BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF024A02

Length=606
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241792.1|  PREDICTED: trafficking protein particle comp...    285   1e-85   Solanum lycopersicum
ref|XP_009778819.1|  PREDICTED: trafficking protein particle comp...    284   3e-85   Nicotiana sylvestris
ref|XP_009618489.1|  PREDICTED: trafficking protein particle comp...    284   3e-85   Nicotiana tomentosiformis
ref|XP_009618488.1|  PREDICTED: trafficking protein particle comp...    283   3e-85   Nicotiana tomentosiformis
ref|XP_009778818.1|  PREDICTED: trafficking protein particle comp...    283   4e-85   Nicotiana sylvestris
ref|XP_006353665.1|  PREDICTED: trafficking protein particle comp...    283   5e-85   Solanum tuberosum [potatoes]
gb|EYU32374.1|  hypothetical protein MIMGU_mgv1a000384mg                266   5e-79   Erythranthe guttata [common monkey flower]
gb|EYU32375.1|  hypothetical protein MIMGU_mgv1a000384mg                266   5e-79   Erythranthe guttata [common monkey flower]
ref|XP_009362334.1|  PREDICTED: uncharacterized protein LOC103952...    244   4e-78   Pyrus x bretschneideri [bai li]
ref|XP_011074995.1|  PREDICTED: trafficking protein particle comp...    263   7e-78   Sesamum indicum [beniseed]
ref|XP_007011772.1|  TRS120 isoform 1                                   262   2e-77   
ref|XP_009362333.1|  PREDICTED: trafficking protein particle comp...    244   4e-77   Pyrus x bretschneideri [bai li]
ref|XP_009122000.1|  PREDICTED: trafficking protein particle comp...    260   6e-77   Brassica rapa
emb|CDX97076.1|  BnaC09g45490D                                          260   8e-77   
emb|CDX69788.1|  BnaA10g21370D                                          260   8e-77   
gb|KFK37733.1|  hypothetical protein AALP_AA3G022200                    258   3e-76   Arabis alpina [alpine rockcress]
ref|XP_006286928.1|  hypothetical protein CARUB_v10000071mg             258   4e-76   Capsella rubella
ref|XP_010453144.1|  PREDICTED: trafficking protein particle comp...    258   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010491799.1|  PREDICTED: trafficking protein particle comp...    258   7e-76   
ref|XP_010491797.1|  PREDICTED: trafficking protein particle comp...    257   7e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010419658.1|  PREDICTED: trafficking protein particle comp...    257   9e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006399603.1|  hypothetical protein EUTSA_v10012483mg             257   1e-75   Eutrema salsugineum [saltwater cress]
ref|NP_196665.1|  protein TRS120                                        256   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519641.1|  PREDICTED: trafficking protein particle comp...    256   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_010048925.1|  PREDICTED: trafficking protein particle comp...    254   1e-74   Eucalyptus grandis [rose gum]
ref|XP_010048924.1|  PREDICTED: trafficking protein particle comp...    254   1e-74   Eucalyptus grandis [rose gum]
ref|XP_010265703.1|  PREDICTED: trafficking protein particle comp...    254   1e-74   Nelumbo nucifera [Indian lotus]
ref|XP_002871450.1|  hypothetical protein ARALYDRAFT_487936             254   2e-74   
gb|KDO46778.1|  hypothetical protein CISIN_1g045708mg                   253   2e-74   Citrus sinensis [apfelsine]
ref|XP_006483432.1|  PREDICTED: uncharacterized protein LOC102615624    253   2e-74   Citrus sinensis [apfelsine]
ref|XP_006450337.1|  hypothetical protein CICLE_v10007276mg             253   2e-74   
ref|XP_004145518.1|  PREDICTED: uncharacterized protein LOC101217047    253   3e-74   Cucumis sativus [cucumbers]
ref|XP_008452884.1|  PREDICTED: transport protein particle subuni...    251   1e-73   Cucumis melo [Oriental melon]
emb|CBI21099.3|  unnamed protein product                                250   2e-73   Vitis vinifera
ref|XP_010648709.1|  PREDICTED: trafficking protein particle comp...    251   2e-73   Vitis vinifera
ref|XP_010648710.1|  PREDICTED: trafficking protein particle comp...    251   2e-73   Vitis vinifera
ref|XP_009355810.1|  PREDICTED: trafficking protein particle comp...    250   3e-73   Pyrus x bretschneideri [bai li]
ref|XP_008219550.1|  PREDICTED: trafficking protein particle comp...    249   5e-73   Prunus mume [ume]
ref|XP_008219549.1|  PREDICTED: trafficking protein particle comp...    249   5e-73   Prunus mume [ume]
emb|CAN82119.1|  hypothetical protein VITISV_024254                     231   6e-73   Vitis vinifera
gb|KDP33546.1|  hypothetical protein JCGZ_07117                         249   6e-73   Jatropha curcas
ref|XP_008394132.1|  PREDICTED: trafficking protein particle comp...    249   1e-72   
ref|XP_010244785.1|  PREDICTED: trafficking protein particle comp...    249   1e-72   Nelumbo nucifera [Indian lotus]
emb|CAN76628.1|  hypothetical protein VITISV_003544                     228   1e-72   Vitis vinifera
ref|XP_010244786.1|  PREDICTED: trafficking protein particle comp...    248   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_009342628.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...    245   2e-72   
ref|XP_011458836.1|  PREDICTED: trafficking protein particle comp...    246   9e-72   Fragaria vesca subsp. vesca
ref|XP_004290928.1|  PREDICTED: trafficking protein particle comp...    246   1e-71   Fragaria vesca subsp. vesca
ref|XP_007225443.1|  hypothetical protein PRUPE_ppa000412mg             246   1e-71   Prunus persica
gb|KHG29759.1|  Trafficking particle complex subunit 9                  246   2e-71   Gossypium arboreum [tree cotton]
emb|CDP18799.1|  unnamed protein product                                244   5e-71   Coffea canephora [robusta coffee]
ref|XP_010105451.1|  hypothetical protein L484_003461                   242   3e-70   Morus notabilis
gb|KJB07659.1|  hypothetical protein B456_001G035900                    241   5e-70   Gossypium raimondii
ref|XP_002515463.1|  conserved hypothetical protein                     234   3e-67   
ref|XP_002309653.2|  hypothetical protein POPTR_0006s27580g             233   5e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010942155.1|  PREDICTED: trafficking protein particle comp...    233   9e-67   
ref|XP_011036637.1|  PREDICTED: trafficking protein particle comp...    231   2e-66   Populus euphratica
ref|XP_011036636.1|  PREDICTED: trafficking protein particle comp...    231   2e-66   Populus euphratica
ref|XP_008784808.1|  PREDICTED: trafficking protein particle comp...    229   2e-65   Phoenix dactylifera
ref|XP_011039615.1|  PREDICTED: trafficking protein particle comp...    228   2e-65   Populus euphratica
ref|XP_010665754.1|  PREDICTED: trafficking protein particle comp...    228   3e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007161157.1|  hypothetical protein PHAVU_001G047300g             228   5e-65   Phaseolus vulgaris [French bean]
ref|XP_006848818.1|  hypothetical protein AMTR_s00026p00150010          228   5e-65   
ref|XP_004498769.1|  PREDICTED: trafficking protein particle comp...    223   2e-63   Cicer arietinum [garbanzo]
gb|KEH39853.1|  transporter TRS120                                      223   2e-63   Medicago truncatula
ref|XP_003550201.1|  PREDICTED: trafficking protein particle comp...    223   2e-63   Glycine max [soybeans]
ref|XP_006595493.1|  PREDICTED: uncharacterized protein LOC100305...    220   2e-62   Glycine max [soybeans]
ref|XP_009381560.1|  PREDICTED: trafficking protein particle comp...    216   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008347735.1|  PREDICTED: uncharacterized protein LOC103410865    192   5e-58   
ref|XP_001777714.1|  predicted protein                                  189   2e-51   
ref|XP_004976134.1|  PREDICTED: trafficking protein particle comp...    189   3e-51   
ref|XP_004976133.1|  PREDICTED: trafficking protein particle comp...    186   3e-50   Setaria italica
ref|XP_008669201.1|  PREDICTED: trafficking protein particle comp...    184   9e-50   Zea mays [maize]
tpg|DAA37075.1|  TPA: hypothetical protein ZEAMMB73_993824              184   1e-49   
ref|XP_001774293.1|  predicted protein                                  183   2e-49   
ref|XP_002446750.1|  hypothetical protein SORBIDRAFT_06g021740          182   6e-49   
ref|XP_010227185.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...    182   8e-49   
emb|CAE01639.1|  OSJNBa0029H02.30                                       179   8e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053234.1|  Os04g0502200                                       178   1e-47   
gb|EEC77580.1|  hypothetical protein OsI_16530                          178   1e-47   Oryza sativa Indica Group [Indian rice]
gb|EPS63566.1|  hypothetical protein M569_11217                         177   3e-47   Genlisea aurea
gb|EMT13211.1|  hypothetical protein F775_03305                         174   4e-46   
emb|CAH67557.1|  H0311C03.11                                            166   3e-43   Oryza sativa [red rice]
ref|XP_002965121.1|  hypothetical protein SELMODRAFT_83253              161   1e-41   
ref|XP_002962206.1|  hypothetical protein SELMODRAFT_77626              158   1e-40   
ref|XP_002963095.1|  hypothetical protein SELMODRAFT_165701             154   2e-39   
ref|XP_002980237.1|  hypothetical protein SELMODRAFT_444472             148   5e-37   
ref|XP_008664222.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...    147   8e-37   
ref|XP_002324891.2|  hypothetical protein POPTR_0018s02220g             142   4e-35   
ref|XP_008377455.1|  PREDICTED: cytochrome P450 82A3-like               133   9e-35   
ref|XP_005844832.1|  hypothetical protein CHLNCDRAFT_138272             128   4e-30   Chlorella variabilis
gb|AFW58777.1|  hypothetical protein ZEAMMB73_746167                    115   3e-29   
gb|KDD72036.1|  hypothetical protein H632_c3968p0                       101   2e-22   Helicosporidium sp. ATCC 50920
ref|XP_011399423.1|  Trafficking protein particle complex subunit 9     103   7e-22   Auxenochlorella protothecoides
ref|XP_006653574.1|  PREDICTED: trafficking protein particle comp...  96.7    3e-19   
ref|XP_643937.1|  hypothetical protein DDB_G0274803                   83.6    9e-15   Dictyostelium discoideum AX4
ref|XP_003290001.1|  hypothetical protein DICPUDRAFT_154468           80.9    5e-14   Dictyostelium purpureum
emb|CEP15600.1|  hypothetical protein                                 78.2    5e-13   Parasitella parasitica
gb|EPB91027.1|  hypothetical protein HMPREF1544_02096                 77.4    8e-13   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN03919.1|  hypercellular protein                                77.4    9e-13   Mucor ambiguus
gb|KFH70946.1|  hypothetical protein MVEG_03792                       75.5    4e-12   Mortierella verticillata NRRL 6337
dbj|GAM26879.1|  hypothetical protein SAMD00019534_100540             74.3    7e-12   Acytostelium subglobosum LB1
ref|XP_002682761.1|  hypothetical protein NAEGRDRAFT_77990            73.2    2e-11   Naegleria gruberi strain NEG-M
gb|ESA21684.1|  hypothetical protein GLOINDRAFT_119508                71.6    5e-11   
gb|EEE61278.1|  hypothetical protein OsJ_15360                        71.6    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005819358.1|  trafficking protein particle complex 9           70.1    2e-10   Guillardia theta CCMP2712
ref|XP_008618120.1|  hypothetical protein SDRG_13800                  70.1    2e-10   Saprolegnia diclina VS20
gb|EIE80684.1|  hypothetical protein RO3G_05389                       69.3    4e-10   Rhizopus delemar RA 99-880
gb|KDO21720.1|  hypothetical protein SPRG_13136                       68.6    5e-10   Saprolegnia parasitica CBS 223.65
ref|XP_002954311.1|  hypothetical protein VOLCADRAFT_106329           64.7    1e-09   Volvox carteri f. nagariensis
gb|ETL35876.1|  hypothetical protein L916_12075                       67.8    1e-09   Phytophthora parasitica
gb|ETO71095.1|  hypothetical protein F444_12526                       67.8    1e-09   Phytophthora parasitica P1976
gb|ETK82491.1|  hypothetical protein L915_12150                       67.8    1e-09   Phytophthora parasitica
gb|ETL89091.1|  hypothetical protein L917_11910                       67.4    1e-09   Phytophthora parasitica
gb|ETI42476.1|  hypothetical protein F443_12424                       67.4    1e-09   Phytophthora parasitica P1569
ref|XP_008908759.1|  hypothetical protein PPTG_14018                  67.4    1e-09   Phytophthora parasitica INRA-310
gb|ETP40315.1|  hypothetical protein F442_12346                       67.4    1e-09   Phytophthora parasitica P10297
ref|XP_009530723.1|  hypothetical protein PHYSODRAFT_513497           67.4    1e-09   Phytophthora sojae
ref|XP_004361713.1|  histidine kinase                                 67.0    1e-09   Cavenderia fasciculata
ref|XP_008876428.1|  hypothetical protein H310_11503                  66.6    2e-09   Aphanomyces invadans
emb|CBN75733.1|  OSJNBa0029H02.30                                     65.1    4e-09   Ectocarpus siliculosus
emb|CEG76765.1|  hypothetical protein RMATCC62417_11620               65.5    4e-09   Rhizopus microsporus
emb|CDS05824.1|  hypothetical protein LRAMOSA08352                    65.1    7e-09   Lichtheimia ramosa
gb|EFA80348.1|  histidine kinase DhkG                                 64.7    1e-08   Heterostelium album PN500
emb|CEG81602.1|  hypothetical protein RMATCC62417_15784               63.9    2e-08   Rhizopus microsporus
emb|CEI86846.1|  hypothetical protein RMCBS344292_01273               63.5    2e-08   Rhizopus microsporus
ref|XP_006682591.1|  hypothetical protein BATDEDRAFT_28213            63.5    2e-08   Batrachochytrium dendrobatidis JAM81
emb|CEJ01961.1|  hypothetical protein RMCBS344292_15981               63.2    2e-08   Rhizopus microsporus
dbj|GAN09915.1|  hypercellular protein                                63.5    2e-08   Mucor ambiguus
gb|EPB81036.1|  hypothetical protein HMPREF1544_12262                 63.2    3e-08   Mucor circinelloides f. circinelloides 1006PhL
emb|CEG65590.1|  hypothetical protein RMATCC62417_02344               62.8    4e-08   Rhizopus microsporus
emb|CEI98563.1|  hypothetical protein RMCBS344292_12669               62.4    5e-08   Rhizopus microsporus
ref|XP_002896003.1|  conserved hypothetical protein                   62.4    5e-08   Phytophthora infestans T30-4
emb|CEP12553.1|  hypothetical protein                                 62.4    6e-08   Parasitella parasitica
emb|CDP20750.1|  unnamed protein product                              53.5    3e-06   Coffea canephora [robusta coffee]
ref|XP_004345847.1|  hypothetical protein ACA1_182040                 56.2    4e-06   Acanthamoeba castellanii str. Neff
ref|XP_009845683.1|  hypothetical protein H257_18343                  55.1    1e-05   Aphanomyces astaci
gb|EWM27764.1|  TRAPP II complex, Trs120 protein                      52.8    2e-05   Nannochloropsis gaditana
gb|EPZ33229.1|  TRAPP II complex, Trs120 domain-containing protein    54.7    2e-05   Rozella allomycis CSF55
ref|XP_007321257.1|  hypothetical protein SERLADRAFT_451500           52.0    1e-04   Serpula lacrymans var. lacrymans S7.9
ref|NP_001169811.1|  uncharacterized protein LOC100383703             48.9    1e-04   



