1|  Heat shock cognate protein 80                           348   5e-112   
ref|XP_003580663.1|  PREDICTED: heat shock protein 82                   348   6e-112   
emb|CAA67191.1|  HSP80-2                                                347   8e-112   
gb|ACX37414.1|  cytosolic heat shock protein 90.2                       347   1e-111   
ref|XP_006290237.1|  hypothetical protein CARUB_v100035110mg            339   1e-111   
ref|XP_002973159.1|  hypothetical protein SELMODRAFT_271009             347   1e-111   
ref|XP_002969937.1|  hypothetical protein SELMODRAFT_267300             346   1e-111   
ref|XP_010055687.1|  PREDICTED: heat shock protein 90-1-like            346   2e-111   
ref|XP_002981406.1|  hypothetical protein SELMODRAFT_271484             346   3e-111   
gb|KFK40822.1|  hypothetical protein AALP_AA2G045900                    330   3e-111   
ref|XP_009119805.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    345   6e-111   
ref|XP_006664928.1|  PREDICTED: heat shock protein 82-like              345   6e-111   
gb|KDP25390.1|  hypothetical protein JCGZ_20546                         345   8e-111   
gb|ADF31781.1|  heat shock protein 90                                   344   1e-110   
emb|CDP12067.1|  unnamed protein product                                343   2e-110   
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like              343   3e-110   
gb|ACN27969.1|  unknown                                                 343   3e-110   
ref|XP_008384610.1|  PREDICTED: heat shock protein 90-2                 343   6e-110   
ref|XP_004974995.1|  PREDICTED: heat shock protein 82-like              342   6e-110   
ref|XP_002447413.1|  hypothetical protein SORBIDRAFT_06g000660          342   7e-110   
ref|XP_011398501.1|  Heat shock protein 90-2                            334   8e-110   
ref|XP_002509852.1|  heat shock protein, putative                       341   2e-109   
gb|EMT17245.1|  Heat shock protein 81-3                                 341   3e-109   
ref|XP_002976693.1|  hypothetical protein SELMODRAFT_151384             339   9e-109   
gb|AAD11549.1|  heat shock protein 80                                   338   3e-108   
ref|NP_001135416.2|  heat shock protein 82                              338   4e-108   
ref|XP_005841364.1|  heat shock protein Hsp90, cytosolic protein        337   5e-108   
emb|CEF99333.1|  Histidine kinase-like ATPase, ATP-binding domain       337   7e-108   
ref|XP_001419938.1|  Heat Shock Protein 90, cytosolic                   337   7e-108   
ref|XP_002499727.1|  predicted protein                                  337   7e-108   
ref|XP_005841337.1|  hypothetical protein GUITHDRAFT_83993              336   2e-107   
gb|AAS20999.1|  heat shock protein 82                                   321   6e-107   
gb|KCW79839.1|  hypothetical protein EUGRSUZ_C01179                     334   8e-107   
dbj|BAL45643.1|  heat shock protein 90                                  334   1e-106   
ref|XP_003058104.1|  predicted protein                                  333   2e-106   
emb|CDY36772.1|  BnaA03g11140D                                          323   2e-106   
ref|XP_006401798.1|  hypothetical protein EUTSA_v10012817mg             333   3e-106   
dbj|BAK08741.1|  heat shock protein 90                                  333   3e-106   
dbj|BAH97107.1|  heat shock protein of Hsp90                            333   3e-106   
dbj|BAK08691.1|  heat shock protein 90                                  333   3e-106   
dbj|BAK08690.1|  heat shock protein 90                                  333   3e-106   
dbj|BAK08728.1|  heat shock protein 90                                  333   3e-106   
gb|ACM50884.1|  heat shock protein 90A                                  332   5e-106   
ref|XP_007510316.1|  predicted protein                                  332   6e-106   
emb|CAN70887.1|  hypothetical protein VITISV_005592                     332   7e-106   
dbj|BAK08742.1|  heat shock protein 90                                  331   1e-105   
ref|XP_010446135.1|  PREDICTED: heat shock protein 90-3-like            323   1e-105   
ref|XP_005643103.1|  HSP90-domain-containing protein                    330   3e-105   
emb|CDY11921.1|  BnaC03g13470D                                          325   3e-105   
gb|KCW52046.1|  hypothetical protein EUGRSUZ_J01486                     313   1e-104   
emb|CDY06551.1|  BnaC02g12750D                                          325   1e-104   
gb|KCW90631.1|  hypothetical protein EUGRSUZ_A02734                     328   2e-104   
emb|CDY20742.1|  BnaA02g08820D                                          324   2e-104   
dbj|BAK08743.1|  heat shock protein 90                                  328   2e-104   
emb|CDY64982.1|  BnaA02g35440D                                          323   3e-104   
emb|CDY36807.1|  BnaA03g10790D                                          323   5e-104   
gb|AGV54249.1|  heat-shock protein                                      327   6e-104   
gb|KDD75584.1|  heat shock protein 90 Hsp90                             327   7e-104   
gb|AFK39716.1|  unknown                                                 312   1e-103   
ref|XP_002947115.1|  hypothetical protein VOLCADRAFT_73112              325   4e-103   
gb|AFK31313.1|  heat shock protein 90                                   324   5e-103   
gb|AFK31312.1|  heat shock protein 90                                   324   7e-103   
gb|KCW81281.1|  hypothetical protein EUGRSUZ_C02653                     320   7e-103   
ref|XP_008238949.1|  PREDICTED: heat shock protein 90-1-like            322   7e-102   
ref|XP_001695264.1|  heat shock protein 90A                             319   5e-101   
ref|XP_005777261.1|  hypothetical protein EMIHUDRAFT_443778             319   6e-101   
tpg|DAA34102.1|  TPA: heat shock protein 90                             302   8e-101   
gb|ACC43938.1|  82 kDa heat shock protein                               319   2e-100   
pdb|3K60|A  Chain A, Crystal Structure Of N-Terminal Domain Of Pl...    302   2e-100   
ref|XP_004367478.1|  heat shock protein 90 alpha, putative              318   2e-100   
gb|ETW37559.1|  hsp90-like protein                                      301   3e-100   
gb|ACD88948.1|  hsp82                                                   318   3e-100   
gb|ACF16064.1|  hsp82                                                   317   7e-100   
pdb|3TUH|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    300   9e-100   
emb|CEI86384.1|  Putative Heat shock protein 90-1                       300   9e-100   
gb|ADV59561.1|  heat shock protein 90                                   316   9e-100   
pdb|3HHU|A  Chain A, Human Heat-Shock Protein 90 (Hsp90) In Compl...    300   1e-99    
ref|XP_002754345.2|  PREDICTED: heat shock protein HSP 90-alpha         302   1e-99    
pdb|1OSF|A  Chain A, Human Hsp90 In Complex With 17-desmethoxy-17...    300   1e-99    
pdb|2YI0|A  Chain A, Structural Characterization Of 5-Aryl-4-(5-S...    301   1e-99    
pdb|3INW|A  Chain A, Hsp90 N-Terminal Domain With Pochoxime A           300   1e-99    
gb|ACC43967.1|  82 kDa heat shock protein                               317   1e-99    
pdb|2JJC|A  Chain A, Hsp90 Alpha Atpase Domain With Bound Small M...    300   1e-99    
pdb|3BM9|A  Chain A, Discovery Of Benzisoxazoles As Potent Inhibi...    300   1e-99    
pdb|3QDD|A  Chain A, Hsp90a N-Terminal Domain In Complex With Bii...    301   1e-99    
pdb|1UY6|A  Chain A, Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trim...    301   1e-99    
pdb|3EKO|A  Chain A, Dihydroxylphenyl Amides As Inhibitors Of The...    300   1e-99    
pdb|3D0B|A  Chain A, Crystal Structure Of Benzamide Tetrahydro-4h...    300   1e-99    
gb|ACC43981.1|  82 kDa heat shock protein                               316   1e-99    
pdb|3B24|A  Chain A, Hsp90 Alpha N-terminal Domain In Complex Wit...    300   2e-99    
pdb|4LWE|A  Chain A, Crystal Structure Of The Human Hsp90-alpha N...    300   2e-99    
pdb|3R4M|A  Chain A, Optimization Of Potent, Selective, And Orall...    300   2e-99    
pdb|2BSM|A  Chain A, Novel, Potent Small Molecule Inhibitors Of T...    300   2e-99    
pdb|3K98|A  Chain A, Hsp90 N-Terminal Domain In Complex With (1r)...    300   2e-99    
pdb|4EEH|A  Chain A, Hsp90 Alpha N-Terminal Domain In Complex Wit...    300   2e-99    
pdb|4EGH|A  Chain A, Hsp90-Alpha Atpase Domain In Complex With (4...    300   2e-99    
pdb|2YJW|A  Chain A, Tricyclic Series Of Hsp90 Inhibitors               299   2e-99    
pdb|4AWO|A  Chain A, Complex Of Hsp90 Atpase Domain With Tropane ...    300   2e-99    
pdb|4B7P|A  Chain A, Structure Of Hsp90 With Nms-e973 Inhibitor B...    300   2e-99    
gb|ACC43956.1|  82 kDa heat shock protein                               316   2e-99    
pdb|2QFO|A  Chain A, Hsp90 Complexed With A143571 And A516383           299   2e-99    
gb|AAI02619.1|  HSPCA protein                                           301   2e-99    
pdb|4NH7|A  Chain A, Correlation Between Chemotype-dependent Bind...    300   2e-99    
pdb|1UYI|A  Chain A, Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benz...    300   2e-99    
pdb|2XDU|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    300   2e-99    
pdb|2K5B|A  Chain A, Human Cdc37-Hsp90 Docking Model Based On Nmr       299   3e-99    
