BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF023P14

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798662.1|  PREDICTED: WPP domain-interacting tail-ancho...    106   1e-22   Nicotiana sylvestris
ref|XP_006365649.1|  PREDICTED: WPP domain-interacting tail-ancho...    105   2e-22   Solanum tuberosum [potatoes]
ref|XP_009798663.1|  PREDICTED: WPP domain-interacting tail-ancho...    105   2e-22   Nicotiana sylvestris
emb|CAN67491.1|  hypothetical protein VITISV_035977                     104   6e-22   Vitis vinifera
emb|CBI16905.3|  unnamed protein product                                103   7e-22   Vitis vinifera
ref|XP_010660542.1|  PREDICTED: WPP domain-interacting tail-ancho...    103   7e-22   Vitis vinifera
emb|CDP02362.1|  unnamed protein product                                101   4e-21   Coffea canephora [robusta coffee]
ref|XP_009596766.1|  PREDICTED: WPP domain-interacting tail-ancho...  97.8    1e-19   Nicotiana tomentosiformis
ref|XP_004233399.1|  PREDICTED: WPP domain-interacting tail-ancho...  97.1    2e-19   Solanum lycopersicum
gb|EYU44256.1|  hypothetical protein MIMGU_mgv1a004254mg              95.9    3e-19   Erythranthe guttata [common monkey flower]
ref|XP_011099070.1|  PREDICTED: WPP domain-interacting tail-ancho...  88.6    1e-16   Sesamum indicum [beniseed]
ref|XP_010100884.1|  hypothetical protein L484_009654                 88.6    1e-16   Morus notabilis
gb|KHG15874.1|  WPP domain-interacting tail-anchored 1 -like protein  87.4    3e-16   Gossypium arboreum [tree cotton]
gb|KJB48233.1|  hypothetical protein B456_008G059400                  86.7    5e-16   Gossypium raimondii
gb|KJB48234.1|  hypothetical protein B456_008G059400                  86.7    5e-16   Gossypium raimondii
ref|XP_009373745.1|  PREDICTED: WPP domain-interacting tail-ancho...  85.5    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_008342057.1|  PREDICTED: WPP domain-interacting tail-ancho...  83.2    7e-15   
ref|XP_008368479.1|  PREDICTED: WPP domain-interacting tail-ancho...  82.8    1e-14   
ref|XP_008362231.1|  PREDICTED: WPP domain-interacting tail-ancho...  82.8    1e-14   
ref|XP_007214993.1|  hypothetical protein PRUPE_ppa002236mg           78.2    4e-13   Prunus persica
ref|XP_008230323.1|  PREDICTED: WPP domain-interacting tail-ancho...  77.8    5e-13   Prunus mume [ume]
ref|XP_010273216.1|  PREDICTED: WPP domain-interacting tail-ancho...  77.8    6e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010273214.1|  PREDICTED: WPP domain-interacting tail-ancho...  77.4    7e-13   Nelumbo nucifera [Indian lotus]
ref|XP_008455570.1|  PREDICTED: WPP domain-interacting tail-ancho...  76.6    1e-12   Cucumis melo [Oriental melon]
ref|XP_008455569.1|  PREDICTED: WPP domain-interacting tail-ancho...  76.6    1e-12   Cucumis melo [Oriental melon]
ref|XP_008455573.1|  PREDICTED: WPP domain-interacting tail-ancho...  76.6    1e-12   
ref|XP_008455568.1|  PREDICTED: WPP domain-interacting tail-ancho...  76.6    1e-12   Cucumis melo [Oriental melon]
ref|XP_008455572.1|  PREDICTED: WPP domain-interacting tail-ancho...  76.6    1e-12   Cucumis melo [Oriental melon]
ref|XP_008455571.1|  PREDICTED: WPP domain-interacting tail-ancho...  76.6    1e-12   Cucumis melo [Oriental melon]
ref|XP_010247050.1|  PREDICTED: WPP domain-interacting tail-ancho...  75.1    4e-12   
ref|XP_010247049.1|  PREDICTED: WPP domain-interacting tail-ancho...  74.7    4e-12   
ref|XP_010247051.1|  PREDICTED: WPP domain-interacting tail-ancho...  74.7    5e-12   
gb|KGN53761.1|  hypothetical protein Csa_4G123340                     73.2    1e-11   Cucumis sativus [cucumbers]
gb|KDP24315.1|  hypothetical protein JCGZ_25611                       72.8    2e-11   Jatropha curcas
ref|XP_007032932.1|  WPP domain-interacting protein 1, putative i...  71.6    6e-11   Theobroma cacao [chocolate]
ref|XP_007032931.1|  WPP domain-interacting protein 1, putative i...  71.6    6e-11   
ref|XP_006482462.1|  PREDICTED: WPP domain-interacting tail-ancho...  70.9    8e-11   Citrus sinensis [apfelsine]
ref|XP_002533487.1|  DNA double-strand break repair rad50 ATPase,...  70.5    1e-10   Ricinus communis
ref|XP_010424056.1|  PREDICTED: WPP domain-interacting tail-ancho...  70.1    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004304181.1|  PREDICTED: WPP domain-interacting tail-ancho...  69.7    2e-10   Fragaria vesca subsp. vesca
emb|CBI27417.3|  unnamed protein product                              69.7    2e-10   Vitis vinifera
ref|XP_010654218.1|  PREDICTED: WPP domain-interacting tail-ancho...  69.3    3e-10   Vitis vinifera
ref|XP_006399640.1|  hypothetical protein EUTSA_v10012837mg           68.9    4e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010528442.1|  PREDICTED: WPP domain-interacting tail-ancho...  67.8    8e-10   Tarenaya hassleriana [spider flower]
ref|XP_010528444.1|  PREDICTED: WPP domain-interacting tail-ancho...  67.8    8e-10   Tarenaya hassleriana [spider flower]
gb|KDO72336.1|  hypothetical protein CISIN_1g007114mg                 67.8    8e-10   Citrus sinensis [apfelsine]
ref|XP_010694439.1|  PREDICTED: WPP domain-interacting tail-ancho...  67.0    1e-09   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN75587.1|  hypothetical protein VITISV_040555                   67.0    2e-09   Vitis vinifera
ref|XP_010694440.1|  PREDICTED: WPP domain-interacting tail-ancho...  66.6    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006287169.1|  hypothetical protein CARUB_v10000340mg           66.6    2e-09   Capsella rubella
emb|CAB96674.1|  putative protein                                     66.2    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287168.1|  hypothetical protein CARUB_v10000340mg           66.2    3e-09   Capsella rubella