>ref|XP_004241792.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Solanum lycopersicum]
Length=1185

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TV LSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSIAIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFK+M GGSPASPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKYMVGGSPASPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SSS+VQRCFAFCPGDSQLED+++KGSN++LFP
Sbjct  121  SSSVVQRCFAFCPGDSQLEDESFKGSNLILFP  152



>ref|XP_009778819.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Nicotiana sylvestris]
Length=1185

 Score =   284 bits (726),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TV LSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSITIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKFM GGSP SPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKFMVGGSPPSPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SSS+VQRCFAFCPGDSQLED+++KGSN++LFP
Sbjct  121  SSSVVQRCFAFCPGDSQLEDESFKGSNLILFP  152



>ref|XP_009618489.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Nicotiana tomentosiformis]
Length=1185

 Score =   284 bits (726),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TV LSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSITIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKFM GGSP SPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKFMVGGSPPSPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SSS+VQRCFAFCPGDSQLED+++KGSN++LFP
Sbjct  121  SSSVVQRCFAFCPGDSQLEDESFKGSNLILFP  152



>ref|XP_009618488.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Nicotiana tomentosiformis]
Length=1188

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TV LSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSITIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKFM GGSP SPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKFMVGGSPPSPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SSS+VQRCFAFCPGDSQLED+++KGSN++LFP
Sbjct  121  SSSVVQRCFAFCPGDSQLEDESFKGSNLILFP  152



>ref|XP_009778818.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Nicotiana sylvestris]
Length=1188

 Score =   283 bits (725),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TV LSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSITIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKFM GGSP SPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKFMVGGSPPSPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SSS+VQRCFAFCPGDSQLED+++KGSN++LFP
Sbjct  121  SSSVVQRCFAFCPGDSQLEDESFKGSNLILFP  152



>ref|XP_006353665.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Solanum tuberosum]
Length=1185

 Score =   283 bits (724),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TV LSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSIAIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFK+M GGSPASPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKYMVGGSPASPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SSS+V+RCFAFCPGDSQLED+++KGSN++LFP
Sbjct  121  SSSVVRRCFAFCPGDSQLEDESFKGSNLILFP  152



>gb|EYU32374.1| hypothetical protein MIMGU_mgv1a000384mg [Erythranthe guttata]
Length=1197

 Score =   266 bits (681),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPD SIETS MIRVAVLPI SIP  LFRDY +ML+RHHTV L+SISSFYTEHQKSPFS+
Sbjct  1    MEPDASIETSGMIRVAVLPIASIPPLLFRDYAAMLLRHHTVSLNSISSFYTEHQKSPFSN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPW+SG+LRFKF+ GGSP SPWEDFQSNRK+LAV+GI HCPSSPDL SVA QF  +CKGY
Sbjct  61   QPWESGTLRFKFILGGSPPSPWEDFQSNRKVLAVIGISHCPSSPDLVSVANQFTAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SSSLVQRCFAFCPGDSQLED++ KGSNI+LFP
Sbjct  121  SSSLVQRCFAFCPGDSQLEDESVKGSNIILFP  152



>gb|EYU32375.1| hypothetical protein MIMGU_mgv1a000384mg [Erythranthe guttata]
Length=1153

 Score =   266 bits (680),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPD SIETS MIRVAVLPI SIP  LFRDY +ML+RHHTV L+SISSFYTEHQKSPFS+
Sbjct  1    MEPDASIETSGMIRVAVLPIASIPPLLFRDYAAMLLRHHTVSLNSISSFYTEHQKSPFSN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPW+SG+LRFKF+ GGSP SPWEDFQSNRK+LAV+GI HCPSSPDL SVA QF  +CKGY
Sbjct  61   QPWESGTLRFKFILGGSPPSPWEDFQSNRKVLAVIGISHCPSSPDLVSVANQFTAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SSSLVQRCFAFCPGDSQLED++ KGSNI+LFP
Sbjct  121  SSSLVQRCFAFCPGDSQLEDESVKGSNIILFP  152



>ref|XP_009362334.1| PREDICTED: uncharacterized protein LOC103952472 isoform X2 [Pyrus 
x bretschneideri]
Length=209

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIG +   L RDY SML+RHHT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSAMIRVAVLPIGHVAPVLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ +   Y
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARLAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV RCFAFCP DSQLED + KG N++LFP
Sbjct  121  SSALVDRCFAFCPADSQLEDGSKKGGNLMLFP  152



>ref|XP_011074995.1| PREDICTED: trafficking protein particle complex subunit 9 [Sesamum 
indicum]
Length=1196

 Score =   263 bits (672),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPD SIETS MIRVAVLPI  IP  LFRDY +ML+RHHTV L+SISSFYTEHQKSPF++
Sbjct  1    MEPDASIETSSMIRVAVLPIAGIPPLLFRDYAAMLLRHHTVSLNSISSFYTEHQKSPFAN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPW+SGSLRFKF+ GGSP SPWEDFQSNRKILAV+GICHCPSSPDL SVA QF  +CK Y
Sbjct  61   QPWESGSLRFKFILGGSPPSPWEDFQSNRKILAVIGICHCPSSPDLRSVANQFAAACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SSSLVQRCFAFCPGDSQLE+++ KGSN+VLFP
Sbjct  121  SSSLVQRCFAFCPGDSQLEEESNKGSNLVLFP  152



>ref|XP_007011772.1| TRS120 isoform 1 [Theobroma cacao]
 gb|EOY29391.1| TRS120 isoform 1 [Theobroma cacao]
Length=1201

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 1/152 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIR+AVLPIG +P PL RDY SML+RHH + LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRIAVLPIGDVPPPLLRDYHSMLLRHHAIPLSTISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRKILAV+GICHCPSSPDL+ V +QFN +CKGY
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGICHCPSSPDLDFVIDQFNAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV+RCFAFCPGDSQLE D  K  N+VLFP
Sbjct  121  TSALVERCFAFCPGDSQLE-DGKKRENLVLFP  151



>ref|XP_009362333.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Pyrus x bretschneideri]
Length=282

 Score =   244 bits (623),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIG +   L RDY SML+RHHT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSAMIRVAVLPIGHVAPVLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ +   Y
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARLAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV RCFAFCP DSQLED + KG N++LFP
Sbjct  121  SSALVDRCFAFCPADSQLEDGSKKGGNLMLFP  152



>ref|XP_009122000.1| PREDICTED: trafficking protein particle complex subunit 9 [Brassica 
rapa]
Length=1183

 Score =   260 bits (665),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP PL RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPPLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL SV E FNV+C+ Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLVSVTESFNVACRSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAFCPGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGENLILFP  152



>emb|CDX97076.1| BnaC09g45490D [Brassica napus]
Length=1183

 Score =   260 bits (664),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP PL RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPPLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL SV E FNV+C+ Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLVSVTESFNVACRSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAFCPGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGENLILFP  152



>emb|CDX69788.1| BnaA10g21370D [Brassica napus]
Length=1183

 Score =   260 bits (664),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP PL RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPPLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL SV E FNV+C+ Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLVSVTESFNVACRSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAFCPGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGENLILFP  152



>gb|KFK37733.1| hypothetical protein AALP_AA3G022200 [Arabis alpina]
Length=1187

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPSLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL SV E FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLVSVTEDFNVACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAFCPGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGENLILFP  152



>ref|XP_006286928.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
 gb|EOA19826.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
Length=1186

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS +IR+AVLPIG+IP  L RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETSSIIRIAVLPIGTIPPTLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+ V E+FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLDYVTEKFNVACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAF PGDSQLED   KG+N++LFP
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGANLILFP  152



>ref|XP_010453144.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Camelina sativa]
Length=1186

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT+ LS++SSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPTLLRDYHSMLLRHHTIALSAVSSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+SV E+FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLDSVTEKFNVACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAF PGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGENVILFP  152



>ref|XP_010491799.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Camelina sativa]
Length=1196

 Score =   258 bits (658),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT+ LS++SSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPQTLLRDYHSMLLRHHTIALSAVSSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+SV E FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLDSVTENFNVACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAF PGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGENLILFP  152



>ref|XP_010491797.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Camelina sativa]
Length=1186

 Score =   257 bits (657),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT+ LS++SSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPQTLLRDYHSMLLRHHTIALSAVSSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+SV E FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLDSVTENFNVACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAF PGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGENLILFP  152



>ref|XP_010419658.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Camelina sativa]
 ref|XP_010419659.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Camelina sativa]
Length=1186

 Score =   257 bits (657),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT+ LS++SSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPQTLLRDYHSMLLRHHTIALSAVSSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+SV E+FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLDSVTEKFNVACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAF PGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGENLILFP  152



>ref|XP_006399603.1| hypothetical protein EUTSA_v10012483mg [Eutrema salsugineum]
 gb|ESQ41056.1| hypothetical protein EUTSA_v10012483mg [Eutrema salsugineum]
Length=1187

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP  L +DY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPALLQDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL SV E FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLISVTESFNVACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAFCPGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGENLILFP  152



>ref|NP_196665.1| protein TRS120 [Arabidopsis thaliana]
 sp|Q9FY61.1|TR120_ARATH RecName: Full=Trafficking protein particle complex II-specific 
subunit 120 homolog; Short=AtTRS120; Short=TRAPP II-specific 
subunit 120 homolog; AltName: Full=Protein VASCULAR NETWORK 
DEFECTIVE 4 [Arabidopsis thaliana]
 emb|CAC03452.1| putative protein [Arabidopsis thaliana]
 gb|AED91628.1| protein TRS120 [Arabidopsis thaliana]
Length=1186

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPTLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRK+LAV+G+CHCPSSPDL+SV E+FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKMLAVIGLCHCPSSPDLDSVTEKFNVACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAF PGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGENLILFP  152



>ref|XP_010519641.1| PREDICTED: trafficking protein particle complex subunit 9 [Tarenaya 
hassleriana]
Length=1188

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIR+AVLPIG+IP  + R+Y S+L+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETSSMIRIAVLPIGTIPPAILREYHSILLRHHTIPLSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQS+RKILAV+G+CHCPSSPDL +V EQFNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSHRKILAVIGLCHCPSSPDLAAVIEQFNVACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAFCPGDSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGDNLILFP  152



>ref|XP_010048925.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Eucalyptus grandis]
Length=1198

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  MIRVAVLP+G +P PL RDY +ML+RH +V LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETGAMIRVAVLPVGHVPTPLLRDYAAMLLRHGSVSLSAISSFYTEHQKSPFAN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+ V EQF V CKGY
Sbjct  61   QPWDSGSLRFKFVIGGSPPSPWEDFQSNRKILAVVGVCHCPSSPDLDDVIEQFGVKCKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV+RCFAFCP D+QLED + K SN+ LFP
Sbjct  121  ASALVRRCFAFCPSDTQLEDGSKKDSNLKLFP  152



>ref|XP_010048924.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Eucalyptus grandis]
 gb|KCW81340.1| hypothetical protein EUGRSUZ_C02726 [Eucalyptus grandis]
Length=1202

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  MIRVAVLP+G +P PL RDY +ML+RH +V LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETGAMIRVAVLPVGHVPTPLLRDYAAMLLRHGSVSLSAISSFYTEHQKSPFAN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+ V EQF V CKGY
Sbjct  61   QPWDSGSLRFKFVIGGSPPSPWEDFQSNRKILAVVGVCHCPSSPDLDDVIEQFGVKCKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV+RCFAFCP D+QLED + K SN+ LFP
Sbjct  121  ASALVRRCFAFCPSDTQLEDGSKKDSNLKLFP  152



>ref|XP_010265703.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Nelumbo nucifera]
Length=1204

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIE+ CM+R+AVLPIG++P    RDY SMLVRH  V LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIESGCMLRIAVLPIGTVPQAQLRDYVSMLVRHRKVELSAISSFYTEHQKSPFAN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+GSLRFKFM GGSP SPWEDFQSNRKILAV+GICHCPSSPDL+ VA+QF++ CK Y
Sbjct  61   QPWDTGSLRFKFMVGGSPPSPWEDFQSNRKILAVIGICHCPSSPDLDVVADQFSIVCKNY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S++VQRCFAF PGD+QLED   +G N++LFP
Sbjct  121  TSAVVQRCFAFSPGDAQLEDGGKRGDNLILFP  152



>ref|XP_002871450.1| hypothetical protein ARALYDRAFT_487936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47709.1| hypothetical protein ARALYDRAFT_487936 [Arabidopsis lyrata subsp. 
lyrata]
Length=1186

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPTLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRK+LAV+G+CHCPSSPDL+SV E+FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKMLAVIGLCHCPSSPDLDSVTEKFNVACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV+RCFAF P DSQLED   KG N++LFP
Sbjct  121  SSALVRRCFAFSPDDSQLEDGDKKGENLILFP  152



>gb|KDO46778.1| hypothetical protein CISIN_1g045708mg [Citrus sinensis]
Length=1196

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVS+ETS MIR+AVLPIG++P  L RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSMETSSMIRIAVLPIGTVPPTLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRKILAV+GICHCPSSPDL+SV EQFN +CKGY
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGICHCPSSPDLDSVIEQFNAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV+RCFAF P DS LE+   KG N+++FP
Sbjct  121  NSALVKRCFAFSPCDSHLEEGGKKGDNLIMFP  152



>ref|XP_006483432.1| PREDICTED: uncharacterized protein LOC102615624 [Citrus sinensis]
Length=1196