gb|AEI70669.1|  heat shock protein 90 alpha-1                           299   3e-99    
pdb|2YE2|A  Chain A, Hsp90 Inhibitors And Drugs From Fragment And...    300   3e-99    
pdb|2FWY|A  Chain A, Structure Of Human Hsp90-Alpha Bound To The ...    300   3e-99    
gb|ACD88973.1|  hsp82                                                   315   3e-99    
pdb|2YEE|A  Chain A, Hsp90 Inhibitors And Drugs From Fragment And...    300   3e-99    
gb|AAI51819.1|  HSPCA protein                                           300   4e-99    
emb|CEJ04800.1|  Putative Heat shock protein 82                         314   4e-99    
pdb|2YE7|A  Chain A, Hsp90 Inhibitors And Drugs From Fragment And...    300   4e-99    
pdb|3FT5|A  Chain A, Structure Of Hsp90 Bound With A Novel Fragment     300   4e-99    
pdb|3K97|A  Chain A, Hsp90 N-Terminal Domain In Complex With 4-Ch...    300   4e-99    
pdb|2CCS|A  Chain A, Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Y...    300   4e-99    
pdb|1BYQ|A  Chain A, Hsp90 N-Terminal Domain Bound To Adp-Mg            299   4e-99    
pdb|2QF6|A  Chain A, Hsp90 Complexed With A56322                        298   6e-99    
dbj|BAC40681.1|  unnamed protein product                                300   7e-99    
gb|ACO58574.1|  heat shock protein 90                                   299   1e-98    
pdb|2XJG|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    299   1e-98    
gb|AJG42174.1|  heat shock protein 90                                   296   1e-98    
gb|ACO58579.1|  heat shock protein 90                                   299   2e-98    
ref|XP_006408893.1|  hypothetical protein EUTSA_v10002229mg             312   2e-98    
pdb|1YC1|A  Chain A, Crystal Structures Of Human Hsp90alpha Compl...    299   2e-98    
gb|AAF74276.1|AF250004_1  82 kDa heat shock protein 4                   300   2e-98    
dbj|BAF75925.1|  heat shock protein 90                                  311   2e-98    
gb|ACO58578.1|  heat shock protein 90                                   298   2e-98    
gb|AAI60441.1|  Unknown (protein for IMAGE:7558608)                     299   3e-98    
emb|CEG72304.1|  Putative Heat shock protein 90                         312   3e-98    
emb|CAG32523.1|  hypothetical protein RCJMB04_28d6                      296   3e-98    
gb|AAL83217.1|AF473560_1  heat shock protein 90 alpha                   297   3e-98    
emb|CEG62768.1|  Putative Heat shock protein 90 homolog                 312   3e-98    
emb|CAA30255.1|  unnamed protein product                                300   4e-98    
gb|AAF74274.1|AF250002_1  82 kDa heat shock protein 3                   299   4e-98    
pdb|2XJJ|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    297   5e-98    
gb|AEX08891.1|  heat-shock protein 90                                   296   5e-98    
gb|AAF01787.1|AF143849_1  82 kD heat shock protein 1                    298   6e-98    
ref|XP_308799.3|  AGAP006959-PA                                         302   6e-98    
emb|CEI87928.1|  Putative Heat shock protein hsp90-like protein         311   6e-98    
emb|CAG31600.1|  hypothetical protein RCJMB04_8j21                      296   6e-98    
gb|EGV94858.1|  Heat shock protein HSP 90-alpha                         300   6e-98    
emb|CAG31138.1|  hypothetical protein RCJMB04_2l3                       296   7e-98    
gb|KCW82680.1|  hypothetical protein EUGRSUZ_C04059                     304   8e-98    
emb|CCQ18614.1|  Molecular chaperone (HSP90 family)                     311   8e-98    
ref|XP_729157.1|  heat shock protein 81-2                               303   2e-97    
emb|CDS02719.1|  Putative Heat shock protein 90-1                       310   2e-97    
gb|EIE75417.1|  hsp83-like protein                                      310   2e-97    
gb|AEP39605.1|  heat shock protein 90                                   310   2e-97    
gb|EIE88925.1|  heat shock protein 90-1                                 310   2e-97    
ref|XP_680456.1|  hypothetical protein                                  303   2e-97    
gb|AAF01789.1|  82 kD heat shock protein 1                              297   2e-97    
gb|AAF74269.1|AF249997_1  82 kDa heat shock protein 2                   297   2e-97    
gb|ADQ64484.1|  hypothetical protein                                    295   3e-97    
gb|ADQ20111.1|  heat shock protein 90                                   310   3e-97    
gb|AAF74271.1|AF249999_1  82 kDa heat shock protein 3                   297   3e-97    
emb|CDS03201.1|  Putative Heat shock protein 90-1                       309   3e-97    
gb|EIE86519.1|  heat shock protein 90-1                                 309   3e-97    
gb|AAF01788.1|  82 kD heat shock protein 1                              296   3e-97    
emb|CDH60666.1|  heat shock protein 90                                  308   4e-97    
gb|AAC32131.1|  heat shock protein                                      293   5e-97    
gb|AAX10949.1|  heat shock protein 90                                   305   5e-97    
gb|AAA37868.1|  heat-shock protein hsp86                                298   5e-97    
gb|AAF74273.1|AF250001_1  82 kDa heat shock protein 3                   296   6e-97    
gb|AAF74272.1|AF250000_1  82 kDa heat shock protein 2                   296   6e-97    
gb|AEV53616.1|  heat shock protein 90-beta                              292   6e-97    
emb|CDS03376.1|  Putative Heat shock protein 90-1                       308   8e-97    
gb|EDM18741.1|  rCG43497, isoform CRA_b                                 293   8e-97    
ref|XP_007986070.1|  PREDICTED: heat shock protein HSP 90-alpha         299   9e-97    
gb|KCW84385.1|  hypothetical protein EUGRSUZ_B01235                     305   9e-97    
emb|CDJ58300.1|  hypothetical protein EMWEY_00014950                    301   1e-96    
dbj|BAK20463.1|  heat shock protein 90                                  296   1e-96    
gb|AEA42008.1|  heat shock protein 90                                   308   2e-96    
pdb|1UYM|A  Chain A, Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-T...    292   2e-96    
emb|CDH51743.1|  heat shock protein 90                                  307   2e-96    
gb|AAF74270.1|AF249998_1  82 kDa heat shock protein 2                   295   2e-96    
gb|AIL52741.1|  heat shock protein 90                                   308   2e-96    
emb|CDH57487.1|  heat shock protein 90                                  307   3e-96    
ref|XP_005855339.1|  molecular chaperone HtpG                           307   3e-96    
gb|AAQ97223.1|  Hsp82                                                   294   3e-96    
gb|AAI02945.1|  HSP90AB1 protein                                        293   3e-96    
ref|XP_001640689.1|  predicted protein                                  307   3e-96    
gb|EWM29604.1|  heat shock protein 90                                   307   3e-96    
gb|ACZ97018.1|  heat shock protein 90                                   307   4e-96    
gb|AEE01388.1|  heat shock protein 90                                   291   4e-96    
ref|XP_008917763.1|  PREDICTED: heat shock protein HSP 90-alpha         301   5e-96    
pdb|3NMQ|A  Chain A, Hsp90b N-Terminal Domain In Complex With Ec4...    291   6e-96    
sp|O16087.1|HSP83_DROMI  RecName: Full=Heat shock protein 83; Alt...    293   7e-96    
gb|ACQ90225.1|  heat shock protein 90-1                                 306   8e-96    
gb|AAI30207.1|  LOC100037031 protein                                    292   8e-96    
ref|XP_002414808.1|  Hsp90 protein, putative                            306   9e-96    
gb|AGJ90347.1|  Heat shock protein 90                                   301   9e-96    
gb|AAC07938.1|  82 kDa heat shock protein                               292   1e-95    
gb|EAW81767.1|  heat shock protein 90kDa alpha (cytosolic), class...    299   1e-95    
gb|EMS22510.1|  molecular chaperone HtpG                                305   1e-95    
gb|ACA03524.1|  heat shock protein 90                                   305   1e-95    
gb|AAA36024.1|  heat shock protein 86                                   293   2e-95    
gb|EPB88745.1|  heat shock protein 90-1                                 305   2e-95    
ref|XP_006270466.1|  PREDICTED: heat shock protein HSP 90-alpha         295   2e-95    
gb|ADT63790.1|  heat shock protein 90                                   305   2e-95    
gb|ADL59936.1|  heat shock protein 90                                   305   2e-95    
dbj|BAF57908.1|  Heat-shock protein 90                                  292   2e-95    
ref|XP_001649752.1|  AAEL014843-PA                                      305   3e-95    
gb|ETW50276.1|  hsp90-like protein                                      305   3e-95    
emb|CEP16055.1|  hypothetical protein                                   304   3e-95    
gb|AAC07939.1|  82 kDa heat shock protein                               291   3e-95    
gb|EUT88770.1|  hsp90-like protein                                      305   3e-95    
gb|KFB48797.1|  hypothetical protein ZHAS_00016808                      301   3e-95    
ref|XP_001655641.1|  AAEL011708-PA                                      304   3e-95    
emb|CEP09503.1|  hypothetical protein                                   304   3e-95    
gb|AAC07928.1|  82 kDa heat shock protein                               291   4e-95    