gb|AAM96967.1|  putative protein                                      66.2    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196700.2|  WPP domain-interacting tail-anchored protein 1      66.2    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491870.1|  PREDICTED: WPP domain-interacting tail-ancho...  65.5    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010491871.1|  PREDICTED: WPP domain-interacting tail-ancho...  65.1    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010553942.1|  PREDICTED: WPP domain-interacting tail-ancho...  65.1    6e-09   Tarenaya hassleriana [spider flower]
ref|XP_010553941.1|  PREDICTED: WPP domain-interacting tail-ancho...  65.1    7e-09   Tarenaya hassleriana [spider flower]
ref|XP_009355657.1|  PREDICTED: WPP domain-interacting tail-ancho...  65.1    7e-09   Pyrus x bretschneideri [bai li]
ref|XP_009355671.1|  PREDICTED: WPP domain-interacting tail-ancho...  64.7    9e-09   Pyrus x bretschneideri [bai li]
ref|XP_008352936.1|  PREDICTED: WPP domain-interacting tail-ancho...  64.3    1e-08   
ref|XP_008339737.1|  PREDICTED: WPP domain-interacting tail-ancho...  64.3    1e-08   
ref|XP_008352937.1|  PREDICTED: WPP domain-interacting tail-ancho...  64.3    1e-08   
ref|XP_010453184.1|  PREDICTED: WPP domain-interacting tail-ancho...  64.3    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008339738.1|  PREDICTED: WPP domain-interacting tail-ancho...  64.3    1e-08   
ref|XP_010942237.1|  PREDICTED: WPP domain-interacting tail-ancho...  63.9    2e-08   Elaeis guineensis
ref|XP_006430992.1|  hypothetical protein CICLE_v10011306mg           63.5    2e-08   Citrus clementina [clementine]
gb|EPS71176.1|  hypothetical protein M569_03583                       62.0    2e-08   Genlisea aurea
ref|XP_010091658.1|  hypothetical protein L484_026512                 63.2    3e-08   
ref|XP_008797571.1|  PREDICTED: WPP domain-interacting tail-ancho...  62.8    3e-08   
ref|XP_009356475.1|  PREDICTED: WPP domain-interacting tail-ancho...  60.8    1e-07   Pyrus x bretschneideri [bai li]
gb|KDP31424.1|  hypothetical protein JCGZ_11800                       60.5    2e-07   Jatropha curcas
ref|XP_009356477.1|  PREDICTED: WPP domain-interacting tail-ancho...  60.5    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_008243770.1|  PREDICTED: WPP domain-interacting tail-ancho...  60.5    2e-07   Prunus mume [ume]
gb|KCW51982.1|  hypothetical protein EUGRSUZ_J01428                   57.4    2e-07   Eucalyptus grandis [rose gum]
ref|XP_008389358.1|  PREDICTED: WPP domain-interacting tail-ancho...  60.5    2e-07   
ref|XP_008243772.1|  PREDICTED: WPP domain-interacting tail-ancho...  60.1    2e-07   Prunus mume [ume]
ref|XP_008389359.1|  PREDICTED: WPP domain-interacting tail-ancho...  60.1    3e-07   
ref|XP_007225684.1|  hypothetical protein PRUPE_ppa002890mg           59.7    3e-07   Prunus persica
ref|XP_009378298.1|  PREDICTED: WPP domain-interacting tail-ancho...  59.3    5e-07   Pyrus x bretschneideri [bai li]
ref|XP_006373525.1|  hypothetical protein POPTR_0017s14520g           57.8    1e-06   
ref|XP_004297183.2|  PREDICTED: WPP domain-interacting tail-ancho...  57.8    2e-06   Fragaria vesca subsp. vesca
ref|XP_008365431.1|  PREDICTED: WPP domain-interacting tail-ancho...  57.4    2e-06   
ref|XP_007151430.1|  hypothetical protein PHAVU_004G045500g           57.4    2e-06   Phaseolus vulgaris [French bean]
ref|XP_011462968.1|  PREDICTED: WPP domain-interacting tail-ancho...  57.4    2e-06   Fragaria vesca subsp. vesca
ref|XP_011021128.1|  PREDICTED: WPP domain-interacting tail-ancho...  57.0    2e-06   Populus euphratica
ref|XP_002514564.1|  conserved hypothetical protein                   56.6    4e-06   Ricinus communis
ref|XP_010915281.1|  PREDICTED: WPP domain-interacting tail-ancho...  55.5    1e-05   Elaeis guineensis
ref|XP_010915283.1|  PREDICTED: WPP domain-interacting tail-ancho...  55.1    1e-05   
ref|XP_010915284.1|  PREDICTED: WPP domain-interacting tail-ancho...  55.1    1e-05   
emb|CDX97101.1|  BnaC09g45240D                                        54.3    2e-05   
ref|XP_004137264.1|  PREDICTED: WPP domain-interacting tail-ancho...  53.9    3e-05   
ref|XP_009611110.1|  PREDICTED: WPP domain-interacting tail-ancho...  53.1    6e-05   Nicotiana tomentosiformis
ref|XP_006844124.1|  hypothetical protein AMTR_s00006p00257300        52.4    1e-04   
ref|XP_008782515.1|  PREDICTED: WPP domain-interacting tail-ancho...  50.8    3e-04   Phoenix dactylifera
ref|XP_004239005.1|  PREDICTED: WPP domain-interacting tail-ancho...  50.8    3e-04   Solanum lycopersicum
ref|XP_008782516.1|  PREDICTED: WPP domain-interacting tail-ancho...  50.8    3e-04   Phoenix dactylifera
gb|KDO70219.1|  hypothetical protein CISIN_1g005569mg                 50.8    4e-04   Citrus sinensis [apfelsine]
gb|KDO70218.1|  hypothetical protein CISIN_1g005569mg                 50.4    4e-04   Citrus sinensis [apfelsine]
gb|KDO70216.1|  hypothetical protein CISIN_1g005569mg                 50.4    4e-04   Citrus sinensis [apfelsine]
ref|XP_006484283.1|  PREDICTED: WPP domain-interacting tail-ancho...  50.4    4e-04   Citrus sinensis [apfelsine]
ref|XP_006484282.1|  PREDICTED: WPP domain-interacting tail-ancho...  50.4    5e-04   
ref|XP_006484284.1|  PREDICTED: WPP domain-interacting tail-ancho...  50.4    5e-04   Citrus sinensis [apfelsine]
gb|KDO70227.1|  hypothetical protein CISIN_1g005569mg                 50.1    5e-04   Citrus sinensis [apfelsine]
gb|KDO70220.1|  hypothetical protein CISIN_1g005569mg                 50.1    5e-04   Citrus sinensis [apfelsine]
gb|KDO70226.1|  hypothetical protein CISIN_1g005569mg                 50.1    6e-04   Citrus sinensis [apfelsine]
gb|KDO70217.1|  hypothetical protein CISIN_1g005569mg                 50.1    6e-04   Citrus sinensis [apfelsine]
ref|XP_009800081.1|  PREDICTED: WPP domain-interacting tail-ancho...  49.7    7e-04   Nicotiana sylvestris