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVS+ETS MIR+AVLPIG++P  L RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSMETSSMIRIAVLPIGTVPPTLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRKILAV+GICHCPSSPDL+SV EQFN +CKGY
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGICHCPSSPDLDSVIEQFNAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV+RCFAF P DS LE+   KG N+++FP
Sbjct  121  NSALVKRCFAFSPCDSHLEEGGKKGDNLIMFP  152



>ref|XP_006450337.1| hypothetical protein CICLE_v10007276mg [Citrus clementina]
 gb|ESR63577.1| hypothetical protein CICLE_v10007276mg [Citrus clementina]
Length=1193

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVS+ETS MIR+AVLPIG++P  L RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSMETSSMIRIAVLPIGTVPPTLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRKILAV+GICHCPSSPDL+SV EQFN +CKGY
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGICHCPSSPDLDSVIEQFNAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV+RCFAF P DS LE+   KG N+++FP
Sbjct  121  NSALVKRCFAFSPCDSHLEEGGKKGDNLIMFP  152



>ref|XP_004145518.1| PREDICTED: uncharacterized protein LOC101217047 [Cucumis sativus]
 ref|XP_004157090.1| PREDICTED: uncharacterized LOC101217047 [Cucumis sativus]
 gb|KGN55459.1| hypothetical protein Csa_4G652710 [Cucumis sativus]
Length=1196

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIGS+P  L RDY SML+RH  + LS+ISSFYTEHQKSPFSH
Sbjct  1    MEPDVSIETSSMIRVAVLPIGSVPPTLLRDYLSMLLRHQLIPLSAISSFYTEHQKSPFSH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG P +PWEDFQSNRKILAV+GICHCPSSPDL+SV +QFN SCK Y
Sbjct  61   QPWDSGSLRFKFILGGDPPNPWEDFQSNRKILAVIGICHCPSSPDLDSVIDQFNASCKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             S+LV+RCFAFCP DSQLE+   KG N+ LFP
Sbjct  121  PSALVERCFAFCPDDSQLEEGCKKGGNLRLFP  152



>ref|XP_008452884.1| PREDICTED: transport protein particle subunit trs120 [Cucumis 
melo]
Length=1196

 Score =   251 bits (642),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  MIRVAVLP+GS+P  L RDY SML+RH  + LS+ISSFYTEHQKSPFSH
Sbjct  1    MEPDVSIETGSMIRVAVLPVGSVPPTLLRDYLSMLLRHQLIPLSAISSFYTEHQKSPFSH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG P +PWEDFQSNRKILAV+GICHCPSSPDL+S  +QFN +CK Y
Sbjct  61   QPWDSGSLRFKFILGGDPPNPWEDFQSNRKILAVIGICHCPSSPDLDSAIDQFNAACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV+RCFAFCP DSQLE+ + KG N+ LFP
Sbjct  121  TSALVERCFAFCPDDSQLEEGSKKGGNLRLFP  152



>emb|CBI21099.3| unnamed protein product [Vitis vinifera]
Length=1056

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAV+P+G +P    RDY++ML+RH T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVIPVGPVPPNHLRDYSAMLLRHCTISLSTISSFYTEHQKSPFSN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKFM GGSP+SPWEDFQSNRKILAV+G+CHCPSSPDL++V +QF  +CKGY
Sbjct  61   QPWDSGSLRFKFMLGGSPSSPWEDFQSNRKILAVIGLCHCPSSPDLDAVVDQFAAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             S+LVQRCF FCPGDSQLED + +  N++LFP
Sbjct  121  PSALVQRCFGFCPGDSQLEDGSKREGNLILFP  152



>ref|XP_010648709.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Vitis vinifera]
Length=1206

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAV+P+G +P    RDY++ML+RH T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVIPVGPVPPNHLRDYSAMLLRHCTISLSTISSFYTEHQKSPFSN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKFM GGSP+SPWEDFQSNRKILAV+G+CHCPSSPDL++V +QF  +CKGY
Sbjct  61   QPWDSGSLRFKFMLGGSPSSPWEDFQSNRKILAVIGLCHCPSSPDLDAVVDQFAAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             S+LVQRCF FCPGDSQLED + +  N++LFP
Sbjct  121  PSALVQRCFGFCPGDSQLEDGSKREGNLILFP  152



>ref|XP_010648710.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Vitis vinifera]
Length=1202

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAV+P+G +P    RDY++ML+RH T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVIPVGPVPPNHLRDYSAMLLRHCTISLSTISSFYTEHQKSPFSN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKFM GGSP+SPWEDFQSNRKILAV+G+CHCPSSPDL++V +QF  +CKGY
Sbjct  61   QPWDSGSLRFKFMLGGSPSSPWEDFQSNRKILAVIGLCHCPSSPDLDAVVDQFAAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             S+LVQRCF FCPGDSQLED + +  N++LFP
Sbjct  121  PSALVQRCFGFCPGDSQLEDGSKREGNLILFP  152



>ref|XP_009355810.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Pyrus x bretschneideri]
Length=1202

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIG +P  L RDY SML+RH T+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHSMLLRHQTIPLSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ + + Y
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARRAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV RCFAFCPGDSQLED + KG N++LFP
Sbjct  121  SSALVDRCFAFCPGDSQLEDGSKKGGNLMLFP  152



>ref|XP_008219550.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Prunus mume]
Length=1200

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIG +P  L RDY SML+RH T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHSMLLRHQTIPLSAISSFYTEHQKSPFSN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ + + Y
Sbjct  61   QPWDSGSLRFKFIVGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARRAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV RCFAFCPGDSQLED + KG N++LFP
Sbjct  121  ASALVDRCFAFCPGDSQLEDGSKKGGNLMLFP  152



>ref|XP_008219549.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Prunus mume]
Length=1201

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIG +P  L RDY SML+RH T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHSMLLRHQTIPLSAISSFYTEHQKSPFSN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ + + Y
Sbjct  61   QPWDSGSLRFKFIVGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARRAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV RCFAFCPGDSQLED + KG N++LFP
Sbjct  121  ASALVDRCFAFCPGDSQLEDGSKKGGNLMLFP  152



>emb|CAN82119.1| hypothetical protein VITISV_024254 [Vitis vinifera]
Length=191

 Score =   231 bits (588),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAV+P+G +P    RDY++ML+RH T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVIPVGPVPPNHLRDYSAMLLRHCTISLSTISSFYTEHQKSPFSN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+GSLRFKFM GGSP+SPWEDFQSNRKILAV+G+CHCPSSPDL++V +QF  +CKGY
Sbjct  61   QPWDTGSLRFKFMLGGSPSSPWEDFQSNRKILAVIGLCHCPSSPDLDAVVDQFAAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLF  601
             S+LVQRCF FCPGDSQ    + + S +V+ 
Sbjct  121  PSALVQRCFGFCPGDSQETTSSTRLSLLVVL  151



>gb|KDP33546.1| hypothetical protein JCGZ_07117 [Jatropha curcas]
Length=1193

 Score =   249 bits (637),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIR+AVLPIG +P  + RDY SM +RHH + LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETSCMIRIAVLPIGPVPPNVLRDYYSMFLRHHIIPLSAISSFYTEHQKSPFAN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+GSLRF+F+ GGSP +PWEDFQSNRKILAV+G+CHCPSSPDL SV +QFNV+CK Y
Sbjct  61   QPWDTGSLRFRFVLGGSPPNPWEDFQSNRKILAVIGVCHCPSSPDLGSVVDQFNVACKNY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV RCFAFCP DSQLE+ + KG N+ LFP
Sbjct  121  ASALVMRCFAFCPCDSQLENSSKKGENLRLFP  152



>ref|XP_008394132.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Malus domestica]
Length=1202

 Score =   249 bits (635),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRV VLPIG +P  L RDY SML+RH T+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSSMIRVTVLPIGHVPPVLLRDYHSMLLRHQTIPLSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ + + Y
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARRAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV RCFAFCPGDSQLED + KG N++LFP
Sbjct  121  SSALVDRCFAFCPGDSQLEDGSKKGGNLMLFP  152



>ref|XP_010244785.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Nelumbo nucifera]
Length=1204

 Score =   249 bits (635),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIE+ CMIR+AVLPIG +P    RDY SMLVRH  V LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIESGCMIRIAVLPIGPVPQAQLRDYLSMLVRHRKVELSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+GSLRFKFM GGSP SPW DFQSNRKI AV+G+CHCPSSPDL+ VA QF+++CK Y
Sbjct  61   QPWDTGSLRFKFMVGGSPPSPWADFQSNRKIHAVIGLCHCPSSPDLDVVAAQFSIACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV+RCFAF PGD+QLED   +G N++LFP
Sbjct  121  TSALVKRCFAFSPGDAQLEDGGKRGDNLILFP  152



>emb|CAN76628.1| hypothetical protein VITISV_003544 [Vitis vinifera]
Length=153

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAV+P+G +P    RDY++ML+RH T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVIPVGPVPPNHLRDYSAMLLRHCTISLSTISSFYTEHQKSPFSN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD GSLRFKFM GGSP+SPWEDFQSNRKILAV+G+CHCPSSPDL++V +QF  +CKGY
Sbjct  61   QPWDXGSLRFKFMLGGSPSSPWEDFQSNRKILAVIGLCHCPSSPDLDAVVDQFAAACKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYK  580
             S+LVQRCF FCPGDSQ+   A K
Sbjct  121  PSALVQRCFGFCPGDSQVRLVAEK  144



>ref|XP_010244786.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Nelumbo nucifera]
Length=1180

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIE+ CMIR+AVLPIG +P    RDY SMLVRH  V LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIESGCMIRIAVLPIGPVPQAQLRDYLSMLVRHRKVELSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+GSLRFKFM GGSP SPW DFQSNRKI AV+G+CHCPSSPDL+ VA QF+++CK Y
Sbjct  61   QPWDTGSLRFKFMVGGSPPSPWADFQSNRKIHAVIGLCHCPSSPDLDVVAAQFSIACKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV+RCFAF PGD+QLED   +G N++LFP
Sbjct  121  TSALVKRCFAFSPGDAQLEDGGKRGDNLILFP  152



>ref|XP_009342628.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle 
complex subunit 9-like [Pyrus x bretschneideri]
Length=824

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIG +   L RDY SML+RHHT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSAMIRVAVLPIGHVAPVLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+S+ +QF+ +   Y
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSIIDQFDSARLAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+LV RCFAFCP DSQLED + KG N++LFP
Sbjct  121  SSALVDRCFAFCPADSQLEDGSKKGGNLMLFP  152



>ref|XP_011458836.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog isoform X1 [Fragaria vesca subsp. vesca]
Length=1199

 Score =   246 bits (628),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIG +P  L RDY +ML+RH T+ LS++SSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHAMLLRHQTIPLSAVSSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL SV +QF+ +C+ Y
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLGSVMDQFDTACRAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             ++LV+RCFAF P DSQLED + KG N++LFP
Sbjct  121  PAALVERCFAFSPADSQLEDGSKKGWNLMLFP  152



>ref|XP_004290928.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog isoform X2 [Fragaria vesca subsp. vesca]
Length=1198

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIG +P  L RDY +ML+RH T+ LS++SSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHAMLLRHQTIPLSAVSSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL SV +QF+ +C+ Y
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLGSVMDQFDTACRAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             ++LV+RCFAF P DSQLED + KG N++LFP
Sbjct  121  PAALVERCFAFSPADSQLEDGSKKGWNLMLFP  152



>ref|XP_007225443.1| hypothetical protein PRUPE_ppa000412mg [Prunus persica]
 gb|EMJ26642.1| hypothetical protein PRUPE_ppa000412mg [Prunus persica]
Length=1200

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIG +P  L RDY SML+R  T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHSMLLRLQTIPLSAISSFYTEHQKSPFSN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ + + Y
Sbjct  61   QPWDSGSLRFKFIVGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARRAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV RCFAFCPGDSQLED + KG N++LFP
Sbjct  121  ASALVDRCFAFCPGDSQLEDGSKKGGNLMLFP  152



>gb|KHG29759.1| Trafficking particle complex subunit 9 [Gossypium arboreum]
Length=1200

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIR+AVLPIG +P PL RDY SML+ HHT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRIAVLPIGKVPPPLLRDYHSMLLPHHTIPLSTISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+GSL+FKF+ GGSP SPWEDFQ  RK L+V+GICHCPSSPDL+ V +QFN +CK Y
Sbjct  61   QPWDTGSLQFKFLLGGSPPSPWEDFQPYRKFLSVIGICHCPSSPDLDHVIDQFNAACKIY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV RCFAFCPGDSQL DD  K  N+VLFP
Sbjct  121  TSALVLRCFAFCPGDSQL-DDGKKRENLVLFP  151



>emb|CDP18799.1| unnamed protein product [Coffea canephora]
Length=1204

 Score =   244 bits (623),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIRVAVLPIG IP  LFR Y+S+L+RHHTV LSSISSFYT+HQKSPFSH
Sbjct  1    MEPDVSIETSCMIRVAVLPIGPIPPHLFRHYSSLLLRHHTVSLSSISSFYTQHQKSPFSH  60

Query  329  QPWDS--GSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCK  502
            QPWDS   SLRFKF+  GSP SPWEDFQSNRKILAV+GI HCPSSPDL+S+A  F  + K
Sbjct  61   QPWDSPSASLRFKFILAGSPPSPWEDFQSNRKILAVIGISHCPSSPDLHSLALHFASASK  120

Query  503  GYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             YSSSLV RCFAF PGDSQLED+++KG+N++LFP
Sbjct  121  PYSSSLVHRCFAFSPGDSQLEDESHKGTNLILFP  154



>ref|XP_010105451.1| hypothetical protein L484_003461 [Morus notabilis]
 gb|EXC04752.1| hypothetical protein L484_003461 [Morus notabilis]
Length=1203

 Score =   242 bits (618),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPD SIETS MIRVAVLPIG +P  + RDY+SML+RH T+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDASIETSSMIRVAVLPIGEVPPAVMRDYSSMLLRHQTIPLSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRKILA++G+CHCPSSPDL+S+  +FN + K Y
Sbjct  61   QPWDSGSLRFKFILGGAPPSPWEDFQSNRKILALIGLCHCPSSPDLSSLLGRFNAASKAY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS+L+ RCFAF P DSQLE+ + KG N++LFP
Sbjct  121  SSALIHRCFAFSPADSQLEEWSKKGGNLMLFP  152



>gb|KJB07659.1| hypothetical protein B456_001G035900 [Gossypium raimondii]
Length=1200