>ref|XP_009785111.1| PREDICTED: heat shock cognate protein 80 [Nicotiana sylvestris]
Length=699

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|ADU04386.1| heat shock protein 90-1 [Nicotiana attenuata]
Length=699

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|ADX06844.1| molecular chaperone Hsp90 [Nicotiana tabacum]
Length=699

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_009591410.1| PREDICTED: heat shock cognate protein 80 [Nicotiana tomentosiformis]
 dbj|BAE97400.1| heat shock protein 90 [Nicotiana tabacum]
 dbj|BAM24708.1| Heat shock protein 90 [Nicotiana tabacum]
Length=699

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KJB81564.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=587

 Score =   373 bits (957),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|AAS79798.1| heat shock protein 90 [Nicotiana tabacum]
Length=699

 Score =   376 bits (966),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKE+FLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEVFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|AAR12193.1| molecular chaperone Hsp90-1 [Nicotiana benthamiana]
Length=699

 Score =   375 bits (964),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSG+NLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGDNLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|AGA62462.1| heat shock protein 90 [Gossypium hirsutum]
Length=699

 Score =   375 bits (962),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEN+GRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENIGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_011089536.1| PREDICTED: heat shock cognate protein 80 [Sesamum indicum]
Length=699

 Score =   375 bits (962),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|AFK35835.1| unknown [Lotus japonicus]
Length=190

 Score =   357 bits (915),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 184/188 (98%), Gaps = 1/188 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLS-IDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNNSL+ IDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTLIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE+LGR TKITL+LKE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGESLGRRTKITLYLKE  180

Query  617  DQLEYLEE  640
            DQLEYLE+
Sbjct  181  DQLEYLED  188



>gb|AEC11021.1| heat shock protein 90, partial [Camellia sinensis]
Length=240

 Score =   358 bits (920),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIV +KHNDDEQYVWESQAGGSFTVTRDT+ E+LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVVSKHNDDEQYVWESQAGGSFTVTRDTTDESLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_011097724.1| PREDICTED: heat shock cognate protein 80-like [Sesamum indicum]
Length=699

 Score =   374 bits (959),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KJB81563.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=684

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KJB22184.1| hypothetical protein B456_004G033900 [Gossypium raimondii]
Length=699

 Score =   374 bits (959),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT KHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTAKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KJB81562.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=699

 Score =   373 bits (958),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>emb|CBI25731.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   369 bits (948),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|AAR12194.1| molecular chaperone Hsp90-2 [Nicotiana benthamiana]
Length=699

 Score =   373 bits (957),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 188/190 (99%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_004169769.1| PREDICTED: LOW QUALITY PROTEIN: heat shock cognate protein 80-like, 
partial [Cucumis sativus]
Length=587

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>dbj|BAD95030.1| heat-shock protein [Arabidopsis thaliana]
Length=246

 Score =   357 bits (916),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK+N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK+
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKD  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010539340.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|ADU04387.1| heat shock protein 90-2 [Nicotiana attenuata]
Length=699

 Score =   372 bits (954),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 188/190 (99%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD+Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDSQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_009758556.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana sylvestris]
Length=699

 Score =   371 bits (953),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_009594054.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana tomentosiformis]
Length=699

 Score =   371 bits (953),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KHN43913.1| Heat shock cognate protein 80 [Glycine soja]
Length=494

 Score =   365 bits (936),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVA+KVIVTTKHNDDEQYVWES AGGSFTVTRDTSGENLGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVADKVIVTTKHNDDEQYVWESHAGGSFTVTRDTSGENLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>gb|KGN66052.1| hypothetical protein Csa_1G569290 [Cucumis sativus]
Length=631

 Score =   369 bits (947),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>dbj|BAG16518.1| putative Hsp90-2 [Capsicum chinense]
Length=699

 Score =   371 bits (952),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD+ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADSETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKI LFLKE
Sbjct  121  FGVGFYSAYLVAEKVLVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKIVLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|NP_001234436.1| molecular chaperone Hsp90-1 [Solanum lycopersicum]
 gb|AAR12195.1| molecular chaperone Hsp90-1 [Solanum lycopersicum]
Length=699

 Score =   370 bits (950),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 188/190 (99%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFQSLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+TLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMTLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_009607645.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana tomentosiformis]
Length=699

 Score =   370 bits (950),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KDP32613.1| hypothetical protein JCGZ_13163 [Jatropha curcas]
Length=699

 Score =   370 bits (950),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDASGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>emb|CAN62488.1| hypothetical protein VITISV_029391 [Vitis vinifera]
Length=699

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_003635036.1| PREDICTED: heat shock cognate protein 80 [Vitis vinifera]
Length=699

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KHG19401.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEKLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KHG22758.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDT+GE++GRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTTGESIGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KJB22185.1| hypothetical protein B456_004G034000 [Gossypium raimondii]
Length=666

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT KHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTAKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEER 
Sbjct  181  DQLEYLEERH  190



>ref|XP_009763345.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana sylvestris]
Length=699

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD+Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDSQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KGN66050.1| hypothetical protein Csa_1G569270 [Cucumis sativus]
Length=699

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|ACX31585.1| molecular chaperone Hsp90-3 [Nicotiana benthamiana]
Length=700

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQ LSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD+Q
Sbjct  1    MAEAETFAFQAEINQQLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDSQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_004135593.1| PREDICTED: heat shock cognate protein 80-like [Cucumis sativus]
Length=699

 Score =   369 bits (947),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|ACR35758.1| unknown [Zea mays]
 gb|ACR36747.1| unknown [Zea mays]
 tpg|DAA47843.1| TPA: putative heat shock protein 90 family protein isoform 1 
[Zea mays]
 tpg|DAA47844.1| TPA: putative heat shock protein 90 family protein isoform 2 
[Zea mays]
Length=351

 Score =   358 bits (918),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK NN+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMTLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>gb|AAN61003.1| putative heat shock protein 90 [Arabidopsis thaliana]
 gb|AAN64168.1| putative heat shock protein 90 [Arabidopsis thaliana]
Length=526

 Score =   363 bits (933),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_010910639.1| PREDICTED: heat shock protein 81-1, partial [Elaeis guineensis]
Length=565

 Score =   365 bits (936),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEKLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>emb|CBI34381.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   356 bits (913),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFT+TRD +GE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVNGEQLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQ+EYLEERR
Sbjct  181  DQMEYLEERR  190



>pdb|2XCM|A Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 
Domain
 pdb|2XCM|B Chain B, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 
Domain
Length=214

 Score =   352 bits (902),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 182/191 (95%), Gaps = 1/191 (1%)
 Frame = +2

Query  77   AMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  256
            A  + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
Sbjct  4    AATETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  63

Query  257  QPELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIG  433
            QPELFIHI+PDK  ++L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIG
Sbjct  64   QPELFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG  123

Query  434  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  613
            QFGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  124  QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMVLYLK  183

Query  614  EDQLEYLEERR  646
            +DQ+EYLEERR
Sbjct  184  DDQMEYLEERR  194



>emb|CDP13679.1| unnamed protein product [Coffea canephora]
Length=681

 Score =   368 bits (944),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PE FIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PEFFIHIIPDKTNNTLSIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGENLGRGTK+TLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDASGENLGRGTKMTLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|EAZ43234.1| hypothetical protein OsJ_27834 [Oryza sativa Japonica Group]
Length=423

 Score =   359 bits (922),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 174/189 (92%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|NP_001274833.1| Hsp90-2-like [Solanum tuberosum]
 gb|ABB55365.1| Hsp90-2-like [Solanum tuberosum]
Length=700

 Score =   368 bits (945),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MSDIETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010252844.1| PREDICTED: heat shock cognate protein 80-like [Nelumbo nucifera]
Length=699

 Score =   368 bits (945),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN++SI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTISIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE+LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDASGESLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_006857538.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
 gb|ERN19005.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
Length=699

 Score =   368 bits (944),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDK +N+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKASNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD+SGE+LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDSSGESLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|AAK91366.1| AT5g56010/MDA7_5 [Arabidopsis thaliana]
Length=527

 Score =   362 bits (930),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_010246543.1| PREDICTED: heat shock cognate protein 80 [Nelumbo nucifera]
Length=699

 Score =   368 bits (944),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFE LTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEDLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|ABW96308.1| heat shock protein 90 [Vitis pseudoreticulata]
Length=699

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT KHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTAKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KJB13949.1| hypothetical protein B456_002G103000 [Gossypium raimondii]
Length=699

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQ+VWESQAGGSFTVTRDT+GE++GRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQFVWESQAGGSFTVTRDTTGESIGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_011030250.1| PREDICTED: heat shock protein 81-1-like [Populus euphratica]
Length=706

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 188/190 (99%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK +N+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KHN31689.1| Heat shock cognate protein 80 [Glycine soja]
Length=700

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|ADC45395.1| HSP90-1 [Glycine max]
Length=702

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_006344905.1| PREDICTED: heat shock cognate protein 80-like [Solanum tuberosum]
Length=699

 Score =   367 bits (942),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFQSLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTV RDTSGE+LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVARDTSGEDLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_009126978.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=696

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010552350.1| PREDICTED: heat shock protein 90-2 [Tarenaya hassleriana]
Length=699

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRIVPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+TLFLKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMTLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>pdb|2JKI|A Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain
 pdb|2JKI|B Chain B, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain
 pdb|2JKI|C Chain C, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain
Length=223

 Score =   351 bits (900),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 181/188 (96%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  265
            + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  10   ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  69

Query  266  LFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  442
            LFIHI+PDK  ++L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  70   LFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  129

Query  443  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKEDQ  622
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK+DQ
Sbjct  130  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMVLYLKDDQ  189