>ref|XP_009798662.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 isoform 
X1 [Nicotiana sylvestris]
Length=666

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 115/164 (70%), Gaps = 8/164 (5%)
 Frame = +1

Query  163  VCSSKTIMDANSGKDEHCS------GELEEESKNVDSLDVIVSSGETMQELGSIEEEVIA  324
            V  S  +MDA++  +   S       E+E ES  VDSL+V+ SSG+ MQE+ S   E++ 
Sbjct  3    VQKSGLLMDADTENNGSASIEGVNVNEVEVESNTVDSLEVLSSSGDVMQEVES--GEMLT  60

Query  325  KIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvllds  504
            ++E++LA  SEKL NL +L MHV TRE++FEAF +EKE +SND V+KA+EF+LLS +LDS
Sbjct  61   RLELELACFSEKLVNLDILVMHVATRESDFEAFSSEKEHTSNDIVEKAIEFDLLSGVLDS  120

Query  505  evrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            EVREL  LLSS+ MEI   R+II SC    E + +IEEKL+D+E
Sbjct  121  EVRELGGLLSSVAMEIDNVRKIISSCGRVDETFVLIEEKLHDSE  164



>ref|XP_006365649.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Solanum tuberosum]
Length=684

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  178  TIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSE  357
            T+ +A++      + E+E ES  VDSL+V+ SSG  MQE+GS+ E ++ ++E+DLA  SE
Sbjct  5    TVNNASTSTKGVNTNEVEAESNTVDSLEVLSSSGNVMQEVGSVGE-ILTRLELDLACVSE  63

Query  358  KLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllss  537
            KL NL +  MHVETRE++FEAF +EKE +SND V+KA+EF+LLS +LDSEV EL  LLSS
Sbjct  64   KLVNLDLFVMHVETRESDFEAFASEKEGTSNDIVEKAIEFDLLSGVLDSEVTELGGLLSS  123

Query  538  lQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            + +EI   R++I S     E + +IEEKL+D+E
Sbjct  124  VAIEIDNVRKVISSRGYVDEAFILIEEKLHDSE  156



>ref|XP_009798663.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009798664.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 isoform 
X2 [Nicotiana sylvestris]
Length=657

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 105/139 (76%), Gaps = 2/139 (1%)
 Frame = +1

Query  220  GELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVET  399
             E+E ES  VDSL+V+ SSG+ MQE+ S   E++ ++E++LA  SEKL NL +L MHV T
Sbjct  19   NEVEVESNTVDSLEVLSSSGDVMQEVES--GEMLTRLELELACFSEKLVNLDILVMHVAT  76

Query  400  RENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPS  579
            RE++FEAF +EKE +SND V+KA+EF+LLS +LDSEVREL  LLSS+ MEI   R+II S
Sbjct  77   RESDFEAFSSEKEHTSNDIVEKAIEFDLLSGVLDSEVRELGGLLSSVAMEIDNVRKIISS  136

Query  580  CEDAGELYGVIEEKLNDAE  636
            C    E + +IEEKL+D+E
Sbjct  137  CGRVDETFVLIEEKLHDSE  155



>emb|CAN67491.1| hypothetical protein VITISV_035977 [Vitis vinifera]
Length=737

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = +1

Query  172  SKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGS  351
            ++T++DA +  D+  + + E E  N+D  + I S GE M E+G+  E V+ ++E+DLA S
Sbjct  3    AETVLDATASVDDINTSDPEAEXNNMDLHEGISSYGEVMLEVGNATE-VLKRVELDLACS  61

Query  352  SEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvll  531
            SEKL NL +L MHV TRE++FEAF +E+E   +DSVQKA+EF+LLS +LDSEVRE+   +
Sbjct  62   SEKLFNLSILTMHVATRESDFEAFASEEEHVLDDSVQKALEFDLLSGILDSEVREVDNFM  121

Query  532  sslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            + LQ ++ ++ +I+ SCE+ G  +  +EEKL+D++
Sbjct  122  TXLQKDVAHTHEILSSCENLGGAFMEMEEKLHDSD  156



>emb|CBI16905.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = +1

Query  172  SKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGS  351
            ++T++DA +  D+  + + E E  N+D  + I S GE M E+G+  E V+ ++E+DLA S
Sbjct  3    AETVLDATASVDDINTSDPEAEENNMDLHEGISSYGEVMLEVGNATE-VLKRVELDLACS  61

Query  352  SEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvll  531
            SEKL NL +L MHV TRE++FEAF +E+E   +DSVQKA+EF+LLS +LDSEVRE+   +
Sbjct  62   SEKLFNLSILTMHVATRESDFEAFASEEEHVLDDSVQKALEFDLLSGILDSEVREVDNFM  121

Query  532  sslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            ++LQ ++ ++ +I+ SCE+ G  +  +EEKL+D++
Sbjct  122  TTLQKDVAHTHEILSSCENLGGAFMEMEEKLHDSD  156



>ref|XP_010660542.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Vitis 
vinifera]
 ref|XP_010660543.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Vitis 
vinifera]
 ref|XP_010660544.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Vitis 
vinifera]
 ref|XP_010660545.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Vitis 
vinifera]
 ref|XP_010660546.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Vitis 
vinifera]
Length=714

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = +1

Query  172  SKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGS  351
            ++T++DA +  D+  + + E E  N+D  + I S GE M E+G+  E V+ ++E+DLA S
Sbjct  3    AETVLDATASVDDINTSDPEAEENNMDLHEGISSYGEVMLEVGNATE-VLKRVELDLACS  61

Query  352  SEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvll  531
            SEKL NL +L MHV TRE++FEAF +E+E   +DSVQKA+EF+LLS +LDSEVRE+   +
Sbjct  62   SEKLFNLSILTMHVATRESDFEAFASEEEHVLDDSVQKALEFDLLSGILDSEVREVDNFM  121

Query  532  sslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            ++LQ ++ ++ +I+ SCE+ G  +  +EEKL+D++
Sbjct  122  TTLQKDVAHTHEILSSCENLGGAFMEMEEKLHDSD  156



>emb|CDP02362.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = +1

Query  181  IMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEK  360
            +++  S  +E  +GELE ES N+DSL+V+ SSG+ M+EL ++ E ++ K+E+DLA  SEK
Sbjct  5    VLNTASVSEEVHAGELEVESNNIDSLEVMSSSGDIMRELENVGE-LLTKVELDLACFSEK  63

Query  361  LANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllssl  540
            L NL +L MHV  RE++FEAFV+EKE +  DS +KA+EF+LLS +L+SEV++L   + +L
Sbjct  64   LLNLDILVMHVGARESDFEAFVSEKESTIGDSAKKALEFDLLSGILESEVKDLDNFIVTL  123

Query  541  QMEIGYSRQIIPSCEDAGELYGVIEEKLND  630
            ++EI  +R++I S +  GE +  ++EKL D
Sbjct  124  RVEIDNAREMIISSKHYGEAFEYMQEKLMD  153



>ref|XP_009596766.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Nicotiana 
tomentosiformis]
 ref|XP_009596767.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Nicotiana 
tomentosiformis]
Length=657

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 102/139 (73%), Gaps = 2/139 (1%)
 Frame = +1

Query  220  GELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVET  399
             E+E ES  VDSL+V+ SSG+ MQE+ S   E++ ++E++LA  SEKL NL +L MHV T
Sbjct  19   NEVEVESNTVDSLEVLSSSGDVMQEVES--GEILTRLELELACFSEKLVNLDILVMHVAT  76

Query  400  RENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPS  579
            RE++FEAF +EKE +SND V+KA+EF+LLS +LDSEV+EL  LLSS+ MEI   R+II S
Sbjct  77   RESDFEAFASEKEHTSNDIVEKAIEFDLLSGVLDSEVKELGGLLSSVAMEIDNVRKIISS  136