 Score =   241 bits (616),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIR+AVLPIG +P  L RDY SML+RH T+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRIAVLPIGDVPSTLLRDYHSMLLRHCTIPLSTISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPW++GSLRFKF+ GG+P SPWEDFQ +RKIL V+GICHCPSSPDL+ V +QFN + +GY
Sbjct  61   QPWETGSLRFKFVLGGAPPSPWEDFQPHRKILGVIGICHCPSSPDLDLVIDQFNAAWRGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            SS LVQRCFAF PGDSQLE D  K  N+VLFP
Sbjct  121  SSVLVQRCFAFSPGDSQLE-DTKKRENLVLFP  151



>ref|XP_002515463.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46912.1| conserved hypothetical protein [Ricinus communis]
Length=1195

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETSCMIR+A++PIG++P  + RDY SM    H + LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETSCMIRIAIIPIGAVPAKILRDYYSMFEGQHRIPLSAISSFYTEHQKSPFAN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+GSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+SV +QFN SCK Y
Sbjct  61   QPWDTGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGVCHCPSSPDLDSVLDQFNASCKYY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+LV RCFAF P DSQ  D   KG N+ LFP
Sbjct  121  ASALVSRCFAFSPCDSQ--DGGKKGENLKLFP  150



>ref|XP_002309653.2| hypothetical protein POPTR_0006s27580g [Populus trichocarpa]
 gb|EEE93176.2| hypothetical protein POPTR_0006s27580g [Populus trichocarpa]
Length=1183

 Score =   233 bits (594),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  MIR+A+LPIG IP    RDY SM +  HT+ LSSISSFYTE QKSPF++
Sbjct  1    MEPDVSIETFSMIRIAILPIGKIPHQTLRDYYSMFLHQHTIPLSSISSFYTEEQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+GSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCP SPDL+SV E+FN  CKGY
Sbjct  61   QPWDTGSLRFKFILGGSPPSPWEDFQSNRKILAVIGVCHCPLSPDLDSVIEEFNGVCKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+ V RCF F P DSQLED   KG N+ LFP
Sbjct  121  ASARVTRCFGFLPCDSQLEDGGKKGDNLRLFP  152



>ref|XP_010942155.1| PREDICTED: trafficking protein particle complex subunit 9 [Elaeis 
guineensis]
 ref|XP_010942156.1| PREDICTED: trafficking protein particle complex subunit 9 [Elaeis 
guineensis]
Length=1207

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIG-SIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEPDVS+ET  MIR+AVLP+G +IP    R+Y +ML RH  + LSSISSFY EHQKSPF+
Sbjct  1    MEPDVSMETGSMIRIAVLPVGGAIPHHQLREYAAMLGRHTRIDLSSISSFYKEHQKSPFA  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW++G LRFK+M GG+P SPWEDFQS RKILAV+G+CHCPSSPDL+ VAEQF  +CKG
Sbjct  61   HQPWETGCLRFKYMLGGAPPSPWEDFQSCRKILAVVGLCHCPSSPDLDLVAEQFAAACKG  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            YSS+L +RCFAFCP DSQLEDD  K  NI+LFP
Sbjct  121  YSSALAKRCFAFCPTDSQLEDDGKKRENIILFP  153



>ref|XP_011036637.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Populus euphratica]
Length=1183

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVS+ETS MIR+A++PIG IP    RDY SM + HHT+ LSSISSFYTE QKSPF++
Sbjct  1    MEPDVSVETSAMIRIAIIPIGKIPHQTLRDYYSMFLHHHTIPLSSISSFYTEEQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPW++GSLRFKF+ GG+P SPWEDFQSNRKILAV+G+CHCP SPDL+SV E+F+  CKGY
Sbjct  61   QPWETGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGVCHCPLSPDLDSVIEEFDGVCKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+ V RCF F P DSQLED   KG N+ LFP
Sbjct  121  ASARVTRCFGFFPCDSQLEDGGKKGENLRLFP  152



>ref|XP_011036636.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Populus euphratica]
Length=1187

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVS+ETS MIR+A++PIG IP    RDY SM + HHT+ LSSISSFYTE QKSPF++
Sbjct  1    MEPDVSVETSAMIRIAIIPIGKIPHQTLRDYYSMFLHHHTIPLSSISSFYTEEQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPW++GSLRFKF+ GG+P SPWEDFQSNRKILAV+G+CHCP SPDL+SV E+F+  CKGY
Sbjct  61   QPWETGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGVCHCPLSPDLDSVIEEFDGVCKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+ V RCF F P DSQLED   KG N+ LFP
Sbjct  121  ASARVTRCFGFFPCDSQLEDGGKKGENLRLFP  152



>ref|XP_008784808.1| PREDICTED: trafficking protein particle complex subunit 9 [Phoenix 
dactylifera]
Length=1209

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIG-SIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEPDVS+ET  MIR+AVLP+G +IP    R+Y +ML R   + LSSISSFY EHQKSPF+
Sbjct  1    MEPDVSMETGSMIRIAVLPVGGAIPHRQLREYAAMLGRQTRIDLSSISSFYKEHQKSPFA  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW++G LRFK+M GG+P SPWEDFQS RKILAV+G+CHCPSSPDL+ VA+QF  +CKG
Sbjct  61   HQPWETGCLRFKYMLGGAPPSPWEDFQSCRKILAVVGLCHCPSSPDLDLVADQFAAACKG  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            YSS+L +RCFAFCP DSQLEDD  K  NI+LFP
Sbjct  121  YSSALAKRCFAFCPTDSQLEDDGKKRENIILFP  153



>ref|XP_011039615.1| PREDICTED: trafficking protein particle complex subunit 9 [Populus 
euphratica]
Length=1182

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIET  MIR+A+LPIG IP    RDY SM +  HT+ LSSISSFYTE QKSPF++
Sbjct  1    MEPDVSIETFSMIRIAILPIGQIPHQTLRDYYSMFLHQHTIPLSSISSFYTEEQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+GSLRFKF+ GGSP SPWEDFQSNRKILAV+G+ HCP SPDL+SV E+FN  CKGY
Sbjct  61   QPWDTGSLRFKFILGGSPPSPWEDFQSNRKILAVIGVFHCPLSPDLDSVIEEFNGVCKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +S+ V RCF F P DSQLED   KG N+ LFP
Sbjct  121  ASARVARCFGFFPCDSQLEDGGKKGENLRLFP  152



>ref|XP_010665754.1| PREDICTED: trafficking protein particle complex subunit 9 [Beta 
vulgaris subsp. vulgaris]
Length=1185

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIE+ C IR+AV+PIG I   LFR+Y S+L  H  + LSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIESMCTIRIAVVPIGQISPSLFREYASLLTLHSKIDLSSISSFYTEHQKSPFTH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+G LRFKF+ GGSP SPWEDFQSNRKIL+V+GI HCPSSPDL+SV + F + CKGY
Sbjct  61   QPWDTGCLRFKFILGGSPPSPWEDFQSNRKILSVIGIFHCPSSPDLDSVNDHFGLVCKGY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +SSL Q+CF FCPGD QL+D   +  N+ LFP
Sbjct  121  ASSLAQKCFGFCPGDQQLKDGNKRQDNLNLFP  152



>ref|XP_007161157.1| hypothetical protein PHAVU_001G047300g [Phaseolus vulgaris]
 gb|ESW33151.1| hypothetical protein PHAVU_001G047300g [Phaseolus vulgaris]
Length=1196

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEP+VSIE S MI+VAV+PIG++P  L RDY SML+  HT+ LS+ISSFYTEHQKSPF+ 
Sbjct  1    MEPEVSIEGSAMIQVAVVPIGTVPSNLLRDYYSMLIPLHTIPLSAISSFYTEHQKSPFAV  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+G+ HCPSSPDL++  + F+ +CK +
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKTLAVVGVVHCPSSPDLDTAVDVFSNACKSF  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             SSLV RCFAFCP DSQLED + KG N+ LFP
Sbjct  121  PSSLVDRCFAFCPNDSQLEDGSKKGGNLRLFP  152



>ref|XP_006848818.1| hypothetical protein AMTR_s00026p00150010 [Amborella trichopoda]
 gb|ERN10399.1| hypothetical protein AMTR_s00026p00150010 [Amborella trichopoda]
Length=1207

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIE+ CMIR+AVLP+G +P    RDY SML+R + + LSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIESGCMIRIAVLPVGDMPRSNMRDYVSMLLRLNKIELSSISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPW++GSLRFKF+ GG+  S WEDFQSNRKIL V+G+CHCPSSPDL +V EQF    K Y
Sbjct  61   QPWENGSLRFKFLVGGAQPSAWEDFQSNRKILGVIGLCHCPSSPDLGAVYEQFQGIRKAY  120

Query  509  SSSLVQRCFAFCPGDS--QLEDDAYKGSNIVLFP  604
            SS+LV++CFAFCP DS  QLED   KG+N++LFP
Sbjct  121  SSALVEKCFAFCPSDSQVQLEDGGKKGNNLILFP  154



>ref|XP_004498769.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Cicer arietinum]
Length=1188

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEP+VSIE S MI+VAV+PIG++P  + RDY SML+  HT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPEVSIEGSSMIQVAVIPIGTVPPNVLRDYYSMLLPLHTIPLSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+  SPWEDFQS RK LAVLGI HCPSSPDL++V +QF+ SCK Y
Sbjct  61   QPWDSGSLRFKFVLGGATPSPWEDFQSYRKNLAVLGIVHCPSSPDLDAVIDQFSNSCKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            +SSLV RCFAF P DSQLED + +  N+ LFP
Sbjct  121  TSSLVDRCFAFYPNDSQLEDGSKRDGNLRLFP  152



>gb|KEH39853.1| transporter TRS120 [Medicago truncatula]
Length=1183

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEP+VSIE S  I++AV+PIG IP PL RDY S+L+  HT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPEVSIEGSSTIQIAVIPIGQIPPPLLRDYYSLLLPLHTIPLSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+  SPWEDFQS+RK LAV+GI HCPSS DLN V +QF  SCK Y
Sbjct  61   QPWDSGSLRFKFVLGGATPSPWEDFQSHRKTLAVVGIVHCPSSLDLNDVVDQFASSCKSY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             SSLV RCFAF P DSQLED + +G N+ LFP
Sbjct  121  PSSLVDRCFAFYPNDSQLEDGSKRGGNLRLFP  152



>ref|XP_003550201.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Glycine max]
Length=1198

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEP+VSIE S MI+VAV+PIG++P  + RDY SML+  HT+ LS+ISSFYTEHQKSPF+ 
Sbjct  1    MEPEVSIEGSAMIQVAVVPIGAVPANVLRDYYSMLLPLHTIPLSAISSFYTEHQKSPFAV  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSLRFKF+ GG+P SPWEDFQS+RK LA++G+ HCPSSPDL +V + F  +CK +
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSHRKTLAIVGVVHCPSSPDLEAVVDVFASACKSF  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             SSLV RCFAFCP D+QLED + KG N+ LFP
Sbjct  121  PSSLVDRCFAFCPNDTQLEDGSKKGGNLRLFP  152



>ref|XP_006595493.1| PREDICTED: uncharacterized protein LOC100305609 isoform X1 [Glycine 
max]
Length=1200

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEP+VSIE S MI+VAV+PIG++P  + RDY SML+  HT+ LS+ISSFYTEHQKSPF+ 
Sbjct  1    MEPEVSIEGSAMIQVAVVPIGTVPSNVMRDYYSMLLPLHTIPLSAISSFYTEHQKSPFAV  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWDSGSL FKF+ GG+P SPWEDFQS+RK LAV+G+ HCPSSPDL++V + F  +CK +
Sbjct  61   QPWDSGSLLFKFVLGGAPPSPWEDFQSHRKTLAVVGVVHCPSSPDLDAVVDVFANACKSF  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             SSLV RCFAFCP DSQLED + KG N+ LFP
Sbjct  121  PSSLVDRCFAFCPDDSQLEDGSKKGGNLRLFP  152



>ref|XP_009381560.1| PREDICTED: trafficking protein particle complex subunit 9 [Musa 
acuminata subsp. malaccensis]
Length=1213

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIG-SIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEPDVS ET  MIR+AVLP+G SIP    R Y  ML RH  + LSSISSFY+EHQKSPF+
Sbjct  1    MEPDVSFETGSMIRIAVLPVGGSIPHARLRSYVEMLGRHTRIDLSSISSFYSEHQKSPFT  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW++GSLRFKFM GG+P S WEDFQS RKILAV+G+CHCP+SPDL+ VA+QF  + K 
Sbjct  61   HQPWETGSLRFKFMLGGAPPSAWEDFQSCRKILAVIGLCHCPASPDLDLVADQFATASKA  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y+S+L +RCFAF P DSQLE+   K  NI+LFP
Sbjct  121  YTSALAKRCFAFFPTDSQLEEGDNKRENILLFP  153



>ref|XP_008347735.1| PREDICTED: uncharacterized protein LOC103410865 [Malus domestica]
 ref|XP_008347736.1| PREDICTED: uncharacterized protein LOC103410865 [Malus domestica]
Length=184

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVSIETS MIRVAVLPIG +     RDY SML+RHHT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSAMIRVAVLPIGHVAPVFLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFAH  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFN  490
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+S+ EQF+
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSIIEQFD  114



>ref|XP_001777714.1| predicted protein [Physcomitrella patens]
 gb|EDQ57494.1| predicted protein [Physcomitrella patens]
Length=1123

 Score =   189 bits (479),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 85/153 (56%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEP+VS+E   MIRVAV+ IG +P   FRDY  MLV+H  + LS++S++YTEHQKSPFS 
Sbjct  1    MEPEVSVEGGSMIRVAVVAIGEMPPSQFRDYVEMLVQHAQIPLSTVSTYYTEHQKSPFSQ  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            Q W++GSL  KFM GG+  SPWEDFQ++RKIL V+G+CH P +PD+++  +QF   CK Y
Sbjct  61   QLWETGSLLLKFMVGGASKSPWEDFQAHRKILGVIGLCHLPLTPDISTAYDQFLTICKAY  120

Query  509  SSSLVQRCFAFCPGDSQLE-DDAYKGSNIVLFP  604
             S+ V RCFAF P D Q++ DD  K   +V+FP
Sbjct  121  PSAQVTRCFAFHPTDVQIDSDDEKKKEFLVMFP  153



>ref|XP_004976134.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Setaria italica]
Length=1182

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIG-SIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP +SIE+   IRVAVLP+G +IP P  R+Y +++ RH  V L+S+ ++Y EHQKSPF+
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGTIPPPRLREYMALVSRHARVDLASLRTYYAEHQKSPFA  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  + + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSSPDLDRVAADFVDTARS  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            YSS+L  RCFAFCP D Q+   A K  +I++FP
Sbjct  121  YSSALANRCFAFCPTDEQVRMAAKKRDDIIMFP  153