Query  623  LEYLEERR  646
            +EYLEERR
Sbjct  190  MEYLEERR  197



>gb|EPS61618.1| hypothetical protein M569_13176 [Genlisea aurea]
Length=701

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKITLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_006401391.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
 dbj|BAJ33984.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42844.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
Length=699

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+TL LKE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMTLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010675973.1| PREDICTED: heat shock cognate protein 80 [Beta vulgaris subsp. 
vulgaris]
Length=698

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFE LTDKSKL+AQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLEAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNNSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_006287183.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
 gb|EOA20081.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
Length=699

 Score =   366 bits (940),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_002273244.1| PREDICTED: heat shock cognate protein 80-like [Vitis vinifera]
Length=704

 Score =   366 bits (940),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            P+LFIHIVPDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PDLFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGERLGRGTKITLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|ABX76302.1| heat shock protein 90 [Ageratina adenophora]
Length=697

 Score =   366 bits (939),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNALTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAITAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010928158.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=702

 Score =   366 bits (939),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 186/189 (98%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKGSNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_002300303.1| HSP80 family protein [Populus trichocarpa]
 gb|EEE85108.1| HSP80 family protein [Populus trichocarpa]
Length=706

 Score =   366 bits (939),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 188/190 (99%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK +N+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KFK40163.1| hypothetical protein AALP_AA3G338900 [Arabis alpina]
Length=701

 Score =   366 bits (939),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDMETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK+NN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ
Sbjct  61   PELFIHIIPDKSNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+V TKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+TL+LK+
Sbjct  121  FGVGFYSAYLVAEKVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMTLYLKD  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_008811147.1| PREDICTED: heat shock protein 81-1-like [Phoenix dactylifera]
Length=701

 Score =   366 bits (939),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFE LTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_007020406.1| Heat shock protein 81.4 [Theobroma cacao]
 gb|EOY11931.1| Heat shock protein 81.4 [Theobroma cacao]
Length=699

 Score =   365 bits (938),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNNSLSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDDAGEKLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_006280101.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
 gb|EOA12999.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
Length=699

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_011039800.1| PREDICTED: heat shock protein 90-2 [Populus euphratica]
Length=699

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKT+N+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTSNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKI L+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKIVLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|NP_200414.1| heat shock protein 81-2 [Arabidopsis thaliana]
 sp|P55737.1|HS902_ARATH RecName: Full=Heat shock protein 90-2; Short=AtHSP90.2; AltName: 
Full=Heat shock protein 81-2; Short=HSP81-2; AltName: Full=Protein 
EARLY-RESPONSIVE TO DEHYDRATION 8; AltName: Full=Protein 
LOSS OF RECOGNITION OF AVRRPM1 2 [Arabidopsis thaliana]
 dbj|BAB09285.1| HEAT SHOCK PROTEIN 81-2 (HSP81-2) [Arabidopsis thaliana]
 gb|AAL32828.1| HEAT SHOCK PROTEIN 81-2 (HSP81-2) [Arabidopsis thaliana]
 gb|AAM91205.1| heat shock protein 81-2 [Arabidopsis thaliana]
 gb|AAN71943.1| putative heat-shock protein HSP81-2 [Arabidopsis thaliana]
 gb|AAO00895.1| Unknown protein [Arabidopsis thaliana]
 gb|AED96711.1| heat shock protein 81-2 [Arabidopsis thaliana]
 prf||1908431B heat shock protein HSP81-2
Length=699

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010450563.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>gb|EYU33725.1| hypothetical protein MIMGU_mgv1a002215mg [Erythranthe guttata]
Length=700

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL++Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLESQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010443242.1| PREDICTED: heat shock protein 90-2 [Camelina sativa]
Length=699

 Score =   365 bits (938),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>dbj|BAE71229.1| putative HEAT SHOCK PROTEIN 81-2 [Trifolium pratense]
Length=478

 Score =   358 bits (920),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKLD+Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDSQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARS TKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSATKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLILKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_003544594.1| PREDICTED: heat shock cognate protein 80-like [Glycine max]
Length=700

 Score =   365 bits (938),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVA+KVIVTTKHNDDEQYVWES AGGSFTVTRDTSGENLGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVADKVIVTTKHNDDEQYVWESHAGGSFTVTRDTSGENLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>gb|AEK20869.1| heat shock protein 90-2 [Cryptocoryne ciliata]
Length=700

 Score =   365 bits (937),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLS-IDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK NNSLS IDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNSLSTIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRDTSGENLGRGTK+TLFLK+D
Sbjct  123  GVGFYSAYLVAEKVIVTSKHNDDEQYIWESQAGGSFTVTRDTSGENLGRGTKMTLFLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>gb|AAN31859.1| putative heat shock protein 81-2 (HSP81-2) [Arabidopsis thaliana]
Length=699

 Score =   365 bits (937),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|NP_001236599.1| heat shock protein 90-2 [Glycine max]
 gb|ACI31551.1| heat shock protein 90-2 [Glycine max]
Length=700

 Score =   365 bits (937),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVA+KVIVTTKHNDDEQYVWES AGGSFTVTRDTSGENLGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVADKVIVTTKHNDDEQYVWESHAGGSFTVTRDTSGENLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_010103960.1| Heat shock cognate protein 80 [Morus notabilis]
 gb|EXB97663.1| Heat shock cognate protein 80 [Morus notabilis]
Length=732

 Score =   366 bits (939),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MSETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEILGRGTKITLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KFK27172.1| hypothetical protein AALP_AA8G344900 [Arabis alpina]
Length=699

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KEH26332.1| heat shock protein 81-2 [Medicago truncatula]
Length=699

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK NN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKANNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|NP_001234439.1| heat shock cognate protein 80 [Solanum lycopersicum]
 sp|P36181.1|HSP80_SOLLC RecName: Full=Heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAB01376.1| heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAR12196.1| molecular chaperone Hsp90-2 [Solanum lycopersicum]
 prf||1909348A heat shock protein hsp80
Length=699

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_002866122.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42381.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_009391803.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=699

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDK  N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRD SGE+LGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVSGESLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_010537148.1| PREDICTED: heat shock protein 83 [Tarenaya hassleriana]
Length=702

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_008234835.1| PREDICTED: heat shock protein 83 [Prunus mume]
Length=703

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_006280103.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
 gb|EOA13001.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
Length=699

 Score =   364 bits (934),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            P+LFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PDLFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_010483071.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVT+DTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTKDTSGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_008439282.1| PREDICTED: heat shock protein 83 [Cucumis melo]
Length=703

 Score =   364 bits (934),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_007220219.1| hypothetical protein PRUPE_ppa002187mg [Prunus persica]
 gb|EMJ21418.1| hypothetical protein PRUPE_ppa002187mg [Prunus persica]
Length=703

 Score =   364 bits (934),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_004234218.1| PREDICTED: heat shock protein 83 [Solanum lycopersicum]
Length=704

 Score =   364 bits (934),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_010483070.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVT+DTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTKDTSGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_004491531.1| PREDICTED: heat shock cognate protein 80-like isoform X2 [Cicer 
arietinum]
Length=660

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLILKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_011040123.1| PREDICTED: heat shock protein 81-1 [Populus euphratica]
Length=698

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK  N+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKVTNTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VT+KHNDDEQYVWESQAGGSFT+TRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVADKVVVTSKHNDDEQYVWESQAGGSFTITRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_006373573.1| HSP80 family protein [Populus trichocarpa]
 gb|ERP51370.1| HSP80 family protein [Populus trichocarpa]
Length=698

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK  N+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKATNTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VT+KHNDDEQYVWESQAGGSFT+TRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVADKVVVTSKHNDDEQYVWESQAGGSFTITRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_006352548.1| PREDICTED: heat shock cognate protein 80-like [Solanum tuberosum]
Length=699

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTV RDTSGE+LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVARDTSGESLGRGTKMILYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_011005759.1| PREDICTED: heat shock cognate protein 80-like [Populus euphratica]
Length=699

 Score =   363 bits (933),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NNSL+I DSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNSLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYS+YLVA+KV+VT+KHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE
Sbjct  121  FGVGFYSSYLVADKVVVTSKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|AHB36893.1| heat shock protein 90 [Matricaria chamomilla var. recutita]
Length=698

 Score =   363 bits (933),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNS DALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSFDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK +N+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIVDSGVGMTKADLVNNLGTIARSGTKEFMEAITAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|NP_001236612.1| heat shock protein 90-1 [Glycine max]
 gb|ACI31552.1| heat shock protein 90-1 [Glycine max]
Length=702

 Score =   363 bits (933),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDNTGEVLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|NP_001240230.1| uncharacterized protein LOC100819568 [Glycine max]
 gb|ADC45396.1| HSP90-2 [Glycine max]
 gb|KHN01774.1| Heat shock cognate protein 80 [Glycine soja]
Length=699

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDNTGEVLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|AAB33937.1| heat-shock Protein [Arabidopsis thaliana]
Length=699

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_002307846.1| HSP80 family protein [Populus trichocarpa]
 gb|ABK95597.1| unknown [Populus trichocarpa]
 gb|EEE91369.1| HSP80 family protein [Populus trichocarpa]
Length=699

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 187/190 (98%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NNSL+I DSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNSLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYS+YLVA+KV+VT+KHNDDEQYVWESQAGGSFTVTRDTSGENLGRG+KITLFLKE
Sbjct  121  FGVGFYSSYLVADKVVVTSKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGSKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010913224.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=700

 Score =   363 bits (932),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK+D
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_007152171.1| hypothetical protein PHAVU_004G107700g [Phaseolus vulgaris]
 gb|ESW24165.1| hypothetical protein PHAVU_004G107700g [Phaseolus vulgaris]
Length=700