Query  580  CEDAGELYGVIEEKLNDAE  636
                 E   +IEEKL+D E
Sbjct  137  RGCVDETSVLIEEKLHDCE  155



>ref|XP_004233399.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Solanum 
lycopersicum]
Length=682

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 2/141 (1%)
 Frame = +1

Query  217  SGELEEESKNVDSLDVIVSSG-ETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHV  393
            + E+E ES  VDSL+V+ SSG   M E+G I E ++ ++E+DLA  SEKL NL +  MHV
Sbjct  18   TNEVEVESNTVDSLEVLSSSGGNVMHEVGRIGE-ILTRLELDLACISEKLVNLDLFVMHV  76

Query  394  ETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQII  573
            ETRE++FEAF +EKE +SND V+KA+EF+LLS +LDSEV ELS LLSS+  EI   R++I
Sbjct  77   ETRESDFEAFASEKEGTSNDIVEKAIEFDLLSGVLDSEVTELSGLLSSVATEIDNVRKVI  136

Query  574  PSCEDAGELYGVIEEKLNDAE  636
             S   A E + +IEEKL D+E
Sbjct  137  SSRGYADEAFILIEEKLYDSE  157



>gb|EYU44256.1| hypothetical protein MIMGU_mgv1a004254mg [Erythranthe guttata]
Length=537

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 101/155 (65%), Gaps = 1/155 (1%)
 Frame = +1

Query  172  SKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGS  351
            S  I D +S  +   SGE E ES   DSL+V+ S G T++EL SI E ++ ++E+DLA S
Sbjct  3    SDNIQDRSSSVENASSGEAEAESNYNDSLEVVSSGGATIRELDSIAE-MLTRVELDLACS  61

Query  352  SEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvll  531
            SEKL NL +L MHV +REN+FEAF  E E +S+   +KA+EF+LL   LDSEV EL  LL
Sbjct  62   SEKLVNLDILVMHVASRENDFEAFALEDEHTSDGRAEKALEFDLLYGFLDSEVTELESLL  121

Query  532  sslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            S+LQ EI  S+  I S +  G+    IEEKL D E
Sbjct  122  SALQAEIVRSKGSISSFKQLGDGLKEIEEKLQDCE  156



>ref|XP_011099070.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Sesamum 
indicum]
Length=660

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 101/154 (66%), Gaps = 6/154 (4%)
 Frame = +1

Query  172  SKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGS  351
            S +I D  +  +   S E+E ES N+DSL+ + S G+  +EL S  E V+ ++E+DLA S
Sbjct  3    SDSIQDRPASIENVSSNEVEAESNNIDSLEAVSSGGDATRELESAAE-VLTRVELDLACS  61

Query  352  SEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvll  531
            SEKL NL +L MHV +REN+FEAF +E+E +S   V+KA+EF+LL   LDSEVREL   L
Sbjct  62   SEKLVNLEILVMHVASRENDFEAFASEEEHNSEGPVEKALEFDLLYGFLDSEVRELESFL  121

Query  532  sslQMEI-GYSRQIIPSCEDAGELYGVIEEKLND  630
            S+LQ EI G+      S E  G+ +  +EEKL D
Sbjct  122  SALQTEIAGFQ----ASFEQLGDSFKEMEEKLQD  151



>ref|XP_010100884.1| hypothetical protein L484_009654 [Morus notabilis]
 gb|EXB85808.1| hypothetical protein L484_009654 [Morus notabilis]
Length=624

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = +1

Query  259  DVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKE  438
            D I S+ E + EL +   E++ ++E+DLA  SEK+ NL VL MHV TRENEFEAF  EKE
Sbjct  32   DRISSNREVLGELRN-SGEILTRLELDLACVSEKIVNLNVLMMHVATRENEFEAFALEKE  90

Query  439  QSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEE  618
             + +DS++KA+EF+LLS +LDSEVR L   ++ LQ EI  +R+++ SC   GE  G +EE
Sbjct  91   HTLDDSLEKALEFDLLSGVLDSEVRGLDGFMAVLQSEIVNARELVSSCLHEGETLGEMEE  150

Query  619  KLNDAE  636
            KL D+E
Sbjct  151  KLCDSE  156



>gb|KHG15874.1| WPP domain-interacting tail-anchored 1 -like protein [Gossypium 
arboreum]
Length=740

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLK  384
            DE  S ELE  S   D LD I S GE  +E G   E ++ ++E+DLA SSEKL NL VL 
Sbjct  14   DEFNSMELEAGSSRADILDGISSGGEVNEEFGRANE-ILTRVELDLACSSEKLVNLSVLT  72

Query  385  MHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSR  564
            MH+ TRE +FE+F++EK+    +S++KA+EF+LLS +LDSEV+EL+  +  L+  I  SR
Sbjct  73   MHLATRETDFESFMSEKDNMQVESMEKALEFDLLSGILDSEVKELNKFMEHLETYIISSR  132

Query  565  QIIPSCEDAGELYGVIEEKLNDAE  636
            + I S +  GE +  +EEKL D+E
Sbjct  133  EAISSFKHLGETFFKMEEKLLDSE  156



>gb|KJB48233.1| hypothetical protein B456_008G059400 [Gossypium raimondii]
Length=619

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLK  384
            DE  S ELE  S   D LD I S GE  +E G   E ++ ++E+DLA SSEKL NL VL 
Sbjct  14   DEFNSMELEAGSSRADILDGISSGGEVNEEFGRANE-ILTRVELDLACSSEKLVNLSVLT  72

Query  385  MHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSR  564
            MH+ TRE +FE+F++EK+    +S++KA+EF+LLS +LDSEV+EL+  +  L+  I  SR
Sbjct  73   MHLATRETDFESFMSEKDNMLVESMEKALEFDLLSGILDSEVKELNKFMEHLETYIISSR  132

Query  565  QIIPSCEDAGELYGVIEEKLNDAE  636
            + I S +  GE +  +EEKL D+E
Sbjct  133  EAISSFKHLGETFFKMEEKLLDSE  156



>gb|KJB48234.1| hypothetical protein B456_008G059400 [Gossypium raimondii]
Length=678

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLK  384
            DE  S ELE  S   D LD I S GE  +E G   E ++ ++E+DLA SSEKL NL VL 
Sbjct  14   DEFNSMELEAGSSRADILDGISSGGEVNEEFGRANE-ILTRVELDLACSSEKLVNLSVLT  72

Query  385  MHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSR  564
            MH+ TRE +FE+F++EK+    +S++KA+EF+LLS +LDSEV+EL+  +  L+  I  SR
Sbjct  73   MHLATRETDFESFMSEKDNMLVESMEKALEFDLLSGILDSEVKELNKFMEHLETYIISSR  132

Query  565  QIIPSCEDAGELYGVIEEKLNDAE  636
            + I S +  GE +  +EEKL D+E
Sbjct  133  EAISSFKHLGETFFKMEEKLLDSE  156



>ref|XP_009373745.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Pyrus x bretschneideri]
Length=693

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 99/157 (63%), Gaps = 7/157 (4%)
 Frame = +1