>ref|XP_004976133.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Setaria italica]
Length=1185

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIG-SIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP +SIE+   IRVAVLP+G +IP P  R+Y +++ RH  V L+S+ ++Y EHQKSPF+
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGTIPPPRLREYMALVSRHARVDLASLRTYYAEHQKSPFA  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  + + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSSPDLDRVAADFVDTARS  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            YSS+L  RCFAFCP D Q+   A K  +I++FP
Sbjct  121  YSSALANRCFAFCPTDEQMA--AKKRDDIIMFP  151



>ref|XP_008669201.1| PREDICTED: trafficking protein particle complex subunit 9 [Zea 
mays]
 tpg|DAA37076.1| TPA: hypothetical protein ZEAMMB73_993824 [Zea mays]
Length=1178

 Score =   184 bits (468),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 112/153 (73%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP +SIE+   IRVAVLP+G  IP P  R+Y +++ RH  V L+S+ ++Y EHQKSPF 
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGPIPPPRLREYAALVARHARVDLASLRTYYAEHQKSPFQ  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  + + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSSPDLDHVAADFIDAARS  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y S+L  RCFAFCP D+QL   A K  +I++FP
Sbjct  121  YPSALANRCFAFCPTDAQLS--AKKRDDIIMFP  151



>tpg|DAA37075.1| TPA: hypothetical protein ZEAMMB73_993824 [Zea mays]
Length=1163

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 112/153 (73%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP +SIE+   IRVAVLP+G  IP P  R+Y +++ RH  V L+S+ ++Y EHQKSPF 
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGPIPPPRLREYAALVARHARVDLASLRTYYAEHQKSPFQ  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  + + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSSPDLDHVAADFIDAARS  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y S+L  RCFAFCP D+QL   A K  +I++FP
Sbjct  121  YPSALANRCFAFCPTDAQLS--AKKRDDIIMFP  151



>ref|XP_001774293.1| predicted protein [Physcomitrella patens]
 gb|EDQ60929.1| predicted protein [Physcomitrella patens]
Length=1118

 Score =   183 bits (465),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/153 (54%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDV +E   +IR+AV+  G +P   FRDY  ML++H  + LSS+S +YTEHQKSPFS 
Sbjct  1    MEPDVRVEGGSIIRLAVVATGEMPPSHFRDYVEMLLQHTKIPLSSVSPYYTEHQKSPFSQ  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPWD+GSL  KF+ GG+ +SPWEDFQ++RKIL V+G+CHCP + +++S  EQF   CK Y
Sbjct  61   QPWDTGSLLLKFVVGGATSSPWEDFQTHRKILGVIGLCHCPLTSEISSAYEQFLTICKAY  120

Query  509  SSSLVQRCFAFCPGDSQLE-DDAYKGSNIVLFP  604
             S+ V RCFAF P  +Q++ D+  K   +V+FP
Sbjct  121  PSAQVMRCFAFHPTPAQMDLDEEKKKEFLVMFP  153



>ref|XP_002446750.1| hypothetical protein SORBIDRAFT_06g021740 [Sorghum bicolor]
 gb|EES11078.1| hypothetical protein SORBIDRAFT_06g021740 [Sorghum bicolor]
Length=1163

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 110/153 (72%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP +SIE+   IRVAVLP+G  IP P  R+Y +++ RH  V L+S+ ++Y EHQKSPF 
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGPIPPPRLREYAALVARHARVDLASLRTYYAEHQKSPFQ  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  S + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSSPDLDRVAADFIDSARS  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y S+L  RCFAFCP D+QL     K  +I++ P
Sbjct  121  YPSALANRCFAFCPTDAQLS--GKKRDDIIMLP  151



>ref|XP_010227185.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle 
complex subunit 9 [Brachypodium distachyon]
Length=1210

 Score =   182 bits (461),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 110/153 (72%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP +SIE+   IRVAVLP+G  IP    RDY +++ +H  V L+S+  +Y+EHQKSPFS
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGPIPPQCLRDYAALVAQHARVDLASLRPYYSEHQKSPFS  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPWD+G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL  VA  F  + + 
Sbjct  61   HQPWDTGCLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLGKVAADFVDAART  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y S+L  RCFAFCP D+QL +   K   I++FP
Sbjct  121  YPSALASRCFAFCPTDAQLAEK--KSDGIIMFP  151



>emb|CAE01639.1| OSJNBa0029H02.30 [Oryza sativa Japonica Group]
Length=1193

 Score =   179 bits (454),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 107/153 (70%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP VSIE+   IRVAVLP+G  I     RDY +++ RH  V L+S+  +Y+EHQKSPF+
Sbjct  1    MEPGVSIESGSAIRVAVLPVGGPISPARLRDYAALVARHARVDLASLRPYYSEHQKSPFA  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW  G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL  VA  F  + + 
Sbjct  61   HQPWGGGCLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLGRVAADFVDAARS  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y S+L  RCFAFCP D+QL     K  NI++FP
Sbjct  121  YPSALASRCFAFCPTDAQLVQK--KRDNIIMFP  151



>ref|NP_001053234.1| Os04g0502200 [Oryza sativa Japonica Group]
 sp|Q0JBY9.1|TR120_ORYSJ RecName: Full=Trafficking protein particle complex II-specific 
subunit 120 homolog; Short=TRAPP II-specific subunit 120 homolog 
[Oryza sativa Japonica Group]
 dbj|BAF15148.1| Os04g0502200 [Oryza sativa Japonica Group]
Length=1187

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 107/153 (70%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP VSIE+   IRVAVLP+G  I     RDY +++ RH  V L+S+  +Y+EHQKSPF+
Sbjct  1    MEPGVSIESGSAIRVAVLPVGGPISPARLRDYAALVARHARVDLASLRPYYSEHQKSPFA  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW  G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL  VA  F  + + 
Sbjct  61   HQPWGGGCLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLGRVAADFVDAARS  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y S+L  RCFAFCP D+QL     K  NI++FP
Sbjct  121  YPSALASRCFAFCPTDAQLVQK--KRDNIIMFP  151



>gb|EEC77580.1| hypothetical protein OsI_16530 [Oryza sativa Indica Group]
Length=1167

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 107/153 (70%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP VSIE+   IRVAVLP+G  I     RDY +++ RH  V L+S+  +Y+EHQKSPF+
Sbjct  1    MEPGVSIESGSAIRVAVLPVGGPISPARLRDYAALVARHARVDLASLRPYYSEHQKSPFA  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW  G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL  VA  F  + + 
Sbjct  61   HQPWGGGCLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLGRVAADFVDAARS  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y S+L  RCFAFCP D+QL     K  NI++FP
Sbjct  121  YPSALASRCFAFCPTDAQLVQK--KRDNIIMFP  151



>gb|EPS63566.1| hypothetical protein M569_11217, partial [Genlisea aurea]
Length=1100

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  305  HQKSPFSHQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQ  484
            HQKSPF++QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G CHCPSSPDL  +A+Q
Sbjct  1    HQKSPFANQPWDSGSLRFKFILGGSPPSPWEDFQSNRKILAVIGFCHCPSSPDLQDIADQ  60

Query  485  FNVSCKGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            F  +CKGYSSSLVQRCFAFCP DSQLE+++  GSN+VLFP
Sbjct  61   FAAACKGYSSSLVQRCFAFCPRDSQLEEESCNGSNLVLFP  100



>gb|EMT13211.1| hypothetical protein F775_03305 [Aegilops tauschii]
Length=1214

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 108/153 (71%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP +SIE+   IRVAVLP+G  IP    RD  +++  H  V L+S+  +Y+EHQKSPFS
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGPIPPQRLRDDAALVAEHARVDLASLRPYYSEHQKSPFS  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            H PWD+ SLR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL  VA  F  + + 
Sbjct  61   HPPWDTASLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLARVAADFLDAART  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y SSL  RCFAFCP D+QL ++   G  I++FP
Sbjct  121  YPSSLASRCFAFCPTDAQLLEERKDG--IIMFP  151



>emb|CAH67557.1| H0311C03.11 [Oryza sativa Indica Group]
Length=1187

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 103/153 (67%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP VSIE+   IRVAVLP+G  I     RDY +++ RH  V L+S+  +Y+EHQKSPF+
Sbjct  1    MEPGVSIESGSAIRVAVLPVGGPISPARLRDYAALVARHARVDLASLRPYYSEHQKSPFA  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW  G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL   A     + + 
Sbjct  61   HQPWGGGCLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLGRGAADVVDAARS  120

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
              ++   RCFAFCP D+QL     K  NI++FP
Sbjct  121  DPAARASRCFAFCPTDAQLVQK--KRDNIIMFP  151



>ref|XP_002965121.1| hypothetical protein SELMODRAFT_83253 [Selaginella moellendorffii]
 gb|EFJ33959.1| hypothetical protein SELMODRAFT_83253 [Selaginella moellendorffii]
Length=1091

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            ME D +++   +IRVAVL +G +P    RDY   +V+H  + L S+ +FY EHQKSPF+ 
Sbjct  1    MELDATLDDFSVIRVAVLAMGQMPPVYLRDYVETIVKHTDMDLRSVRAFYIEHQKSPFTQ  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
              W++G LR KFM GG+  SPWEDFQ++RKI  V+G+CHCP S DL +  ++F   C  Y
Sbjct  61   LAWETGKLRIKFMVGGAVRSPWEDFQAHRKIHGVIGLCHCPLSHDLGATYDKFLTICASY  120

Query  509  SSSLVQRCFAFCPGDSQLE-DDAYKGSNIVLFP  604
             S+ V+RCF F   D+QLE +D  K S+ +LFP
Sbjct  121  PSAQVKRCFGFHASDNQLEQEDKSKNSDFILFP  153



>ref|XP_002962206.1| hypothetical protein SELMODRAFT_77626 [Selaginella moellendorffii]
 gb|EFJ37466.1| hypothetical protein SELMODRAFT_77626 [Selaginella moellendorffii]
Length=1091

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            ME D +++   +IRVAVL +G +P    RDY   +V+H  + L S+ +FY EHQKSPF+ 
Sbjct  1    MELDATLDDFSVIRVAVLAMGQMPPVYLRDYVETIVKHTDMDLRSVRAFYIEHQKSPFTQ  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
              W++G LR KFM GG+  +PWEDFQ++RKI  V+G+CHCP S DL +  ++F   C  Y
Sbjct  61   LAWETGKLRIKFMVGGAVRNPWEDFQAHRKIHGVIGLCHCPLSHDLGATYDKFLTICASY  120

Query  509  SSSLVQRCFAFCPGDSQL-EDDAYKGSNIVLFP  604
             S+ V+RCF F   D+QL ++D  K S+ +LFP
Sbjct  121  PSAQVKRCFGFHASDNQLKQEDKSKNSDFILFP  153



>ref|XP_002963095.1| hypothetical protein SELMODRAFT_165701 [Selaginella moellendorffii]
 gb|EFJ36558.1| hypothetical protein SELMODRAFT_165701 [Selaginella moellendorffii]
Length=1000

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDV IE  C IRV V+ +GS+P+   RDYT M+ +H  + L + SSFY E QKSPF  
Sbjct  1    MEPDVCIENGCKIRVVVVGVGSMPLHRLRDYTEMVTQHARIELQATSSFYKEDQKSPFGL  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPW++G LRF+F+ G +  S WEDFQ++RK+   +G+ HCP   DL++  E+F   C  Y
Sbjct  61   QPWENGCLRFQFVIGRANRSQWEDFQAHRKVHGCIGVLHCPDVADLDAAYEKFVEICNEY  120

Query  509  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             ++  +RCFAF P   Q +D   K   +VLFP
Sbjct  121  PAAQTRRCFAFSPTQEQQDDK--KRQQMVLFP  150



>ref|XP_002980237.1| hypothetical protein SELMODRAFT_444472 [Selaginella moellendorffii]
 gb|EFJ18497.1| hypothetical protein SELMODRAFT_444472 [Selaginella moellendorffii]
Length=1093

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDV IE  C IRV V+ +GS+P+   RDYT M+ +H  + L + SSFY E QKSPF  
Sbjct  1    MEPDVCIENGCKIRVVVVGVGSMPLHRLRDYTEMVTQHARIELQATSSFYKEDQKSPFGL  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  508
            QPW++G LRF+F+ G +  S WEDFQ++RK+   +G+ HCP   DL++  E+F   C  Y
Sbjct  61   QPWENGCLRFQFVIGRANRSQWEDFQAHRKVHGCIGVLHCPDVADLDAAYEKFVEICNEY  120

Query  509  SSSLVQRCFAFCPGDSQ  559
             ++  +RCFAF P   Q
Sbjct  121  PAAQTRRCFAFSPTQEQ  137



>ref|XP_008664222.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle 
complex subunit 9-like [Zea mays]
Length=1113

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 103/153 (67%), Gaps = 6/153 (4%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPL-FRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP + IE+   IRVAV+P+G    P   R+Y +++ R+  V L+S+ ++Y EHQKSPF 
Sbjct  1    MEPGLRIESGSAIRVAVVPVGGPIPPPRLREYAALVARNARVDLASVRTYYAEHQKSPFQ  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSS     VA  F  + + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSS---XRVAADFIDAARS  117

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y S+L  RCFAFCP D+QL     K   I++FP
Sbjct  118  YPSALANRCFAFCPTDAQLS--GKKRDTIIMFP  148



>ref|XP_002324891.2| hypothetical protein POPTR_0018s02220g [Populus trichocarpa]
 gb|EEF03456.2| hypothetical protein POPTR_0018s02220g [Populus trichocarpa]
Length=1087

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            MEPDVS+ETS MIR+A++PIG IP    RDY SM + HHT+ LSSISSFYTE QKSPF++
Sbjct  1    MEPDVSVETSAMIRIAIIPIGKIPHQTLRDYYSMFLHHHTIPLSSISSFYTEEQKSPFTN  60

Query  329  QPWDSGSLRFKFMAGGSPASPWEDFQSN  412
            QPW++GSLRFKF+ GG+P SPWEDFQSN
Sbjct  61   QPWETGSLRFKFVLGGAPPSPWEDFQSN  88



>ref|XP_008377455.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=215

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  293  FYTEHQKSPFSHQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNS  472
             YTEH  SPF+HQP DSG++RFKF+ GG+P SPWEDFQ NRK L V+ I HCPSSP+L+S
Sbjct  44   IYTEHLXSPFAHQPLDSGNIRFKFVLGGAPLSPWEDFQXNRKTLVVISIYHCPSSPNLDS  103