 Score =   363 bits (932),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPD+ N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDQANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT GE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTDGEQLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_009417329.1| PREDICTED: heat shock protein 81-1 [Musa acuminata subsp. malaccensis]
Length=699

 Score =   363 bits (932),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK  N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_010443241.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   363 bits (932),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELF+HI+PDKTNN+L+I D GVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFVHIIPDKTNNTLTIIDRGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_002869603.1| early-responsive to dehydration 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45862.1| early-responsive to dehydration 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=700

 Score =   363 bits (932),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAEKVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010536759.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
 ref|XP_010536760.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   363 bits (932),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK +N+LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEILGRGTKITLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|AGU99972.1| HSP90 [Populus tomentosa]
Length=699

 Score =   363 bits (931),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKT+N+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTSNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKI L+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDNSGEPLGRGTKIVLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|NP_200412.1| Heat shock protein 90-3 [Arabidopsis thaliana]
 sp|P51818.2|HS903_ARATH RecName: Full=Heat shock protein 90-3; Short=AtHSP90.3; AltName: 
Full=HSP81.2; AltName: Full=Heat shock protein 81-3; Short=HSP81-3 
[Arabidopsis thaliana]
 dbj|BAB09283.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL32910.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL91191.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AED96709.1| heat shock protein 81-3 [Arabidopsis thaliana]
Length=699

 Score =   363 bits (931),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_009768512.1| PREDICTED: heat shock protein 82 [Nicotiana sylvestris]
Length=703

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|NP_200411.1| Heat shock protein 90-4 [Arabidopsis thaliana]
 sp|O03986.1|HS904_ARATH RecName: Full=Heat shock protein 90-4; Short=AtHSP90.4; AltName: 
Full=Heat shock protein 81-4; Short=HSP81-4 [Arabidopsis 
thaliana]
 emb|CAA72514.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAB09282.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAE99287.1| heat shock protein [Arabidopsis thaliana]
 gb|AED96708.1| Heat shock protein 90-4 [Arabidopsis thaliana]
Length=699

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMILYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>tpg|DAA61990.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=629

 Score =   361 bits (926),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 183/188 (97%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  265
            + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  4    ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  266  LFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  442
            LFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  443  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKEDQ  622
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLKEDQ
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLFLKEDQ  183

Query  623  LEYLEERR  646
            LEYLEERR
Sbjct  184  LEYLEERR  191



>ref|XP_010047845.1| PREDICTED: LOW QUALITY PROTEIN: heat shock cognate protein 80-like 
[Eucalyptus grandis]
Length=702

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLREL+SN+SDALDKIRFESLTDK+KLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELVSNASDALDKIRFESLTDKTKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK +NSL+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FG GFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL+LKE
Sbjct  121  FGXGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_002532177.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30214.1| heat shock protein, putative [Ricinus communis]
Length=698

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 185/190 (97%), Gaps = 2/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRD SGENLGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRD-SGENLGRGTKITLHLKE  179

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  180  DQLEYLEERR  189



>gb|AAL49788.1| putative heat shock protein 90 [Arabidopsis thaliana]
Length=699

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_008776162.1| PREDICTED: heat shock protein 81-1 [Phoenix dactylifera]
Length=700

 Score =   363 bits (931),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>gb|KDP22224.1| hypothetical protein JCGZ_26055 [Jatropha curcas]
Length=703

 Score =   363 bits (931),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSILDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_002513649.1| heat shock protein, putative [Ricinus communis]
 gb|EEF49052.1| heat shock protein, putative [Ricinus communis]
Length=703

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_009132345.1| PREDICTED: heat shock protein 90-2 [Brassica rapa]
Length=699

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINT YSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTLYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+ L LKE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMVLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_004491530.1| PREDICTED: heat shock cognate protein 80-like isoform X1 [Cicer 
arietinum]
Length=699

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLILKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KFK29176.1| hypothetical protein AALP_AA7G099100 [Arabis alpina]
Length=700

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK+NN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKSNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAEKVVVITKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_011076104.1| PREDICTED: heat shock protein 83 [Sesamum indicum]
Length=698

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_003533977.1| PREDICTED: heat shock protein 83-like [Glycine max]
 gb|KHN42443.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKDNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|EYU31897.1| hypothetical protein MIMGU_mgv1a002208mg [Erythranthe guttata]
Length=701

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDK+KLD+Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKAKLDSQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL+AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALSAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYL AEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTS E LGRG+KITL+LKE
Sbjct  121  FGVGFYSAYLAAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSDETLGRGSKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_009390627.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=700

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDK  N+LSI DSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKATNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVA++V+VT+KHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVADRVVVTSKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|NP_001275844.1| HSP90 protein [Citrus sinensis]
 gb|AFF58924.1| Hsp90 [Citrus sinensis]
Length=700

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 183/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKVIVT KHNDDEQY+WESQAGGSFTVTRDTSGE LGRGTKITL LKED
Sbjct  123  GVGFYSAYLVAEKVIVTAKHNDDEQYIWESQAGGSFTVTRDTSGEPLGRGTKITLHLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_006452664.1| hypothetical protein CICLE_v10007633mg [Citrus clementina]
 gb|AFF58923.1| Hsp90 [Citrus sinensis]
 gb|ESR65904.1| hypothetical protein CICLE_v10007633mg [Citrus clementina]
 gb|KDO59214.1| hypothetical protein CISIN_1g045760mg [Citrus sinensis]
Length=700

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 183/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDKTNNSLSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNSLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKVIVT KHNDDEQY+WESQAGGSFTVTRDTSGE LGRGTKITL LKED
Sbjct  123  GVGFYSAYLVAEKVIVTAKHNDDEQYIWESQAGGSFTVTRDTSGELLGRGTKITLHLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_009383207.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=700

 Score =   362 bits (929),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    AESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK  N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVA++V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVADRVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_009368732.1| PREDICTED: heat shock protein 83 [Pyrus x bretschneideri]
Length=703

 Score =   362 bits (929),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_006362664.1| PREDICTED: heat shock protein 83-like [Solanum tuberosum]
Length=704

 Score =   362 bits (929),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_006599549.1| PREDICTED: heat shock protein 83-like [Glycine max]
Length=699

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLS-IDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LS IDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSVIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTK+TLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGRGTKMTLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010671625.1| PREDICTED: heat shock protein 83 [Beta vulgaris subsp. vulgaris]
Length=703

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT+GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTTGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>gb|KHN09298.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTK+TLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGRGTKMTLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_004140753.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 ref|XP_004157188.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 gb|KGN57413.1| hypothetical protein Csa_3G183950 [Cucumis sativus]
Length=703

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_006413166.1| hypothetical protein EUTSA_v10024564mg [Eutrema salsugineum]
 gb|ESQ54619.1| hypothetical protein EUTSA_v10024564mg [Eutrema salsugineum]
Length=700

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK+NN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKSNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAEKVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>emb|CBI22652.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQ+EYLEERR
Sbjct  186  DQVEYLEERR  195



>ref|XP_002299048.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
 gb|EEE83853.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
Length=699

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 183/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHIVPDKT+N+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTSNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTV RDTSGE LGRGTKI L+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVIRDTSGEPLGRGTKIVLYLKE  180

Query  617  DQLEYLEER  643
            DQLEYLEER
Sbjct  181  DQLEYLEER  189



>ref|XP_002460433.1| hypothetical protein SORBIDRAFT_02g028050 [Sorghum bicolor]
 gb|EER96954.1| hypothetical protein SORBIDRAFT_02g028050 [Sorghum bicolor]
Length=699

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 183/188 (97%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  265
            D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  4    DTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  266  LFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  442
            LFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  443  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKEDQ  622
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK+DQ
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLFLKDDQ  183

Query  623  LEYLEERR  646
            LEYLEERR
Sbjct  184  LEYLEERR  191



>ref|XP_009420064.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=698

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 183/188 (97%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  265
            + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  4    ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  266  LFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  442
            LFIHIVPDK  N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHIVPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  443  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKEDQ  622
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITLFLKEDQ
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLFLKEDQ  183

Query  623  LEYLEERR  646
            LEYLEERR
Sbjct  184  LEYLEERR  191



>ref|XP_008652859.1| PREDICTED: heat shock protein 81-1 [Zea mays]
 tpg|DAA61991.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=699

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 183/188 (97%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  265
            + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  4    ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  266  LFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  442
            LFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  443  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKEDQ  622
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLKEDQ
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLFLKEDQ  183

Query  623  LEYLEERR  646
            LEYLEERR
Sbjct  184  LEYLEERR  191



>ref|XP_008355028.1| PREDICTED: heat shock protein 90-2 [Malus domestica]
Length=694

 Score =   361 bits (926),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL+AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALSAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010060433.1| PREDICTED: heat shock protein 83-like [Eucalyptus grandis]
 gb|KCW90632.1| hypothetical protein EUGRSUZ_A02734 [Eucalyptus grandis]
Length=704

 Score =   361 bits (927),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+E LTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYEGLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDKTN +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_004516872.1| PREDICTED: heat shock protein 83-like [Cicer arietinum]
Length=699

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADGETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_008811143.1| PREDICTED: heat shock protein 81-1-like [Phoenix dactylifera]
Length=700

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
             + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    GETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +NSLSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNSLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKV+VTTK+NDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED
Sbjct  123  GVGFYSAYLVAEKVVVTTKNNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>gb|EYU19581.1| hypothetical protein MIMGU_mgv1a002166mg [Erythranthe guttata]
Length=706

 Score =   361 bits (927),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDDDGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_009132299.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=699