Query  184  MDANSGKDEHCS------GELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLA  345
            MD ++G +   S       +LE ES  V +L  + S G  + EL  + E V+ ++E+DLA
Sbjct  1    MDYDAGHEASVSVNDVNIDDLEVESNKVSNLGSVSSDGVVIGELRHLGE-VLTRVELDLA  59

Query  346  GSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsv  525
             +SEKL NL VL MHV T+E+EFEAF + KEQ+S   ++KA+E  L S +LDSE+ EL  
Sbjct  60   CASEKLVNLNVLMMHVATKESEFEAFASAKEQTSAYYLEKALELTLSSGILDSELSELDK  119

Query  526  llsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            L++ LQ EI  ++ I+ S    GE   VIEEKL+D+E
Sbjct  120  LMAVLQTEITSAQGILSSYTYLGETVAVIEEKLHDSE  156



>ref|XP_008342057.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Malus domestica]
Length=563

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  223  ELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETR  402
            +LE ES  V +L  + S G  + EL  + E V+ ++E+DLA +SEKL NL VL MHV T+
Sbjct  20   DLEVESNKVSNLGSVSSDGVVIGELRHLGE-VLTRVELDLACASEKLVNLNVLMMHVATK  78

Query  403  ENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSC  582
            E+EFEAF + KEQ+S   ++KA+E  LLS +LDSE+ EL  L++ LQ EI  ++ I+ S 
Sbjct  79   ESEFEAFASAKEQTSAYYLEKALELTLLSGILDSELSELDKLMAILQTEITSAQGILSSY  138

Query  583  EDAGELYGVIEEKLNDAE  636
               GE   VIEEKL+D+E
Sbjct  139  XYLGETVVVIEEKLHDSE  156



>ref|XP_008368479.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Malus domestica]
Length=693

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  223  ELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETR  402
            +LE ES  V +L  + S G  + EL  + E V+ ++E+DLA +SEKL NL VL MHV T+
Sbjct  20   DLEVESNKVSNLGSVSSDGVVIGELRHLGE-VLTRVELDLACASEKLVNLNVLMMHVATK  78

Query  403  ENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSC  582
            E+EFEAF + KEQ+S   ++KA+E  LLS +LDSE+ EL  L++ LQ EI  ++ I+ S 
Sbjct  79   ESEFEAFASAKEQTSAYYLEKALELTLLSGILDSELSELDKLMAILQTEITSAQGILSSY  138

Query  583  EDAGELYGVIEEKLNDAE  636
               GE   VIEEKL+D+E
Sbjct  139  XYLGETVVVIEEKLHDSE  156



>ref|XP_008362231.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Malus domestica]
Length=693

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  223  ELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETR  402
            +LE ES  V +L  + S G  + EL  + E V+ ++E+DLA +SEKL NL VL MHV T+
Sbjct  20   DLEVESNKVSNLGSVSSDGVVIGELRHLGE-VLTRVELDLACASEKLVNLNVLMMHVATK  78

Query  403  ENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSC  582
            E+EFEAF + KEQ+S   ++KA+E  LLS +LDSE+ EL  L++ LQ EI  ++ I+ S 
Sbjct  79   ESEFEAFASAKEQTSAYYLEKALELTLLSGILDSELSELDKLMAILQTEITSAQGILSSY  138

Query  583  EDAGELYGVIEEKLNDAE  636
               GE   VIEEKL+D+E
Sbjct  139  XYLGETVVVIEEKLHDSE  156



>ref|XP_007214993.1| hypothetical protein PRUPE_ppa002236mg [Prunus persica]
 gb|EMJ16192.1| hypothetical protein PRUPE_ppa002236mg [Prunus persica]
Length=697

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = +1

Query  229  EEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETREN  408
            E +S  V +L+ + S G  + EL S+ E V  ++E+DLA +SEKL NL VL MHV T+E+
Sbjct  22   EVDSSKVGNLESVSSDGVIVGELRSVGE-VFTRVELDLACASEKLVNLNVLMMHVATKES  80

Query  409  EFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCED  588
            + EA  +++EQ+S D V+KAMEF LLS +LDSEV EL  L++ LQ EI  ++ ++ S   
Sbjct  81   DLEALASKEEQTSVDFVEKAMEFVLLSGILDSEVSELDKLMAILQAEITNAQGLLSSYTC  140

Query  589  AGELYGVIEEKLNDAE  636
             GE + V+E+KL D+E
Sbjct  141  LGETFVVVEDKLCDSE  156



>ref|XP_008230323.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Prunus 
mume]
Length=697

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = +1

Query  229  EEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETREN  408
            E +S  V +L+ + S G  + EL S+ E V  ++E+DLA +SEKL NL VL MHV T+E+
Sbjct  22   EVDSSKVGNLESVSSDGVIVGELRSVGE-VFTRVELDLACASEKLVNLNVLMMHVATKES  80

Query  409  EFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCED  588
            + EA  +++EQ+S DSV+ AMEF LLS +LDSEV EL  L++ LQ EI  ++ ++ S   
Sbjct  81   DLEALSSKEEQTSVDSVENAMEFVLLSGILDSEVSELDKLMAILQAEITNAQGLLSSYTC  140

Query  589  AGELYGVIEEKLNDAE  636
             GE + V+E+KL D+E
Sbjct  141  LGETFVVVEDKLCDSE  156



>ref|XP_010273216.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X2 [Nelumbo nucifera]
Length=731

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsv  492
            E++ ++E+DLA SSEKL NL +L MHV  RE +FEAF  E +    DS +KA+EF LLS 
Sbjct  51   EILTRVELDLAYSSEKLVNLDMLLMHVAAREGDFEAFSVENDDIEADSAKKALEFHLLSG  110

Query  493  lldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            +LDSEVREL   + SLQ+EI  +R+ I SCE  GE +  +E KL+D+E
Sbjct  111  ILDSEVRELDGFMDSLQLEIVDARRRISSCEHPGEFFLEMEAKLHDSE  158



>ref|XP_010273214.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Nelumbo nucifera]
Length=736

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsv  492
            E++ ++E+DLA SSEKL NL +L MHV  RE +FEAF  E +    DS +KA+EF LLS 
Sbjct  51   EILTRVELDLAYSSEKLVNLDMLLMHVAAREGDFEAFSVENDDIEADSAKKALEFHLLSG  110

Query  493  lldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            +LDSEVREL   + SLQ+EI  +R+ I SCE  GE +  +E KL+D+E
Sbjct  111  ILDSEVRELDGFMDSLQLEIVDARRRISSCEHPGEFFLEMEAKLHDSE  158



>ref|XP_008455570.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X3 [Cucumis melo]
Length=647

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsv  492
            EVI ++E+D+A +SEKL NL VL MH+ TRE+EFEAF  E +   +DSV++A E +LL+ 
Sbjct  41   EVITRLELDVARASEKLVNLNVLMMHIATRESEFEAFAFENDHMFDDSVKRASEIDLLAG  100

Query  493  lldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
             LDSE+  +   L+ +Q +I ++ ++IP C+ + E    +EEKL D++
Sbjct  101  FLDSEMDRVDAFLARIQNDIFHAHELIPFCKFSSETLMYLEEKLQDSK  148



>ref|XP_008455569.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X2 [Cucumis melo]
Length=653