Query  473  VAEQFNVSCKGYSSSLVQRCFAFCPGDSQ  559
            + +QF+ + + YSS+LV RCFAFCP D Q
Sbjct  104  IIDQFDSALRTYSSALVNRCFAFCPDDFQ  132



>ref|XP_005844832.1| hypothetical protein CHLNCDRAFT_138272 [Chlorella variabilis]
 gb|EFN52730.1| hypothetical protein CHLNCDRAFT_138272 [Chlorella variabilis]
Length=1511

 Score =   128 bits (322),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 62/161 (39%), Positives = 94/161 (58%), Gaps = 4/161 (2%)
 Frame = +2

Query  128  PISDSLIMEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEH  307
            P++ +L  E  V++ ++  IRV +LP+G  P  +F+ Y S++VRH  V L+++ SFY E 
Sbjct  7    PVARTL--EAGVTLFSAAEIRVVLLPVGEAPEAVFQRYASLIVRHRQVELNNVRSFYKEA  64

Query  308  QKSPFSHQPWDSGSLRFKFMAG--GSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAE  481
            QKSPF   PW  G++ F+F+       ASP     S+R++L V+GI HCP   D+     
Sbjct  65   QKSPFKFFPWKQGNMHFRFLPEELALEASPLAPLHSHRRVLGVIGIMHCPEVQDVAKAYL  124

Query  482  QFNVSCKGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            QF   CK +  +   RCFAF P D Q+++D     N ++FP
Sbjct  125  QFEQRCKAFPDAFTLRCFAFEPSDEQIQEDRKGQRNFIMFP  165



>gb|AFW58777.1| hypothetical protein ZEAMMB73_746167 [Zea mays]
Length=106

 Score =   115 bits (289),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPL-FRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP + IE+   IRVAV+P+G    P   R+Y +++ R+  V L+S+ ++Y EHQKSPF 
Sbjct  1    MEPGLRIESGSAIRVAVVPVGGPIPPPRLREYAALVARNARVDLASVRTYYAEHQKSPFQ  60

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSS  457
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSS
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSS  104



>gb|KDD72036.1| hypothetical protein H632_c3968p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=241

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 73/136 (54%), Gaps = 5/136 (4%)
 Frame = +2

Query  206  IGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSHQPWDSGSLRFKFM---AGG  376
            +G     +F  Y S++ RH  V LSSI SFY E QKSPF   PW +G + F F+      
Sbjct  4    VGEASPAVFDKYASLITRHRQVELSSIKSFYKEAQKSPFKFFPWRTGHMSFSFLEEEEAL  63

Query  377  SPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAFCPGDS  556
            +PA P     S+R +  V+G+ HCPS PD+     QF   C+ +  +   R  AF P DS
Sbjct  64   TPA-PLSPLHSHRAVAGVIGVLHCPSVPDVAREVAQFEKVCRTFKGASTVRLAAFGPSDS  122

Query  557  QLEDDAYKGSNIVLFP  604
            Q+ D A K  NI LFP
Sbjct  123  QMADLAKK-DNIFLFP  137



>ref|XP_011399423.1| Trafficking protein particle complex subunit 9 [Auxenochlorella 
protothecoides]
 gb|KFM26485.1| Trafficking protein particle complex subunit 9 [Auxenochlorella 
protothecoides]
Length=702

 Score =   103 bits (257),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 48/140 (34%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            +EP++++ +   IRVA++P+G  P   F+   S++ RH  V LS + +F+ E  K+PF H
Sbjct  12   VEPNITLFSPAEIRVAMIPVGEAPDAEFQRCASLITRHKQVKLSHVRTFHHEAHKTPFKH  71

Query  329  QPWDSGSLRFKFMAGGSP--ASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCK  502
             PW SG++ FKF+   +    SP     ++R +L V+GI HC  + DL      F   C 
Sbjct  72   IPWKSGNMNFKFLGEEAALGPSPLSTLHAHRAVLGVIGILHCGHTRDLAKACRAFQQRCH  131

Query  503  GYSSSLVQRCFAFCPGDSQL  562
             +  +   R F F P D+Q+
Sbjct  132  AFKGAFTVRLFGFDPTDAQV  151



>ref|XP_006653574.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Oryza brachyantha]
Length=1113

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = +2

Query  371  GGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAFCPG  550
            GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  + + Y S+L  RCFAFCP 
Sbjct  5    GGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLDRVAADFVDAARSYPSALANRCFAFCPT  64

Query  551  DSQLEDDAYKGSNIVLFP  604
            D+QL +   K  +I++FP
Sbjct  65   DAQLVEK--KRDDIIMFP  80



>ref|XP_643937.1| hypothetical protein DDB_G0274803 [Dictyostelium discoideum AX4]
 gb|EAL70294.1| hypothetical protein DDB_G0274803 [Dictyostelium discoideum AX4]
Length=1464

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 82/153 (54%), Gaps = 5/153 (3%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            ME +++   +  I++ +LPIG I    +++YTS++   + + LSSI+   ++++ SPF  
Sbjct  1    MEMNLTFTENRSIKILILPIGDISPEKYKEYTSLIKTINIIELSSITR--SQNELSPFEK  58

Query  329  QPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
              W  GS+   F+  GS   S +ED Q+ +K+  V+G+  C  S DL      F ++   
Sbjct  59   ISWVDGSMILNFVDIGSFQRSEYEDLQTYKKVFGVIGVVDCKKSKDLQETKRLFEIAVAQ  118

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y S +   C AF P D Q   D   G+N+++ P
Sbjct  119  YPSCVSSLCCAFDPMDDQ--PDLGLGANLIMIP  149



>ref|XP_003290001.1| hypothetical protein DICPUDRAFT_154468 [Dictyostelium purpureum]
 gb|EGC33478.1| hypothetical protein DICPUDRAFT_154468 [Dictyostelium purpureum]
Length=1287

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 47/153 (31%), Positives = 82/153 (54%), Gaps = 5/153 (3%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            ME +++   +  I+V +LPIG I    +++YTS++   + + LSSI+   ++++ +PF  
Sbjct  1    MEMNLTFTENRSIKVIILPIGDISPEKYKEYTSLIKTINIIELSSITR--SQNESTPFEK  58

Query  329  QPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
              W  GS+   F+   S   S +E+FQ+ +K+  V+G+  C  S DL    + F  +   
Sbjct  59   ISWVDGSMLLNFVDASSYQRSEYEEFQTYKKVFGVIGVVDCKKSKDLMVTKKLFEQAVNQ  118

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            Y S +   C AF P D Q   D   G+N+++ P
Sbjct  119  YPSCVSSLCCAFDPMDDQ--QDLGLGANLIMIP  149



>emb|CEP15600.1| hypothetical protein [Parasitella parasitica]
Length=1363

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 45/144 (31%), Positives = 75/144 (52%), Gaps = 4/144 (3%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  + + +SC +RV ++P+  I    F  Y  ++   + V L  ++    +   + FS 
Sbjct  1    MDLAIDVTSSCKVRVLLVPVAPIKKATFNKYVELVKTFNLVRLGDVTPDMKKGANAMFSS  60

Query  329  QPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  499
            Q +  G + F+F+   +   +  EDFQ +R+I  V+GI  C    S DLN   +QF+   
Sbjct  61   QAFQEGQMHFQFITHWTRDHAELEDFQPHRRIFGVIGIMDCQEWKSRDLNEGYKQFSRGL  120

Query  500  KGYSSSLVQRCFAFCPGDSQLEDD  571
              Y +++  RCFAF P +SQ EDD
Sbjct  121  DQYPTAVATRCFAFDPSESQ-EDD  143



>gb|EPB91027.1| hypothetical protein HMPREF1544_02096 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=1379

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 46/155 (30%), Positives = 81/155 (52%), Gaps = 7/155 (5%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  + + +SC +RV ++P+  I    F  Y  ++   H V L  ++    +   + FS 
Sbjct  1    MDLAIDVTSSCRVRVLLVPVSPIKKSTFYKYVELVKTFHLVRLGDVTPDLKKGANAMFSS  60

Query  329  QPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  499
            Q +  G + F+F+   +   +  EDFQ +R+I  V+GI  C    + DL+   +QF+   
Sbjct  61   QAFQEGQMHFQFITHWTREHAELEDFQPHRRIFGVIGIMDCQEWKNKDLSEGYKQFSQDL  120

Query  500  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
              Y +++  RCFAF P ++Q EDD  KG  +++ P
Sbjct  121  DQYPTAVATRCFAFDPSETQ-EDDT-KG--LIMIP  151



>dbj|GAN03919.1| hypercellular protein [Mucor ambiguus]
Length=1434

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 47/158 (30%), Positives = 82/158 (52%), Gaps = 10/158 (6%)
 Frame = +2

Query  125  PPI----SDSLIMEPDVSIE--TSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSI  286
            PP     + + I++ D++I+  +SC +RV ++P+  I    F  Y  ++   H V L  +
Sbjct  29   PPFPTFYTSTTILDMDLAIDVTSSCRVRVLLVPVSPIKKSTFYKYVELVKTFHLVRLGDV  88

Query  287  SSFYTEHQKSPFSHQPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCPS--S  457
            +    +   + FS Q +  G + F+F+   +   +  EDFQ +R+I  V+GI  C     
Sbjct  89   TPDLKKGANAMFSSQVFQEGQMHFQFITHWTREHAELEDFQPHRRIFGVIGIMDCQEWKD  148

Query  458  PDLNSVAEQFNVSCKGYSSSLVQRCFAFCPGDSQLEDD  571
             DL+   +QF+     Y +++  RCFAF P ++Q EDD
Sbjct  149  KDLSGAYKQFSQDLDQYPTAVATRCFAFDPSETQ-EDD  185



>gb|KFH70946.1| hypothetical protein MVEG_03792 [Mortierella verticillata NRRL 
6337]
Length=1465

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 77/151 (51%), Gaps = 6/151 (4%)
 Frame = +2

Query  161  VSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSHQPWD  340
            V+  ++  IRV ++P+G I    F  +  ML  H++V L  +S      + S FS     
Sbjct  4    VNFISAARIRVLLVPVGPIKKATFERHAKMLRNHNSVKLEEVS-MGPRTENSFFSQNVPH  62

Query  341  SGSLRFKFMAGGSPASPW-EDFQSNRKILAVLGICHCPSSPDLNSVA--EQFNVSCKGYS  511
             G L F+F+   S    + E+FQ +R++  V+GI  C   PD N VA  +QF      Y 
Sbjct  63   EGQLYFQFVTSYSNEHQYLEEFQMHRRVFGVIGIMDCQEWPDGNMVAGYQQFQQILAKYP  122

Query  512  SSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
            S++  +CFAF P + Q +D   +G  I++ P
Sbjct  123  SAVANQCFAFDPSEQQPDDP--RGGGIIMIP  151



>dbj|GAM26879.1| hypothetical protein SAMD00019534_100540 [Acytostelium subglobosum 
LB1]
Length=1028

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 69/138 (50%), Gaps = 3/138 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+ +++   +  IRVA+LPIG I +  FR Y++++     + LS I+    E +      
Sbjct  1    MDINLTFIENRAIRVAILPIGDISLDSFRHYSNLIKTLAIIELSGITRDAKESRV--LEK  58

Query  329  QPWDSGSLRFKFMAGGSP-ASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
              W  G +   F+   +P  S WED   ++++  V+G+  C  + DL      F+++   
Sbjct  59   INWVDGHMLLNFLDSTTPPTSEWEDIHVHKRVFGVIGVVDCKRAKDLTETKRLFDLAIAP  118

Query  506  YSSSLVQRCFAFCPGDSQ  559
            Y S++   C+AF P D Q
Sbjct  119  YKSAVATVCYAFDPLDEQ  136



>ref|XP_002682761.1| hypothetical protein NAEGRDRAFT_77990 [Naegleria gruberi]
 gb|EFC50017.1| hypothetical protein NAEGRDRAFT_77990 [Naegleria gruberi]
Length=1102

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 48/160 (30%), Positives = 77/160 (48%), Gaps = 19/160 (12%)
 Frame = +2

Query  161  VSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSHQPWD  340
            + + T+ +IR+A+ PIG I    F+ + SM+    +  + S++ F  ++ KSPF  Q W 
Sbjct  11   LGVVTNTLIRIAIFPIGKINASTFKKFVSMIQACDSKPIKSLTRFRDDNLKSPFQKQDWS  70

Query  341  SGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG----Y  508
               L+F+F+   S  + + DF   R +  V+GI  C S     SVA  F    K     Y
Sbjct  71   RSVLKFQFVDETSINTGYSDFHQYRNVHGVIGIMSCLSE---ESVASGFTKYKKQKLQLY  127

Query  509  SSSLVQRCFA-------FCPGDSQL-----EDDAYKGSNI  592
              ++V RCFA         P D +L     +D+ + G +I
Sbjct  128  GKNIVGRCFAVEQDPETMAPEDEELVVIPNQDENHVGCHI  167



>gb|ESA21684.1| hypothetical protein GLOINDRAFT_119508 [Rhizophagus irregularis 
DAOM 181602]
Length=1326

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 64/129 (50%), Gaps = 1/129 (1%)
 Frame = +2

Query  185  IRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSHQPWDSGSLRFKF  364
            IRV ++P+  I  P F  +  ++   + V L  ++      Q + FS Q +  G L F F
Sbjct  12   IRVLLVPVHPIKAPTFHRHVQLVKNFNVVRLGDVTPDMRGVQSAMFSSQLFHEGQLHFNF  71

Query  365  MAGGSPASPW-EDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAF  541
            +    P   + E+FQ +R+I  V+GI  C    DL     +F+   K Y +++  RCFAF
Sbjct  72   VTSYEPEHAYLEEFQMHRRIFGVIGIMDCCEWSDLKEGYNKFSEIIKNYRTAVAHRCFAF  131

Query  542  CPGDSQLED  568
             P + Q +D
Sbjct  132  DPSEDQPDD  140



>gb|EEE61278.1| hypothetical protein OsJ_15360 [Oryza sativa Japonica Group]
Length=1247

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 73/166 (44%), Gaps = 28/166 (17%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFS  325
            MEP VSIE+   IRVAVLP+G  I     RDY +++ RH     + + S           
Sbjct  1    MEPGVSIESGSAIRVAVLPVGGPISPARLRDYAALVARH-----ARVDSRLAAALLLGAP  55

Query  326  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSS-------------PDL  466
             +P        +  A G    P +      + LAV G+   P               PDL
Sbjct  56   EEP-------LRAPAVGRRLPPPQVRARRLRALAVAGLPVLPQGCSPSSASATSPSFPDL  108

Query  467  NSVAEQFNVSCKGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
              VA  F  + + Y S+L  RCFAFCP D+QL     K  NI++FP
Sbjct  109  GRVAADFVDAARSYPSALASRCFAFCPTDAQLVQK--KRDNIIMFP  152