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIIN FYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINPFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+ L LKE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMVLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|EEC84771.1| hypothetical protein OsI_31801 [Oryza sativa Indica Group]
Length=184

 Score =   343 bits (880),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 1/182 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDD  182

Query  620  QL  625
            Q+
Sbjct  183  QV  184



>ref|XP_010913223.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=700

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDK +++LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKASSTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK+D
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>gb|AFQ94045.1| heat shock protein 90 [Lactuca sativa]
Length=698

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MGDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK +N+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAITAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_004500151.1| PREDICTED: heat shock cognate protein 80-like [Cicer arietinum]
Length=699

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFT+TRDTSGE LGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTITRDTSGEILGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>emb|CDY27839.1| BnaC09g28660D [Brassica napus]
Length=705

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_006659612.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=686

 Score =   360 bits (925),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+VIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK+D
Sbjct  123  GVGFYSAYLVAERVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>dbj|BAO20259.1| heat shock protein [Brassica rapa subsp. chinensis]
Length=699

 Score =   360 bits (925),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK +N+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKADNTLTISDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+ L LKE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMVLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_002462554.1| hypothetical protein SORBIDRAFT_02g028020 [Sorghum bicolor]
 gb|EER99075.1| hypothetical protein SORBIDRAFT_02g028020 [Sorghum bicolor]
Length=699

 Score =   360 bits (925),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 175/188 (93%), Positives = 183/188 (97%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  265
            D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  4    DTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  266  LFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  442
            LFIH+VPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHLVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  443  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKEDQ  622
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK+DQ
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLFLKDDQ  183

Query  623  LEYLEERR  646
            LEYLEERR
Sbjct  184  LEYLEERR  191



>ref|XP_006372391.1| hypothetical protein POPTR_0017s01160g [Populus trichocarpa]
 gb|ERP50188.1| hypothetical protein POPTR_0017s01160g [Populus trichocarpa]
Length=703

 Score =   361 bits (926),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDKTNN+LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITL+LKE
Sbjct  126  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLYLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_003617873.1| Heat shock protein [Medicago truncatula]
 ref|XP_003617876.1| Heat shock protein [Medicago truncatula]
 gb|AET00832.1| heat shock protein 81-2 [Medicago truncatula]
 gb|AET00835.1| heat shock protein 81-2 [Medicago truncatula]
Length=699

 Score =   360 bits (925),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKLD+Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDSQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEALGRGTKITLILKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_004240717.1| PREDICTED: heat shock protein 83-like [Solanum lycopersicum]
Length=704

 Score =   361 bits (926),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_007142446.1| hypothetical protein PHAVU_008G281300g [Phaseolus vulgaris]
 gb|ESW14440.1| hypothetical protein PHAVU_008G281300g [Phaseolus vulgaris]
Length=699

 Score =   360 bits (925),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MSETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRDT GE+LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTDGESLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>emb|CDP05141.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   360 bits (925),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDTSGE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTSGEQLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_010483069.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 90-3-like 
[Camelina sativa]
Length=699

 Score =   360 bits (925),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTF SNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFXSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVT+DTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTKDTSGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>gb|KFK26865.1| hypothetical protein AALP_AA8G303900 [Arabis alpina]
Length=705

 Score =   360 bits (925),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_011046024.1| PREDICTED: heat shock protein 83 [Populus euphratica]
Length=703

 Score =   360 bits (924),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDKTNN+LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITL+LKE
Sbjct  126  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLYLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_002305263.1| hypothetical protein POPTR_0004s07190g [Populus trichocarpa]
 gb|EEE85774.1| hypothetical protein POPTR_0004s07190g [Populus trichocarpa]
Length=703

 Score =   360 bits (924),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDKTNN+LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEER+
Sbjct  186  DQLEYLEERK  195



>gb|KFK25886.1| hypothetical protein AALP_AA8G175000 [Arabis alpina]
Length=700

 Score =   360 bits (924),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+V TKHNDDEQYVWESQAGGSFTVT DTSGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAEKVVVITKHNDDEQYVWESQAGGSFTVTLDTSGEKLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_008376647.1| PREDICTED: heat shock protein 83 isoform X1 [Malus domestica]
 ref|XP_008376648.1| PREDICTED: heat shock protein 83 isoform X2 [Malus domestica]
Length=703

 Score =   360 bits (924),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSF VTRD SGE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFIVTRDVSGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>dbj|BAD04054.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|EAZ09522.1| hypothetical protein OsI_31797 [Oryza sativa Indica Group]
Length=699

 Score =   360 bits (923),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_010545291.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLI NTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLITNTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+ L LKE
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMILHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_009375529.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
Length=703

 Score =   360 bits (924),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MHDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEPLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_010438732.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
Length=706

 Score =   360 bits (924),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 183/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            +D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QP
Sbjct  3    SDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVA+KV+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKED
Sbjct  123  GVGFYSAYLVADKVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|NP_001063503.1| Os09g0482400 [Oryza sativa Japonica Group]
 ref|NP_001175894.1| Os09g0482610 [Oryza sativa Japonica Group]
 sp|Q07078.2|HSP83_ORYSJ RecName: Full=Heat shock protein 81-3; Short=HSP81-3; AltName: 
Full=Gravity-specific protein GSC 381 [Oryza sativa Japonica 
Group]
 dbj|BAD33409.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25417.1| Os09g0482400 [Oryza sativa Japonica Group]
 gb|ACJ54894.1| heat shock protein [Oryza sativa Japonica Group]
 dbj|BAG88166.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01431.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94622.1| Os09g0482610 [Oryza sativa Japonica Group]
Length=699

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|NP_001063500.1| Os09g0482100 [Oryza sativa Japonica Group]
 sp|Q69QQ6.1|HSP82_ORYSJ RecName: Full=Heat shock protein 81-2; Short=HSP81-2; AltName: 
Full=Heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD33406.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25414.1| Os09g0482100 [Oryza sativa Japonica Group]
Length=699

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_009367265.1| PREDICTED: heat shock protein 90-2 [Pyrus x bretschneideri]
Length=699

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK +N+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_008380194.1| PREDICTED: heat shock protein 83-like [Malus domestica]
Length=703

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MHDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEPLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>sp|P51819.1|HSP83_IPONI RecName: Full=Heat shock protein 83 [Ipomoea nil]
 gb|AAA33748.1| heat shock protein 83 [Ipomoea nil]
 prf||1909372A heat shock protein 83
Length=703

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDKTN +LSI DSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_009607669.1| PREDICTED: heat shock protein 82 [Nicotiana tomentosiformis]
Length=703

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLE+LEERR
Sbjct  186  DQLEFLEERR  195



>ref|XP_009362097.1| PREDICTED: heat shock protein 90-2 [Pyrus x bretschneideri]
Length=699

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK +N+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL+LKE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010261331.1| PREDICTED: heat shock protein 83 [Nelumbo nucifera]
Length=703

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_008218765.1| PREDICTED: heat shock protein 90-2 [Prunus mume]
Length=699

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDNSGEVLGRGTKITLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010433476.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448245.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448246.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448248.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010491086.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
Length=701

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 183/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            +D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QP
Sbjct  3    SDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHI+PDKTNN+L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVA+KV+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LKED
Sbjct  123  GVGFYSAYLVADKVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLKED  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>gb|KJB52728.1| hypothetical protein B456_008G274600 [Gossypium raimondii]
Length=703

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_002864186.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40445.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
Length=705

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>dbj|BAJ34368.1| unnamed protein product [Thellungiella halophila]
Length=705

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>gb|AAQ08597.1| heat shock protein [Hevea brasiliensis]
Length=698

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +G+ LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGDQLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_006280097.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
 gb|EOA12995.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
Length=705

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_010035175.1| PREDICTED: heat shock protein 83 [Eucalyptus grandis]
 gb|KCW46468.1| hypothetical protein EUGRSUZ_K00295 [Eucalyptus grandis]
Length=700

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPD+ N +L+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDRANKTLAIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010442803.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=705

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>gb|AGC60019.1| heat shock protein 90 [Saccharum hybrid cultivar SP80-3280]
Length=698

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK NN+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKVTLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_010482633.1| PREDICTED: heat shock protein 90-1 [Camelina sativa]
Length=705

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRMVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_009132342.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=698

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTF+SNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFHSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+ L +KE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMVLHIKE  180

Query  617  DQLEYLEERR  646
            DQLEY+EERR
Sbjct  181  DQLEYIEERR  190



>ref|XP_006659552.1| PREDICTED: heat shock protein 81-1-like isoform X2 [Oryza brachyantha]
Length=699

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/189 (92%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>dbj|BAA00615.1| 81kDa heat-shock protein [Arabidopsis thaliana]
Length=700

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK+N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK+
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKD  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>sp|P27323.3|HS901_ARATH RecName: Full=Heat shock protein 90-1; Short=AtHSP90.1; AltName: 
Full=Heat shock protein 81-1; Short=HSP81-1; AltName: Full=Heat 
shock protein 83 [Arabidopsis thaliana]
Length=700

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK+N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK+
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKD  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>sp|A2YWQ1.1|HSP81_ORYSI RecName: Full=Heat shock protein 81-1; Short=HSP81-1; AltName: 
Full=Heat shock protein 82 [Oryza sativa Indica Group]
 sp|Q0J4P2.2|HSP81_ORYSJ RecName: Full=Heat shock protein 81-1; Short=HSP81-1; AltName: 
Full=Heat shock protein 82 [Oryza sativa Japonica Group]
 emb|CAA77978.1| heat shock protein 82 (HSP82) [Oryza sativa]
 dbj|BAD08818.1| heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAD08897.1| heat shock protein 82 [Oryza sativa Japonica Group]
 gb|EAZ07512.1| hypothetical protein OsI_29768 [Oryza sativa Indica Group]
 gb|ADM86854.1| 82kDa heat shock protein [Oryza sativa Japonica Group]
Length=699