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsv  492
            EVI ++E+D+A +SEKL NL VL MH+ TRE+EFEAF  E +   +DSV++A E +LL+ 
Sbjct  41   EVITRLELDVARASEKLVNLNVLMMHIATRESEFEAFAFENDHMFDDSVKRASEIDLLAG  100

Query  493  lldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
             LDSE+  +   L+ +Q +I ++ ++IP C+ + E    +EEKL D++
Sbjct  101  FLDSEMDRVDAFLARIQNDIFHAHELIPFCKFSSETLMYLEEKLQDSK  148



>ref|XP_008455573.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X6 [Cucumis melo]
Length=627

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsv  492
            EVI ++E+D+A +SEKL NL VL MH+ TRE+EFEAF  E +   +DSV++A E +LL+ 
Sbjct  41   EVITRLELDVARASEKLVNLNVLMMHIATRESEFEAFAFENDHMFDDSVKRASEIDLLAG  100

Query  493  lldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
             LDSE+  +   L+ +Q +I ++ ++IP C+ + E    +EEKL D++
Sbjct  101  FLDSEMDRVDAFLARIQNDIFHAHELIPFCKFSSETLMYLEEKLQDSK  148



>ref|XP_008455568.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X1 [Cucumis melo]
Length=654

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsv  492
            EVI ++E+D+A +SEKL NL VL MH+ TRE+EFEAF  E +   +DSV++A E +LL+ 
Sbjct  41   EVITRLELDVARASEKLVNLNVLMMHIATRESEFEAFAFENDHMFDDSVKRASEIDLLAG  100

Query  493  lldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
             LDSE+  +   L+ +Q +I ++ ++IP C+ + E    +EEKL D++
Sbjct  101  FLDSEMDRVDAFLARIQNDIFHAHELIPFCKFSSETLMYLEEKLQDSK  148



>ref|XP_008455572.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X5 [Cucumis melo]
Length=632

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsv  492
            EVI ++E+D+A +SEKL NL VL MH+ TRE+EFEAF  E +   +DSV++A E +LL+ 
Sbjct  41   EVITRLELDVARASEKLVNLNVLMMHIATRESEFEAFAFENDHMFDDSVKRASEIDLLAG  100

Query  493  lldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
             LDSE+  +   L+ +Q +I ++ ++IP C+ + E    +EEKL D++
Sbjct  101  FLDSEMDRVDAFLARIQNDIFHAHELIPFCKFSSETLMYLEEKLQDSK  148



>ref|XP_008455571.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X4 [Cucumis melo]
Length=633

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsv  492
            EVI ++E+D+A +SEKL NL VL MH+ TRE+EFEAF  E +   +DSV++A E +LL+ 
Sbjct  41   EVITRLELDVARASEKLVNLNVLMMHIATRESEFEAFAFENDHMFDDSVKRASEIDLLAG  100

Query  493  lldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
             LDSE+  +   L+ +Q +I ++ ++IP C+ + E    +EEKL D++
Sbjct  101  FLDSEMDRVDAFLARIQNDIFHAHELIPFCKFSSETLMYLEEKLQDSK  148



>ref|XP_010247050.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X2 [Nelumbo nucifera]
Length=712

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 94/140 (67%), Gaps = 1/140 (1%)
 Frame = +1

Query  217  SGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVE  396
            SG+ E ES N+ S + ++ +GE ++E G I  E++ ++E+ LA SSEKL NL +L MHV 
Sbjct  18   SGDPEVESDNIYSYEAVMPNGEGIREAG-IVREILTRVELYLAYSSEKLVNLDILLMHVA  76

Query  397  TRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIP  576
            T E++ EAF  E ++     ++KA+EF+ LS +LDSEVR+L   + SLQMEI  + Q I 
Sbjct  77   TMESDLEAFSLESDEILAFPLEKALEFDFLSGILDSEVRDLDSFMDSLQMEIRDACQRII  136

Query  577  SCEDAGELYGVIEEKLNDAE  636
            S E +GE +  +E KL+DAE
Sbjct  137  SYEPSGESFVEMEAKLHDAE  156



>ref|XP_010247049.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Nelumbo nucifera]
Length=719

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 94/140 (67%), Gaps = 1/140 (1%)
 Frame = +1

Query  217  SGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVE  396
            SG+ E ES N+ S + ++ +GE ++E G I  E++ ++E+ LA SSEKL NL +L MHV 
Sbjct  18   SGDPEVESDNIYSYEAVMPNGEGIREAG-IVREILTRVELYLAYSSEKLVNLDILLMHVA  76

Query  397  TRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIP  576
            T E++ EAF  E ++     ++KA+EF+ LS +LDSEVR+L   + SLQMEI  + Q I 
Sbjct  77   TMESDLEAFSLESDEILAFPLEKALEFDFLSGILDSEVRDLDSFMDSLQMEIRDACQRII  136

Query  577  SCEDAGELYGVIEEKLNDAE  636
            S E +GE +  +E KL+DAE
Sbjct  137  SYEPSGESFVEMEAKLHDAE  156



>ref|XP_010247051.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X3 [Nelumbo nucifera]
Length=695

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 94/140 (67%), Gaps = 1/140 (1%)
 Frame = +1

Query  217  SGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVE  396
            SG+ E ES N+ S + ++ +GE ++E G I  E++ ++E+ LA SSEKL NL +L MHV 
Sbjct  18   SGDPEVESDNIYSYEAVMPNGEGIREAG-IVREILTRVELYLAYSSEKLVNLDILLMHVA  76

Query  397  TRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIP  576
            T E++ EAF  E ++     ++KA+EF+ LS +LDSEVR+L   + SLQMEI  + Q I 
Sbjct  77   TMESDLEAFSLESDEILAFPLEKALEFDFLSGILDSEVRDLDSFMDSLQMEIRDACQRII  136

Query  577  SCEDAGELYGVIEEKLNDAE  636
            S E +GE +  +E KL+DAE
Sbjct  137  SYEPSGESFVEMEAKLHDAE  156



>gb|KGN53761.1| hypothetical protein Csa_4G123340 [Cucumis sativus]
Length=548

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsv  492
            EVI ++E+D+A +SEKL NL VL M + TRE+EFEAF  E +   +DSV++A E +LL+ 
Sbjct  41   EVITRLELDVARASEKLVNLNVLMMRIATRESEFEAFALENDHMFDDSVERASEVDLLAG  100

Query  493  lldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
             LDSEV  +   L+ +Q +I ++ ++IP C+ + E    +EEKL D+E
Sbjct  101  FLDSEVDGVDAFLARIQNDIFHAHELIPFCKFSSETLMYLEEKLQDSE  148



>gb|KDP24315.1| hypothetical protein JCGZ_25611 [Jatropha curcas]
Length=701

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 89/144 (62%), Gaps = 2/144 (1%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLK  384
            DE    + E ES  +D L  + S  E   ELG I +E++ ++E+DLA +SEKL NL +L 
Sbjct  14   DEANPADQETESSKIDLLVEMSSDAEINGELG-IADEILTRMELDLACASEKLVNLSLLM  72