>ref|XP_005819358.1| trafficking protein particle complex 9 [Guillardia theta CCMP2712]
 gb|EKX32378.1| trafficking protein particle complex 9 [Guillardia theta CCMP2712]
Length=1818

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/131 (31%), Positives = 64/131 (49%), Gaps = 6/131 (5%)
 Frame = +2

Query  185  IRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKS---PFSHQPWDSGSLR  355
            +RVA++P+G I    F  Y  +L    ++ +  +         S   PFS    D G LR
Sbjct  18   VRVALMPVGRISPERFERYARVLTDVRSIDVRVVDRTEVSSASSHAFPFSEGLADYGQLR  77

Query  356  FKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQF---NVSCKGYSSSLVQ  526
              F+  G   SPW+  Q++R++LAV+GIC+CP + D  S  E F     S   +  ++  
Sbjct  78   ILFVDVGYSNSPWDSLQASRQVLAVVGICYCPEADDFLSAWESFLHDVQSSHVWRGAISV  137

Query  527  RCFAFCPGDSQ  559
             C A  PG+ +
Sbjct  138  HCIAIEPGEHR  148



>ref|XP_008618120.1| hypothetical protein SDRG_13800 [Saprolegnia diclina VS20]
 gb|EQC28472.1| hypothetical protein SDRG_13800 [Saprolegnia diclina VS20]
Length=1187

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 43/147 (29%), Positives = 79/147 (54%), Gaps = 10/147 (7%)
 Frame = +2

Query  185  IRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS---SFYTEHQKSPFSHQPWDSG-SL  352
            I V  +P+G++ + L+ +Y  +L     + +SS++    + TE   SPF    W+S  ++
Sbjct  9    ILVYTMPVGNLSMELYEEYMGVLQSAAVIPISSLTRPGGYSTE--LSPFRSLSWESSQAI  66

Query  353  RFKFMAGGSPAS-PWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQR  529
            +++F+        P E+  ++R+ LA+LGICHCP++ +L      F      + +++  +
Sbjct  67   KYRFLDMNQVLHVPCEEVHASRRPLALLGICHCPTTENLREAYHHFTTVAAQFPTTIAHK  126

Query  530  CFAF--CPGDSQLEDDAYKGSNIVLFP  604
            CFAF    G   L+D A    N+V+FP
Sbjct  127  CFAFEHAFGAGTLDDVAVL-DNLVMFP  152



>gb|EIE80684.1| hypothetical protein RO3G_05389 [Rhizopus delemar RA 99-880]
Length=1267

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 42/143 (29%), Positives = 73/143 (51%), Gaps = 3/143 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  V I +SC +RV ++P+  I    F  +  ++ + +TV L  ++    +   + FS 
Sbjct  1    MDLAVDITSSCRVRVLLVPVSPIKKSSFWRHVELVRKFNTVRLGDVTPDLHKGANAKFSS  60

Query  329  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  499
            Q +  G + F+F+       S  EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGQMHFQFVTKYNRDHSHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYKEFVDML  120

Query  500  KGYSSSLVQRCFAFCPGDSQLED  568
              Y +++  RCFAF P ++Q +D
Sbjct  121  VQYPTAVATRCFAFDPTENQPDD  143



>gb|KDO21720.1| hypothetical protein SPRG_13136 [Saprolegnia parasitica CBS 223.65]
Length=956

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 42/146 (29%), Positives = 79/146 (54%), Gaps = 8/146 (5%)
 Frame = +2

Query  185  IRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWDSG-SLR  355
            I V  +P+G++ + L+ +Y  +L     + +SS++    Y+  + SPF    W+S  +++
Sbjct  9    ILVYTMPVGNLSMELYEEYMGVLQSAAVIPISSLTRPGGYSA-ELSPFRSLSWESSQAIK  67

Query  356  FKFMAGGSPAS-PWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRC  532
            ++F+        P E+  ++R+ LA+LGICHCP++ +L      F      + +++  +C
Sbjct  68   YRFLDMNRVLHLPCEEVHASRRPLALLGICHCPTTENLREAYHHFTTVAAQFPTTIAHKC  127

Query  533  FAF--CPGDSQLEDDAYKGSNIVLFP  604
            FAF    G   L+D A    N+V+FP
Sbjct  128  FAFEHAFGAGTLDDVAVL-DNLVMFP  152



>ref|XP_002954311.1| hypothetical protein VOLCADRAFT_106329 [Volvox carteri f. nagariensis]
 gb|EFJ44735.1| hypothetical protein VOLCADRAFT_106329 [Volvox carteri f. nagariensis]
Length=196

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 66/157 (42%), Gaps = 39/157 (25%)
 Frame = +2

Query  191  VAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEH-----------------QKSP  319
             AVLP+G++P     +Y  ++ R          SFY E                   K P
Sbjct  41   AAVLPVGAVPRDAMEEYLELINR----------SFYRESPVVQAAAVSAAGLAGGVSKPP  90

Query  320  FSHQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSC  499
                 W +  L  +F+               R++LA+LG+ HCP   ++    ++F   C
Sbjct  91   LQLLDWSNSYLHLRFL----------QLYPGRQVLAILGVVHCPMCSNVQQAYDEFKKIC  140

Query  500  KGYSSSLVQRCFAFCPGDSQL--EDDAYKGSNIVLFP  604
            + Y  +LV RCF F P +  +  E D  + S++V+FP
Sbjct  141  RSYPEALVTRCFVFEPSEDHIRQERDCQQLSDLVMFP  177



>gb|ETL35876.1| hypothetical protein L916_12075 [Phytophthora parasitica]
Length=1451

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 74/147 (50%), Gaps = 10/147 (7%)
 Frame = +2

Query  191  VAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWD-SGSLRFK  361
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  362  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  526
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVESYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  527  RCFAFCPGDSQLEDDAYKG-SNIVLFP  604
            + FAF      +     +G S++V+FP
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFP  162



>gb|ETO71095.1| hypothetical protein F444_12526 [Phytophthora parasitica P1976]
Length=1451

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 74/147 (50%), Gaps = 10/147 (7%)
 Frame = +2

Query  191  VAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWD-SGSLRFK  361
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  362  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  526
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVESYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  527  RCFAFCPGDSQLEDDAYKG-SNIVLFP  604
            + FAF      +     +G S++V+FP
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFP  162



>gb|ETK82491.1| hypothetical protein L915_12150 [Phytophthora parasitica]
 gb|ETP12188.1| hypothetical protein F441_12410 [Phytophthora parasitica CJ01A1]
Length=1451

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 74/147 (50%), Gaps = 10/147 (7%)
 Frame = +2

Query  191  VAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWD-SGSLRFK  361
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  362  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  526
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVESYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  527  RCFAFCPGDSQLEDDAYKG-SNIVLFP  604
            + FAF      +     +G S++V+FP
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFP  162



>gb|ETL89091.1| hypothetical protein L917_11910 [Phytophthora parasitica]
Length=1451

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 74/147 (50%), Gaps = 10/147 (7%)
 Frame = +2

Query  191  VAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWD-SGSLRFK  361
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  362  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  526
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVESYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  527  RCFAFCPGDSQLEDDAYKG-SNIVLFP  604
            + FAF      +     +G S++V+FP
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFP  162



>gb|ETI42476.1| hypothetical protein F443_12424 [Phytophthora parasitica P1569]
 gb|ETM42371.1| hypothetical protein L914_11983 [Phytophthora parasitica]
Length=1451

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 74/147 (50%), Gaps = 10/147 (7%)
 Frame = +2

Query  191  VAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWD-SGSLRFK  361
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLGWTGTGSLRFH  75

Query  362  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  526
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVESYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  527  RCFAFCPGDSQLEDDAYKG-SNIVLFP  604
            + FAF      +     +G S++V+FP
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFP  162



>ref|XP_008908759.1| hypothetical protein PPTG_14018 [Phytophthora parasitica INRA-310]
 gb|ETN06257.1| hypothetical protein PPTG_14018 [Phytophthora parasitica INRA-310]
Length=1451

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 74/147 (50%), Gaps = 10/147 (7%)
 Frame = +2

Query  191  VAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWD-SGSLRFK  361
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  362  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  526
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVDSYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  527  RCFAFCPGDSQLEDDAYKG-SNIVLFP  604
            + FAF      +     +G S++V+FP
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFP  162



>gb|ETP40315.1| hypothetical protein F442_12346 [Phytophthora parasitica P10297]
Length=1451

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 74/147 (50%), Gaps = 10/147 (7%)
 Frame = +2

Query  191  VAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWD-SGSLRFK  361
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  362  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  526
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVDSYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  527  RCFAFCPGDSQLEDDAYKG-SNIVLFP  604
            + FAF      +     +G S++V+FP
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFP  162



>ref|XP_009530723.1| hypothetical protein PHYSODRAFT_513497 [Phytophthora sojae]
 gb|EGZ13294.1| hypothetical protein PHYSODRAFT_513497 [Phytophthora sojae]
Length=1465

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 67/125 (54%), Gaps = 9/125 (7%)
 Frame = +2

Query  191  VAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPW-DSGSLRFK  361
            V ++P+G IP  +F  Y  +L RH  + L S++    Y   + SPF    W  +GSLRF+
Sbjct  17   VYLVPVGGIPADVFAGYARLLQRHSELPLCSLTRPGGYAA-ELSPFRGLDWAGAGSLRFR  75

Query  362  FMAGGS--PASPWEDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  526
            F++      A   ED  ++R+++ VLG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAERVDACDGEDAHASRRVVGVLGVCHSPSLTLSGGLRAAHAQFEASVRRFPGLLLH  135

Query  527  RCFAF  541
            + FAF
Sbjct  136  KLFAF  140



>ref|XP_004361713.1| histidine kinase [Dictyostelium fasciculatum]
 gb|EGG23862.1| histidine kinase [Dictyostelium fasciculatum]
Length=1180

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 65/138 (47%), Gaps = 3/138 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+ +++   +  IRV VLPIG I    F++YTS++     + LS I+     ++      
Sbjct  1    MDINLTFVENRAIRVVVLPIGDISNESFKEYTSLIRTLGIIELSGITR--DANESKILEK  58

Query  329  QPWDSGSLRFKFMAGG-SPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
              W  G +   F+     P   WE+    +KI  V+G+  C  S DL    +QF  +   
Sbjct  59   ISWVDGHMLLNFLDSTVPPKDEWEELHIYKKIFGVIGVVDCKRSRDLQETKKQFEQAVSR  118

Query  506  YSSSLVQRCFAFCPGDSQ  559
            Y S++   C+AF P + Q
Sbjct  119  YPSAVATVCYAFDPLEDQ  136



>ref|XP_008876428.1| hypothetical protein H310_11503 [Aphanomyces invadans]
 gb|ETV94837.1| hypothetical protein H310_11503 [Aphanomyces invadans]
Length=1349

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 77/151 (51%), Gaps = 13/151 (9%)
 Frame = +2

Query  185  IRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWDSG-SLR  355
            I V V+P+G++   ++ +   ML     + +SS++    Y+  + SPF    WDS  S  
Sbjct  14   ILVYVMPVGNMSPRMYMEGVKMLQASSDIPMSSLTRPGGYSS-ELSPFRSLSWDSSTSFV  72

Query  356  FKFMAGGSPAS------PWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSS  517
            ++F    S AS      P ED  +  + LA+LG+CHCPS+ +L      F      Y S+
Sbjct  73   YRFEDTTSNASSVSTPVPCEDVHAWNRPLAILGLCHCPSTANLRDAYTDFKRVAANYPSA  132

Query  518  LVQRCFAF--CPGDSQLEDDAYKGSNIVLFP  604
            ++Q+ +AF    GD  L DD     ++V+FP
Sbjct  133  ILQKVYAFEHAFGDGTL-DDVSALDDLVMFP  162



>emb|CBN75733.1| OSJNBa0029H02.30 [Ectocarpus siliculosus]
Length=467

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 12/128 (9%)
 Frame = +2

Query  188  RVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISS-FYTEHQKSPFSHQPWDSGSLRFKF  364
            +V ++P+G+IP  ++  Y  +L R  T+ + ++++      Q S   H  W  G   F F
Sbjct  19   QVLLVPLGNIPPDVYAKYCEILRRFSTIPMQNLTAPGDWNRQNSALKHFNWSEGCFNFHF  78

Query  365  MA-----GGSPASPWEDFQSNRKILAVLGICHCPS----SPDLNSVAEQFNVSCKGYSSS  517
            +      GG   S WED+Q+ R++L  +G+ H PS      D   + +QFN    GY   
Sbjct  79   IDQDTTDGG--LSDWEDYQAYRRVLGAIGVVHFPSCEGGRADFKELEKQFNQVVAGYKHV  136

Query  518  LVQRCFAF  541
               R FAF
Sbjct  137  HATRMFAF  144



>emb|CEG76765.1| hypothetical protein RMATCC62417_11620 [Rhizopus microsporus]
Length=930

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/143 (28%), Positives = 70/143 (49%), Gaps = 3/143 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  V I + C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLAVDITSCCRVRVLLVPVSPIKKSSFWRHVELVKKFSLVRLGDVTPDLQKGANAKFSS  60

Query  329  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  499
            Q +  G + F+F+       S  EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGHMHFQFVTKYNRDHSHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYQKFVDML  120

Query  500  KGYSSSLVQRCFAFCPGDSQLED  568
              Y +++  RCFAF P ++Q +D
Sbjct  121  VQYPTAIATRCFAFDPTENQPDD  143



>emb|CDS05824.1| hypothetical protein LRAMOSA08352 [Absidia idahoensis var. thermophila]
Length=1384

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 71/143 (50%), Gaps = 3/143 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  ++I +SC +RV ++P+  I    F  +  ++ +   V L  ++        + FS 
Sbjct  1    MDLAINITSSCRVRVLLVPVPPIKSSTFWKHVELVKKFSVVRLGDVTPDLQNGAGAMFSS  60

Query  329  QPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  499
            Q +  G + F+F    +   +  EDFQ +R+I  V+GI  C      DL+   + F  + 
Sbjct  61   QVFQEGQMHFQFTTTYTRDHAHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGHKHFVDTL  120

Query  500  KGYSSSLVQRCFAFCPGDSQLED  568
              Y +++  RCFAF P ++Q +D
Sbjct  121  HKYPTAIATRCFAFDPTETQPDD  143



>gb|EFA80348.1| histidine kinase DhkG [Polysphondylium pallidum PN500]
Length=1230

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 39/126 (31%), Positives = 63/126 (50%), Gaps = 3/126 (2%)
 Frame = +2