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/189 (92%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|NP_200076.1| heat shock protein 90.1 [Arabidopsis thaliana]
 dbj|BAA98082.1| heat-shock protein [Arabidopsis thaliana]
 gb|AAM91104.1| AT5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AAN46890.1| At5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AED96244.1| heat shock protein 90.1 [Arabidopsis thaliana]
Length=705

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK+N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>prf||1908431A heat shock protein HSP81-1
Length=705

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK+N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_002278894.1| PREDICTED: heat shock protein 83 [Vitis vinifera]
Length=703

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 183/191 (96%), Gaps = 1/191 (1%)
 Frame = +2

Query  77   AMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  256
            AM +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDA
Sbjct  5    AMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDA  64

Query  257  QPELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIG  433
            QPELFI +VPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIG
Sbjct  65   QPELFIRLVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIG  124

Query  434  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  613
            QFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFT+TRD +GE LGRGTKITLFLK
Sbjct  125  QFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVNGEQLGRGTKITLFLK  184

Query  614  EDQLEYLEERR  646
            EDQ+EYLEERR
Sbjct  185  EDQMEYLEERR  195



>ref|XP_009377558.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
 ref|XP_009377599.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
Length=703

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M DAETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MHDAETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEPLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_002444804.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
 gb|EES14299.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
Length=698

 Score =   358 bits (920),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK NN+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMTLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_009802902.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 83-like [Nicotiana 
sylvestris]
Length=703

 Score =   359 bits (921),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITL LKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLLLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>gb|EEC83017.1| hypothetical protein OsI_28083 [Oryza sativa Indica Group]
Length=184

 Score =   341 bits (875),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 176/182 (97%), Gaps = 1/182 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLII TFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIIKTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDD  182

Query  620  QL  625
            Q+
Sbjct  183  QV  184



>ref|XP_006439485.1| hypothetical protein CICLE_v10019095mg [Citrus clementina]
 gb|ESR52725.1| hypothetical protein CICLE_v10019095mg [Citrus clementina]
Length=702

 Score =   358 bits (920),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 180/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKANKALSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQ EYLEERR
Sbjct  186  DQCEYLEERR  195



>ref|XP_003592196.1| Heat shock protein [Medicago truncatula]
 gb|AES62447.1| heat shock protein 81-2 [Medicago truncatula]
Length=689

 Score =   358 bits (919),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MCDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>gb|AIZ68157.1| heat shock protein 83 [Ornithogalum saundersiae]
Length=701

 Score =   358 bits (920),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 184/190 (97%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDKTN +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTK+NDDEQY+WESQAGGSFTVTRDTSGE LGRGTKITL+LKE
Sbjct  126  FGVGFYSAYLVAEKVVVTTKNNDDEQYIWESQAGGSFTVTRDTSGEQLGRGTKITLYLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_010941080.1| PREDICTED: heat shock protein 83 [Elaeis guineensis]
Length=702

 Score =   358 bits (920),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITL+LKE
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLYLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_004308051.1| PREDICTED: heat shock protein 83 [Fragaria vesca subsp. vesca]
Length=703

 Score =   358 bits (919),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 184/191 (96%), Gaps = 2/191 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAG-ADVSMIG  433
            PELFI +VPDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL +G +DVSMIG
Sbjct  66   PELFIRLVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALASGVSDVSMIG  125

Query  434  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  613
            QFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  QFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  185

Query  614  EDQLEYLEERR  646
            EDQLEYLEERR
Sbjct  186  EDQLEYLEERR  196



>ref|NP_001170475.1| LOC100384473 [Zea mays]
 gb|ACO35045.1| heat shock protein 90 [Zea mays]
Length=697

 Score =   358 bits (919),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK NN+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMTLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_006413591.1| hypothetical protein EUTSA_v10024561mg [Eutrema salsugineum]
 gb|ESQ55044.1| hypothetical protein EUTSA_v10024561mg [Eutrema salsugineum]
Length=700

 Score =   358 bits (919),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK+NN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKSNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL LKE
Sbjct  121  FGVGFYSAYLVAERVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_008801780.1| PREDICTED: heat shock protein 83 [Phoenix dactylifera]
Length=703

 Score =   358 bits (919),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITL+LKE
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLYLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_007208337.1| hypothetical protein PRUPE_ppa002220mg [Prunus persica]
 gb|EMJ09536.1| hypothetical protein PRUPE_ppa002220mg [Prunus persica]
Length=699

 Score =   358 bits (919),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            P+LFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PDLFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDNSGEVLGRGTKITLHLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_001779443.1| predicted protein [Physcomitrella patens]
 gb|EDQ55721.1| predicted protein [Physcomitrella patens]
Length=697

 Score =   358 bits (919),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 183/191 (96%), Gaps = 1/191 (1%)
 Frame = +2

Query  77   AMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  256
            A A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL A
Sbjct  2    AAAEVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLGA  61

Query  257  QPELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIG  433
            QPELFIHIVPDK NN+LSI DSG+GMTKAD+VNNLGTIARSGTKEFMEAL+AGADVSMIG
Sbjct  62   QPELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALSAGADVSMIG  121

Query  434  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  613
            QFGVGFYSAYLVAEKV+VT+KHNDDEQY+WESQAGGSFT+TRDTSGE LGRGT I LFLK
Sbjct  122  QFGVGFYSAYLVAEKVVVTSKHNDDEQYMWESQAGGSFTITRDTSGEQLGRGTHIKLFLK  181

Query  614  EDQLEYLEERR  646
            EDQLEYLEERR
Sbjct  182  EDQLEYLEERR  192



>ref|XP_010063241.1| PREDICTED: heat shock cognate protein 80-like [Eucalyptus grandis]
 gb|KCW70449.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=703

 Score =   358 bits (919),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKH DDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHYDDEQYVWESQAGGSFTVTRDTSGEILGRGTKITLLLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_010276895.1| PREDICTED: heat shock protein 83-like [Nelumbo nucifera]
Length=701

 Score =   358 bits (918),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            + DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    IGDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>gb|AGB76029.1| heat shock protein 90 [Salicornia europaea]
Length=696

 Score =   358 bits (918),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 182/190 (96%), Gaps = 2/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDK NNSL+I DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNSLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTKITL LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDT-GEPLGRGTKITLILKE  179

Query  617  DQLEYLEERR  646
            DQ EYLEERR
Sbjct  180  DQQEYLEERR  189



>ref|XP_006659551.1| PREDICTED: heat shock protein 81-1-like isoform X1 [Oryza brachyantha]
Length=699

 Score =   358 bits (918),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMTLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_001777414.1| predicted protein [Physcomitrella patens]
 gb|EDQ57818.1| predicted protein [Physcomitrella patens]
Length=704

 Score =   358 bits (918),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 181/189 (96%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A  ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK+D QP
Sbjct  6    AQVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKMDGQP  65

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK NN+LSI DSG+GMTKAD+VNNLGTIARSGTKEFMEALTAGADVSMIGQF
Sbjct  66   ELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALTAGADVSMIGQF  125

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKV+VT+KHNDDEQY+WESQAGGSFT+TRDTSGE LGRGT I L+LKED
Sbjct  126  GVGFYSAYLVAEKVVVTSKHNDDEQYIWESQAGGSFTITRDTSGEQLGRGTHIKLYLKED  185

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  186  QLEYLEERR  194



>emb|CAA72513.1| heat shock protein [Arabidopsis thaliana]
Length=699

 Score =   358 bits (918),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSN EIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNLEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLV NLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVKNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LKE
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLKE  180

Query  617  DQLEYLEERR  646
            DQ+EY+EERR
Sbjct  181  DQMEYIEERR  190



>ref|XP_007038813.1| Heat shock protein 90.1 isoform 1 [Theobroma cacao]
 gb|EOY23314.1| Heat shock protein 90.1 isoform 1 [Theobroma cacao]
Length=703

 Score =   358 bits (918),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 183/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRD +GE LGRGTK+TL+LKE
Sbjct  126  FGVGFYSAYLVAEKVIVTSKHNDDEQYIWESQAGGSFTVTRDVNGEPLGRGTKMTLYLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>gb|EAZ29453.1| hypothetical protein OsJ_13528 [Oryza sativa Japonica Group]
Length=434

 Score =   349 bits (896),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  9    MAEKETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  68

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VP K + +LSI DSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  69   PELFIRLVPYKPSKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  128

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVT DT+GE LGRGTKITLFLK+
Sbjct  129  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTAGERLGRGTKITLFLKD  188

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  189  DQLEYLEERR  198



>emb|CAN73318.1| hypothetical protein VITISV_007727 [Vitis vinifera]
Length=704

 Score =   358 bits (918),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQ+EYLEERR
Sbjct  186  DQVEYLEERR  195



>ref|XP_002274022.1| PREDICTED: heat shock protein 83-like [Vitis vinifera]
Length=704

 Score =   358 bits (918),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQ+EYLEERR
Sbjct  186  DQVEYLEERR  195



>gb|AAA32822.1| heat shock protein 83 [Arabidopsis thaliana]
Length=705

 Score =   357 bits (917),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKI+LFLK+
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKISLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>prf||1710352A heat shock protein 83
Length=705

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKI+LFLK+
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKISLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>gb|KJB24312.1| hypothetical protein B456_004G138600 [Gossypium raimondii]
Length=543