Query  385  MHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSR  564
            MHV TRE+EFE   + KE    DSV+ A+EF+LLS +LDSEV EL   ++  Q  I  +R
Sbjct  73   MHVATRESEFETITSPKENFVGDSVE-ALEFDLLSWILDSEVTELDKFMTDTQKNIVDAR  131

Query  565  QIIPSCEDAGELYGVIEEKLNDAE  636
            ++I   +   E++  +EEKL D E
Sbjct  132  KMISLYQHLEEIFMAMEEKLLDCE  155



>ref|XP_007032932.1| WPP domain-interacting protein 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY03858.1| WPP domain-interacting protein 1, putative isoform 2 [Theobroma 
cacao]
Length=719

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 94/154 (61%), Gaps = 7/154 (5%)
 Frame = +1

Query  184  MDANSGKDEHCSG------ELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLA  345
            MDA+   +E  SG      E E  S   D LD I S GE   EL     E++ ++E+DLA
Sbjct  1    MDADVIHEEGVSGDDFNSMEPEAGSNRADILDGISSGGEVNGELF-WASEILTRLELDLA  59

Query  346  GSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsv  525
             SSEKL NL +L MHV TRE +FE+F++EK     D V+KA+EF+LLS +LDSE REL  
Sbjct  60   CSSEKLVNLSILTMHVATRETDFESFMSEKNFMLVDLVEKALEFDLLSGILDSEARELDK  119

Query  526  llsslQMEIGYSRQIIPSCEDAGELYGVIEEKLN  627
             + S++ +I  + + I S +  GE +  +E+KL+
Sbjct  120  FMESIETDIVGALETISSFKYLGETFFKMEDKLH  153



>ref|XP_007032931.1| WPP domain-interacting protein 1, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007032933.1| WPP domain-interacting protein 1, putative isoform 1 [Theobroma 
cacao]
 gb|EOY03857.1| WPP domain-interacting protein 1, putative isoform 1 [Theobroma 
cacao]
 gb|EOY03859.1| WPP domain-interacting protein 1, putative isoform 1 [Theobroma 
cacao]
Length=718

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 94/154 (61%), Gaps = 7/154 (5%)
 Frame = +1

Query  184  MDANSGKDEHCSG------ELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLA  345
            MDA+   +E  SG      E E  S   D LD I S GE   EL     E++ ++E+DLA
Sbjct  1    MDADVIHEEGVSGDDFNSMEPEAGSNRADILDGISSGGEVNGELF-WASEILTRLELDLA  59

Query  346  GSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsv  525
             SSEKL NL +L MHV TRE +FE+F++EK     D V+KA+EF+LLS +LDSE REL  
Sbjct  60   CSSEKLVNLSILTMHVATRETDFESFMSEKNFMLVDLVEKALEFDLLSGILDSEARELDK  119

Query  526  llsslQMEIGYSRQIIPSCEDAGELYGVIEEKLN  627
             + S++ +I  + + I S +  GE +  +E+KL+
Sbjct  120  FMESIETDIVGALETISSFKYLGETFFKMEDKLH  153



>ref|XP_006482462.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482463.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X2 [Citrus sinensis]
Length=617

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = +1

Query  220  GELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVET  399
            G+ E ES  V SL+ I ++G+ ++EL S  E V +++E+ +A SSEKL NL +L MHV T
Sbjct  18   GDSETESNKVYSLEGISANGDVIEELRSAGE-VFSQLELHIACSSEKLVNLNILTMHVAT  76

Query  400  RENEFEAFVAEKEQ-SSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIP  576
            RE+EFEAF  ++E    +DSV+ A+ F+LLS LLDSE+REL   +++++ +   +R++I 
Sbjct  77   RESEFEAFAKKREHILDDDSVETALAFDLLSGLLDSELRELENFITTVEADFVKARELIS  136

Query  577  SCEDAGELYGVIEEKLNDAE  636
            S  + G+    +EEKL D+E
Sbjct  137  SYRELGKASIEMEEKLLDSE  156



>ref|XP_002533487.1| DNA double-strand break repair rad50 ATPase, putative [Ricinus 
communis]
 gb|EEF28891.1| DNA double-strand break repair rad50 ATPase, putative [Ricinus 
communis]
Length=631

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 92/144 (64%), Gaps = 6/144 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLK  384
            D+  S + E ES  VD +  + S+GE   ELG I  + + ++E+DLA +SEKL NL VL 
Sbjct  14   DDVNSADPEAESSKVDLVVEMSSNGEISSELG-IVHKFLTRMELDLACASEKLVNLSVLM  72

Query  385  MHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSR  564
            MH+ T+E+EFE   +++     DSV+ A+EF+LLS +LDSE+ EL   + + Q  I   R
Sbjct  73   MHLATKESEFETIASQE----GDSVE-ALEFDLLSRILDSELTELDKFMITSQKNIVEVR  127

Query  565  QIIPSCEDAGELYGVIEEKLNDAE  636
            ++I S E  GE++  +EEKL D+E
Sbjct  128  KMISSYEHLGEMFMAMEEKLCDSE  151



>ref|XP_010424056.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Camelina sativa]
Length=784

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 83/127 (65%), Gaps = 6/127 (5%)
 Frame = +1

Query  274  SGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQ----  441
            +G+ M    S   EV+ K+E+D A  SEKL NL +L M + TREN+FE+FV  KE+    
Sbjct  39   TGQVMNPQLSSAGEVLTKVELDFAFVSEKLVNLSLLTMQLGTRENDFESFVTRKEKEEEE  98

Query  442  --SSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIE  615
              S++DS +KA+EF+LLS +L+SEV+EL  LL  LQ EI  +R +I   +  GE +  +E
Sbjct  99   PLSNDDSAEKALEFDLLSSILNSEVKELESLLGFLQDEIQSARVMISPFQHDGEAFLDLE  158

Query  616  EKLNDAE  636
             KL+DAE
Sbjct  159  GKLHDAE  165



>ref|XP_004304181.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467849.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Fragaria 
vesca subsp. vesca]
Length=656

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 90/134 (67%), Gaps = 6/134 (4%)
 Frame = +1

Query  235  ESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEF  414
            ES + D LD  VSSGE    L ++ E VI  +E DLA +++KL NL    M V T+E++F
Sbjct  24   ESHSRDGLDR-VSSGE----LENVRE-VIIDVESDLARAADKLQNLSGFMMRVATKESDF  77

Query  415  EAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAG  594
            EAFV+++E+ S D V+KA+E+ LLS +LDSEV EL  L++ LQMEI  ++ I+ S    G
Sbjct  78   EAFVSKEEEKSVDCVEKALEYTLLSGILDSEVSELDKLMAMLQMEITAAQGILSSYTYLG  137

Query  595  ELYGVIEEKLNDAE  636
            E + V+EEKL  +E
Sbjct  138  ETFAVMEEKLQYSE  151



>emb|CBI27417.3| unnamed protein product [Vitis vinifera]
Length=735

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 84/130 (65%), Gaps = 4/130 (3%)
 Frame = +1

Query  247  VDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFV  426
            VD  D+   +G+ M+EL     +V+  +++DLA SSEKL NL VL M V  REN FEA  
Sbjct  61   VDDTDM---NGKGMEEL-ECAVKVLLSLDLDLAYSSEKLVNLHVLLMQVWARENVFEAMA  116