Query  185  IRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSHQPWDSGSLRFKF  364
            I+VA+LPIG I    FR+Y+S++     + LS I+    E +        W  G +   F
Sbjct  13   IKVAILPIGDISTDSFREYSSLIKTLGIIELSGITRDAKESRV--LEKINWVDGHMLLNF  70

Query  365  MAGGSP-ASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAF  541
            ++  +  +S WED    ++I  V+G+  C  S DL +  + F  +   Y S++   C+AF
Sbjct  71   VSPNTAQSSEWEDILIYKRIFGVIGVVDCKRSRDLAATKQLFEEAIGPYRSAVATICYAF  130

Query  542  CPGDSQ  559
             P D Q
Sbjct  131  DPLDEQ  136



>emb|CEG81602.1| hypothetical protein RMATCC62417_15784 [Rhizopus microsporus]
Length=1232

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 43/153 (28%), Positives = 72/153 (47%), Gaps = 10/153 (7%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  V I   C IRV ++P+  I    F+ Y  ++   HT+ L  +    T +    F+ 
Sbjct  1    MDIAVDITCLCRIRVLLVPVFPIKRSTFKKYVQLIQSLHTIRLGDV----TPNLNDTFNS  56

Query  329  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            Q +  G L F+F+    +     +DFQ  R++  V+GI  C    DL+   +QF    + 
Sbjct  57   QVFPEGQLHFEFLTHVANDHVELQDFQPYRRLFGVIGIMDCQEWKDLSEGYDQFMKMAQT  116

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             ++  V RCFAF P    +E+ A     +++ P
Sbjct  117  IAAP-VTRCFAFDP----IENQADNAKGLIMIP  144



>emb|CEI86846.1| hypothetical protein RMCBS344292_01273 [Rhizopus microsporus]
Length=595

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 70/143 (49%), Gaps = 3/143 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  V I + C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLAVDITSCCRVRVLLVPVSPIKKSSFWRHVELVKKFSLVRLGDVTPDLQKGANAKFSS  60

Query  329  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  499
            Q +  G + F+F+       S  EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGHMHFQFVTKYNREHSHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYQKFVDML  120

Query  500  KGYSSSLVQRCFAFCPGDSQLED  568
              Y +++  RCFAF P ++Q +D
Sbjct  121  VQYPTAIATRCFAFDPTENQPDD  143



>ref|XP_006682591.1| hypothetical protein BATDEDRAFT_28213 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76651.1| hypothetical protein BATDEDRAFT_28213 [Batrachochytrium dendrobatidis 
JAM81]
Length=1804

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 75/141 (53%), Gaps = 7/141 (5%)
 Frame = +2

Query  185  IRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSHQPWDSGSLRFKF  364
            I++ V+P+  I    F  Y  +L +  +V L  ++    + + + F++Q +  G + F F
Sbjct  80   IKILVVPVHPIRQDTFNTYLHLLSQFGSVSLKDLTP--PDAKTAKFTNQFYHDGCIHFNF  137

Query  365  MAGGSPA-SPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAF  541
                +   SP E+ Q +R++L V+GI +C  +P+L    ++F    + Y+++L  RCF F
Sbjct  138  ATSHNKEHSPLEEIQLSRQVLGVIGIMNCQQTPNLLDGYKRFQHIVQRYTTTLAYRCFGF  197

Query  542  CPGDSQLEDDAYKGSNIVLFP  604
             P D+Q   D  KG  +V+ P
Sbjct  198  EPLDTQA--DNIKG--LVMIP  214



>emb|CEJ01961.1| hypothetical protein RMCBS344292_15981 [Rhizopus microsporus]
Length=595

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 70/143 (49%), Gaps = 3/143 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  V I + C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLAVDITSCCRVRVLLVPVSPIKKSSFWRHVELVKKFSLVRLGDVTPDLQKGANAKFSS  60

Query  329  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  499
            Q +  G + F+F+       S  EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGHMHFQFVTKYNRDHSHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYQKFVDML  120

Query  500  KGYSSSLVQRCFAFCPGDSQLED  568
              Y +++  RCFAF P ++Q +D
Sbjct  121  VQYPTAIATRCFAFDPTENQPDD  143



>dbj|GAN09915.1| hypercellular protein [Mucor ambiguus]
Length=1369

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/143 (27%), Positives = 70/143 (49%), Gaps = 3/143 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  + I ++C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLALDITSACRVRVLLVPVSPIKKSTFWHHVELVRKFSLVRLGDVTPDLHKGANAKFSS  60

Query  329  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  499
            Q +  G + F+F+          EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGQMHFQFVTKYNRDHCHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYKKFVDML  120

Query  500  KGYSSSLVQRCFAFCPGDSQLED  568
              Y +++  RCFAF P ++Q +D
Sbjct  121  SQYPTAVATRCFAFDPNENQPDD  143



>gb|EPB81036.1| hypothetical protein HMPREF1544_12262 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=1381

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/143 (27%), Positives = 70/143 (49%), Gaps = 3/143 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  + I ++C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLALDITSACRVRVLLVPVSPIKKSTFWHHVELVRKFSLVRLGDVTPDLHKGANAKFSS  60

Query  329  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  499
            Q +  G + F+F+          EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGQMHFQFVTKYNRDHCHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYKKFVDML  120

Query  500  KGYSSSLVQRCFAFCPGDSQLED  568
              Y +++  RCFAF P ++Q +D
Sbjct  121  SQYPTAVATRCFAFDPTENQPDD  143



>emb|CEG65590.1| hypothetical protein RMATCC62417_02344 [Rhizopus microsporus]
Length=1232

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 43/153 (28%), Positives = 72/153 (47%), Gaps = 10/153 (7%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  V I   C IRV ++P+  I    F+ Y  ++   HT+ L  +    T +    F+ 
Sbjct  1    MDIAVDITCLCRIRVLLVPVFPIKRSTFKKYVQLIQSLHTIRLGDV----TPNLNDKFNS  56

Query  329  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            Q +  G L F+F+    +     +DFQ  R++  V+GI  C    DL+   +QF    + 
Sbjct  57   QMFPEGQLHFEFLTHVTNDHVELQDFQPCRRLFGVIGIMDCREWKDLSEGYDQFMKMAQT  116

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             ++  V RCFAF P    +E+ A     +++ P
Sbjct  117  IAAP-VTRCFAFDP----IENQADNAKGLIMIP  144



>emb|CEI98563.1| hypothetical protein RMCBS344292_12669 [Rhizopus microsporus]
Length=1152

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 42/153 (27%), Positives = 72/153 (47%), Gaps = 10/153 (7%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  V I   C IRV ++P+  I    F+ Y  ++   HT+ L  +    T +    F+ 
Sbjct  1    MDIAVDITCLCRIRVLLVPVFPIKRSTFKKYVQLIQSLHTIRLGDV----TPNLNDKFNS  56

Query  329  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  505
            Q +  G L F+F+    +     +DFQ  R++  V+GI  C    DL+   +QF    + 
Sbjct  57   QMFPEGQLHFEFLTHVTNDHVELQDFQPCRRLFGVIGIMDCREWKDLSEGYDQFMKMAQT  116

Query  506  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
             ++  + RCFAF P    +E+ A     +++ P
Sbjct  117  IAAP-ITRCFAFDP----IENQADNAKGLIMIP  144



>ref|XP_002896003.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY53716.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=1398

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 41/125 (33%), Positives = 63/125 (50%), Gaps = 9/125 (7%)
 Frame = +2

Query  191  VAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWD-SGSLRFK  361
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W   GSLRF 
Sbjct  17   VYLVPVGGIPSDLFTSYARLLQTHSELPLRSLTRPGGYAA-ELSPFRGLDWTGKGSLRFH  75

Query  362  FMAGGS--PASPWEDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  526
            F++      +   ED   +R+++  LG+CH PS   S  L +   QF  S + + + L+ 
Sbjct  76   FVSTAEHVESCDGEDVHVSRRVIGALGVCHSPSLTLSGGLQAAHAQFEASVRRFPALLMH  135

Query  527  RCFAF  541
            + FAF
Sbjct  136  KLFAF  140



>emb|CEP12553.1| hypothetical protein [Parasitella parasitica]
Length=1394

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/143 (27%), Positives = 68/143 (48%), Gaps = 3/143 (2%)
 Frame = +2

Query  149  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSH  328
            M+  + I ++C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLALDITSACRVRVLLVPVSPIKKSTFWRHVELVRKFSLVRLGDVTPDLHQGTNAKFSS  60

Query  329  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  499
            Q +  G + F+F+          EDFQ +R+I  V+GI  C      DLN    +F    
Sbjct  61   QAFQEGQMHFQFVTKYNQDHCHLEDFQPHRRIFGVIGIMDCREWKDKDLNEGYRKFVGML  120

Query  500  KGYSSSLVQRCFAFCPGDSQLED  568
              Y ++L  R FAF P ++Q +D
Sbjct  121  GQYPTALATRFFAFDPTENQPDD  143



>emb|CDP20750.1| unnamed protein product [Coffea canephora]
Length=123

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +2

Query  245  SMLVRHHTV*LSSISSFYTEHQKSPFSHQPWD--SGSLRFKFMAGGSPASPWEDF  403
            S+L+  HTV LSSISSF  +H K PF  QPWD  S SLRFKF+  GSP S WEDF
Sbjct  69   SLLLHRHTVSLSSISSFSAQHHKIPFFDQPWDSPSASLRFKFILAGSPLSHWEDF  123



>ref|XP_004345847.1| hypothetical protein ACA1_182040 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR21303.1| hypothetical protein ACA1_182040 [Acanthamoeba castellanii str. 
Neff]
Length=1019

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 52/99 (53%), Gaps = 4/99 (4%)
 Frame = +2

Query  311  KSPFSHQPWDSGSLRFKFM-AGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQF  487
            +S  + + W  G +  +F+ +  +  S WEDFQ +RK L V+GI HC    DL+    +F
Sbjct  3    RSGSTQRWWQGGRVYPRFVDSRTTHRSDWEDFQVHRKTLGVVGIIHCAQWRDLSDAYTEF  62

Query  488  NVSCKGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP  604
                + + +++   CFAF P D Q +   +   N+V+ P
Sbjct  63   ERLRRQHPTAVAVTCFAFEPRDDQPD---FAKDNLVMIP  98



>ref|XP_009845683.1| hypothetical protein H257_18343 [Aphanomyces astaci]
 gb|ETV64826.1| hypothetical protein H257_18343 [Aphanomyces astaci]
Length=1399

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 43/153 (28%), Positives = 77/153 (50%), Gaps = 15/153 (10%)
 Frame = +2

Query  185  IRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSIS--SFYTEHQKSPFSHQPWDSG-SLR  355
            I V V+P+G+IP  ++ +   ML     + +SS++    Y+  + SPF    WDS  S+ 
Sbjct  14   ILVYVMPVGNIPRHMYMEGIRMLQASAVIPMSSLTRPGGYSA-ELSPFRALSWDSTTSIV  72

Query  356  FKF--------MAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYS  511
            ++F         +    ++  ++  +  + L V+G+CHCPS+ DL      F  +   Y 
Sbjct  73   YRFEDTLSQASSSSTLSSASCDEVHAWNRPLGVIGLCHCPSTADLRDAYADFKRAALKYP  132

Query  512  SSLVQRCFAF--CPGDSQLEDDAYKGSNIVLFP  604
            S+++Q+ +AF    G   LE D     ++V+FP
Sbjct  133  SAIIQKVYAFEHAFGAGTLE-DVSALDDLVMFP  164



>gb|EWM27764.1| TRAPP II complex, Trs120 protein [Nannochloropsis gaditana]
Length=176

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 55/99 (56%), Gaps = 7/99 (7%)
 Frame = +2

Query  152  EPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVR-HHTV*LSSISS-FYTEHQKSPFS  325
            EP+ S      +RVAV+P+G +P   FR Y S+L R  H + ++++S     + + SPF 
Sbjct  10   EPN-SFAAHRQLRVAVVPLGGVPGARFRVYLSLLRRSFHELPMANLSKPGSWKKESSPFK  68

Query  326  HQPWDSGSLRFKFMAGGSP----ASPWEDFQSNRKILAV  430
            H  W  G+L  +++    P    +S W+DFQ+ R+  AV
Sbjct  69   HFSWFDGNLLLQYLDRAPPSTSASSEWQDFQAFRRTWAV  107



>gb|EPZ33229.1| TRAPP II complex, Trs120 domain-containing protein [Rozella allomycis 
CSF55]
Length=988

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +2

Query  395  EDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAFCPGDSQLEDDA  574
            EDFQ  R+I  ++GI HCP   DL    E+FN     +   + +RCFAF P     ED  
Sbjct  43   EDFQIYRQISGIIGIVHCPQYDDLGEAHERFNKITSKFPQIINKRCFAFEP----REDQP  98

Query  575  YKGSNIVLFP  604
                N+++ P
Sbjct  99   DNSKNVIMIP  108



>ref|XP_007321257.1| hypothetical protein SERLADRAFT_451500 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO21471.1| hypothetical protein SERLADRAFT_451500 [Serpula lacrymans var. 
lacrymans S7.9]
Length=1349

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (46%), Gaps = 10/145 (7%)
 Frame = +2

Query  179  CMIRVAVLPIGSIPIPLFRDYTSMLVRHHTV*LSSISSFYTEHQKSPFSHQPWDSGSLRF  358
             ++R+ +LP+G I  P F  Y + +     + L  I +  T+  ++ F   P  +G L  
Sbjct  10   ALVRILLLPVGGISGPTFEKYAAEIRNFDNIRLGDIPA-ETKEDRARFMPNPLSTGYLHL  68

Query  359  KFMAGGSP--ASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQF-----NVSCKGYSSS  517
             F +   P   SP   F+ +   L V+GI  C  +  LNS+ E+F      +S  G +  
Sbjct  69   AFPSHPPPFTHSPLSLFRPSHFSLGVVGIAVCSQTEPLNSILEKFEHSLGEISSSGSTFP  128

Query  518  LVQRCFAFCPGDSQLEDDAYKGSNI  592
            L + CF F   DS+    +  G NI
Sbjct  129  LAKICFVF--EDSEETAGSNLGENI  151



>ref|NP_001169811.1| uncharacterized protein LOC100383703 [Zea mays]
 gb|ACN34971.1| unknown [Zea mays]
Length=118

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -1

Query  438  MPRTARILRLDWKSSQGLAGEPPAMNLNRRLPESQGW  328
            MP TA  LR DWKSSQG   +PP+ NL RR P SQGW
Sbjct  1    MPITASTLREDWKSSQGEGTQPPSTNLRRRHPVSQGW  37



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800