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 180/189 (95%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            +++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKLDAQP
Sbjct  8    SESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDAQP  67

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFI I+PDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  68   ELFIRIIPDKANKTLSIVDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  127

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGRGTKITLFLKED
Sbjct  128  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDLGGEPLGRGTKITLFLKED  187

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  188  QLEYLEERR  196



>ref|XP_001777383.1| predicted protein [Physcomitrella patens]
 gb|EDQ57787.1| predicted protein [Physcomitrella patens]
Length=707

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 182/191 (95%), Gaps = 1/191 (1%)
 Frame = +2

Query  77   AMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  256
            A  + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK+D 
Sbjct  7    ASPEIETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKMDG  66

Query  257  QPELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIG  433
            QPELFIHIVPDK NN+LSI DSG+GMTKAD+VNNLGTIARSGTKEFMEALTAGADVSMIG
Sbjct  67   QPELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALTAGADVSMIG  126

Query  434  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  613
            QFGVGFYSAYLVAEKV+VT+KHNDDEQY+WESQAGGSFT+TRDTSGE LGRGT I L+LK
Sbjct  127  QFGVGFYSAYLVAEKVVVTSKHNDDEQYIWESQAGGSFTITRDTSGEQLGRGTHIKLYLK  186

Query  614  EDQLEYLEERR  646
            EDQLEYLEERR
Sbjct  187  EDQLEYLEERR  197



>emb|CAA68885.1| heat shock protein 90A [Arabidopsis thaliana]
Length=704

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKPNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKI+LFLK+
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKISLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_008670278.1| PREDICTED: heat shock protein 81-1-like [Zea mays]
 tpg|DAA40366.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=698

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 183/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIH+VPDK  N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHLVPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVA++V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK+D
Sbjct  123  GVGFYSAYLVADRVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLFLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_006476504.1| PREDICTED: heat shock protein 83-like [Citrus sinensis]
Length=701

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFE LTDKSKLDAQ
Sbjct  6    MGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQ EYLEERR
Sbjct  186  DQCEYLEERR  195



>ref|XP_004308050.1| PREDICTED: heat shock protein 83-like [Fragaria vesca subsp. 
vesca]
Length=700

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/192 (93%), Positives = 185/192 (96%), Gaps = 3/192 (2%)
 Frame = +2

Query  80   MADA-ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  256
            MADA ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
Sbjct  1    MADAAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  60

Query  257  QPELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAG-ADVSMI  430
            QPELFI +VPDKTNN+LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL +G +DVSMI
Sbjct  61   QPELFIRLVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALASGVSDVSMI  120

Query  431  GQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFL  610
            GQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFT+TRD SGE LGRGTKITLFL
Sbjct  121  GQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVSGEQLGRGTKITLFL  180

Query  611  KEDQLEYLEERR  646
            KEDQLEYLEERR
Sbjct  181  KEDQLEYLEERR  192



>ref|XP_004973824.1| PREDICTED: heat shock protein 81-1-like [Setaria italica]
Length=698

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>gb|KDO76323.1| hypothetical protein CISIN_1g005321mg [Citrus sinensis]
Length=702

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFE LTDKSKLDAQ
Sbjct  6    MGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLKE
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKE  185

Query  617  DQLEYLEERR  646
            DQ EYLEERR
Sbjct  186  DQCEYLEERR  195



>gb|ADP89125.1| heat shock protein 90 [Cenchrus americanus]
 gb|ADP89126.1| heat shock protein 90 [Cenchrus americanus]
Length=698

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 184/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_007040338.1| Heat shock protein 90.1 [Theobroma cacao]
 gb|EOY24839.1| Heat shock protein 90.1 [Theobroma cacao]
Length=705

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 182/189 (96%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            +++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  8    SESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  67

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFI I+PDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  68   ELFIRIIPDKINKTLSIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  127

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLKED
Sbjct  128  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKED  187

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  188  QLEYLEERR  196



>ref|XP_010445119.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=706

 Score =   356 bits (914),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 181/191 (95%), Gaps = 2/191 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEN-LGRGTKITLFLK  613
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE  LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLLGRGTKITLFLK  185

Query  614  EDQLEYLEERR  646
            EDQLEYLEERR
Sbjct  186  EDQLEYLEERR  196



>ref|NP_001170480.1| HSP protein [Zea mays]
 gb|ACO72989.1| HSP protein [Zea mays]
 gb|AFW65179.1| putative heat shock protein 90 family protein [Zea mays]
Length=699

 Score =   356 bits (913),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 183/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDK+KLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKTKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK NN+L+I DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTV RDTSGE LGRGTK+TL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVARDTSGEQLGRGTKMTLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



>ref|XP_011080917.1| PREDICTED: heat shock protein 83-like [Sesamum indicum]
Length=704

 Score =   356 bits (913),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M ++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL++Q
Sbjct  6    MGESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLESQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK+
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKD  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_004294900.1| PREDICTED: heat shock protein 90-2 [Fragaria vesca subsp. vesca]
Length=697

 Score =   356 bits (913),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 183/190 (96%), Gaps = 2/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKL++Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLESQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFIHI+PDKTNN+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKI L LKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD-SGEPLGRGTKICLHLKE  179

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  180  DQLEYLEERR  189



>ref|XP_008797179.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=701

 Score =   356 bits (913),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M ++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  6    MGESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI IVPDK N +LSI DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYS+YLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITL+LKE
Sbjct  126  FGVGFYSSYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEPLGRGTKITLYLKE  185

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  186  DQLEYLEERR  195



>ref|XP_006422036.1| hypothetical protein CICLE_v10004456mg [Citrus clementina]
 ref|XP_006490631.1| PREDICTED: heat shock protein 83-like [Citrus sinensis]
 gb|ESR35276.1| hypothetical protein CICLE_v10004456mg [Citrus clementina]
Length=699

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI I+PDK N +L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KHG00618.1| Heat shock 90-1 -like protein [Gossypium arboreum]
Length=707

 Score =   356 bits (913),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 182/189 (96%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  9    AESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  68

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFI I+PDK N +LSI DSG+GMTKA+LVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  69   ELFIRIIPDKANKTLSIVDSGIGMTKAELVNNLGTIARSGTKEFMEALQAGADVSMIGQF  128

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK+D
Sbjct  129  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKDD  188

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  189  QLEYLEERR  197



>gb|EYU25148.1| hypothetical protein MIMGU_mgv1a002213mg [Erythranthe guttata]
Length=700

 Score =   355 bits (912),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 180/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKLD+Q
Sbjct  1    MADGETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDSQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFT+TRD  GE LGRGTKITLFLKE
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVDGEQLGRGTKITLFLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>gb|KJB20596.1| hypothetical protein B456_003G155600 [Gossypium raimondii]
Length=707

 Score =   355 bits (912),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 182/189 (96%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            A++ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  9    AESETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQP  68

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFI I+PDK N +LSI DSGVGMTKA+LVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  69   ELFIRIIPDKANKTLSIVDSGVGMTKAELVNNLGTIARSGTKEFMEALQAGADVSMIGQF  128

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK+D
Sbjct  129  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKDD  188

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  189  QLEYLEERR  197



>ref|XP_001780981.1| predicted protein [Physcomitrella patens]
 gb|EDQ54241.1| predicted protein [Physcomitrella patens]
Length=704

 Score =   355 bits (912),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 181/189 (96%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
             + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QP
Sbjct  9    PEVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQP  68

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK NN+LSI DSG+GMTKAD+VNNLGTIARSGTKEFMEAL+AGADVSMIGQF
Sbjct  69   ELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALSAGADVSMIGQF  128

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAEKV+VT+KHNDDEQY+WESQAGGSFT+TRDTSGE LGRGT I L+LKED
Sbjct  129  GVGFYSAYLVAEKVVVTSKHNDDEQYIWESQAGGSFTITRDTSGEPLGRGTHIKLYLKED  188

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  189  QLEYLEERR  197



>gb|KDO56796.1| hypothetical protein CISIN_1g005370mg [Citrus sinensis]
Length=699

 Score =   355 bits (912),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI I+PDK N +L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTK+TL+LKE
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKE  180

Query  617  DQLEYLEERR  646
            DQLEYLEERR
Sbjct  181  DQLEYLEERR  190



>ref|XP_006659553.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=699

 Score =   355 bits (911),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 183/189 (97%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK +N+LSI DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDD  182

Query  620  QLEYLEERR  646
            QLE LEERR
Sbjct  183  QLESLEERR  191



>ref|XP_010934626.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
 ref|XP_010934627.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=702

 Score =   355 bits (911),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  259
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+E LTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYEGLTDKSKLDAQ  65

Query  260  PELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  436
            PELFI +VPDK N +LSI DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  437  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKE  616
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITL+LKE
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLYLKE  185

Query  617  DQLEYLEERR  646
            DQL+YLEERR
Sbjct  186  DQLDYLEERR  195



>gb|ACN36206.1| unknown [Zea mays]
Length=699

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 182/189 (96%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  262
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDK+KLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKTKLDAQP  62

Query  263  ELFIHIVPDKTNNSLSI-DSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  439
            ELFIHIVPDK NN+L+I DSG+GMTK+DLVNNLGTIAR GTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARPGTKEFMEALAAGADVSMIGQF  122

Query  440  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKED  619
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTV RDTSGE LGRGTK+TL+LK+D
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVARDTSGEQLGRGTKMTLYLKDD  182

Query  620  QLEYLEERR  646
            QLEYLEERR
Sbjct  183  QLEYLEERR  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000