Query  427  AEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYG  606
             EK+  S DS++KA+ F+LLS +LDSEVRE+   + +LQ EI  + + I SC    EL+ 
Sbjct  117  MEKDHISADSIEKALVFDLLSGILDSEVREIENFMDTLQAEIVDAHKKIYSCSHLRELFN  176

Query  607  VIEEKLNDAE  636
            V+EEKL D E
Sbjct  177  VMEEKLIDCE  186



>ref|XP_010654218.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 [Vitis 
vinifera]
Length=694

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 84/130 (65%), Gaps = 4/130 (3%)
 Frame = +1

Query  247  VDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFV  426
            VD  D+   +G+ M+EL     +V+  +++DLA SSEKL NL VL M V  REN FEA  
Sbjct  8    VDDTDM---NGKGMEEL-ECAVKVLLSLDLDLAYSSEKLVNLHVLLMQVWARENVFEAMA  63

Query  427  AEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYG  606
             EK+  S DS++KA+ F+LLS +LDSEVRE+   + +LQ EI  + + I SC    EL+ 
Sbjct  64   MEKDHISADSIEKALVFDLLSGILDSEVREIENFMDTLQAEIVDAHKKIYSCSHLRELFN  123

Query  607  VIEEKLNDAE  636
            V+EEKL D E
Sbjct  124  VMEEKLIDCE  133



>ref|XP_006399640.1| hypothetical protein EUTSA_v10012837mg [Eutrema salsugineum]
 gb|ESQ41093.1| hypothetical protein EUTSA_v10012837mg [Eutrema salsugineum]
Length=697

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 85/131 (65%), Gaps = 4/131 (3%)
 Frame = +1

Query  256  LDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK  435
            L+ I  SG+ M    S   +V+ K+E+D A  SEKL NL +L M + +REN+FE+FV+EK
Sbjct  31   LEDISLSGQAMNTELSSAGQVLTKVELDFAFISEKLVNLSLLTMQLGSRENDFESFVSEK  90

Query  436  EQ--SSN--DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELY  603
            E+  SSN  DS +KA+EF+LLS +L SEV+EL  LL  LQ EI  +R +I   +  GE  
Sbjct  91   EEEPSSNDDDSAEKALEFDLLSSILSSEVKELDSLLGFLQNEIQSARVMISPFQHDGEAI  150

Query  604  GVIEEKLNDAE  636
              +E KL DAE
Sbjct  151  SDLEGKLRDAE  161



>ref|XP_010528442.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010528443.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Tarenaya hassleriana]
Length=681

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = +1

Query  316  VIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvl  495
            ++ ++E+DLA  SEKL NL VL MH+  RE++FE+F +EK  S  DS +KAMEF+LLS +
Sbjct  44   ILTRVELDLACCSEKLVNLSVLTMHLGARESDFESFASEKVPSGIDSAEKAMEFDLLSAI  103

Query  496  ldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
             DSEV EL  L+  LQ EI  +  +I   +D  E +  + EKL DAE
Sbjct  104  CDSEVNELENLIKHLQTEIQGASDMISPFQDVEEAFSEMLEKLRDAE  150



>ref|XP_010528444.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X2 [Tarenaya hassleriana]
Length=674

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = +1

Query  316  VIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvl  495
            ++ ++E+DLA  SEKL NL VL MH+  RE++FE+F +EK  S  DS +KAMEF+LLS +
Sbjct  44   ILTRVELDLACCSEKLVNLSVLTMHLGARESDFESFASEKVPSGIDSAEKAMEFDLLSAI  103

Query  496  ldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
             DSEV EL  L+  LQ EI  +  +I   +D  E +  + EKL DAE
Sbjct  104  CDSEVNELENLIKHLQTEIQGASDMISPFQDVEEAFSEMLEKLRDAE  150



>gb|KDO72336.1| hypothetical protein CISIN_1g007114mg [Citrus sinensis]
Length=617

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 67/104 (64%), Gaps = 7/104 (7%)
 Frame = +1

Query  184  MDANSGKDEHCS-----GELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAG  348
            MD ++ ++   S     G+ E ES  V SL+ I ++G+ ++EL S  E V +++E+ +A 
Sbjct  1    MDTDADQETSASVVVNVGDSESESNKVYSLEGISANGDVIEELRSAGE-VFSQLELHIAC  59

Query  349  SSEKLANLGVLKMHVETRENEFEAFVAEKEQ-SSNDSVQKAMEF  477
            SSEKL NL +L MHV TRE+EFEAF  ++E    +DSV+ A+ F
Sbjct  60   SSEKLVNLNILTMHVATRESEFEAFAKKREHILDDDSVETALAF  103



>ref|XP_010694439.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=672

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 80/124 (65%), Gaps = 7/124 (6%)
 Frame = +1

Query  265  IVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQS  444
            I S  E ++E+GS     + ++E+D+AG SEKL N+ +L MHV  RE+ FEAF  EKE +
Sbjct  35   IYSEKEVIREIGS----ALIRLELDIAGCSEKLVNMNLLMMHVAARESNFEAFTLEKEDT  90

Query  445  SNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKL  624
                V KA+EF++LS + D EVRE+   + +L+ ++  + ++I S E  GE +  ++EKL
Sbjct  91   ---LVGKALEFDILSGIFDLEVREMDRFIGTLETDLNNTCEVISSYEHLGEDFLALQEKL  147

Query  625  NDAE  636
             DAE
Sbjct  148  QDAE  151



>emb|CAN75587.1| hypothetical protein VITISV_040555 [Vitis vinifera]
Length=745

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = +1

Query  247  VDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFV  426
            VD  D+   +G+ M+EL     +V+  +++DLA SSEKL NL VL M V  REN FEA  
Sbjct  8    VDDTDM---NGKGMEEL-ECAVKVLLSLDLDLAYSSEKLVNLHVLLMQVWARENVFEAMA  63

Query  427  AEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYG  606
              K+  S DS++KA+ F+LLS +LDSEVRE+   + +LQ EI  + + I SC    EL+ 
Sbjct  64   MGKDHISADSIEKALVFDLLSGILDSEVREIENFMDTLQAEIVDAHKKIYSCSHLRELFN  123

Query  607  VIEEKLNDAE  636
            V+EEKL D E
Sbjct  124  VMEEKLIDCE  133



>ref|XP_010694440.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=551

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 80/124 (65%), Gaps = 7/124 (6%)
 Frame = +1

Query  265  IVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQS  444
            I S  E ++E+GS     + ++E+D+AG SEKL N+ +L MHV  RE+ FEAF  EKE +
Sbjct  35   IYSEKEVIREIGS----ALIRLELDIAGCSEKLVNMNLLMMHVAARESNFEAFTLEKEDT  90

Query  445  SNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKL  624
                V KA+EF++LS + D EVRE+   + +L+ ++  + ++I S E  GE +  ++EKL
Sbjct  91   ---LVGKALEFDILSGIFDLEVREMDRFIGTLETDLNNTCEVISSYEHLGEDFLALQEKL  147

Query  625  NDAE  636
             DAE
Sbjct  148  QDAE  151



>ref|XP_006287169.1| hypothetical protein CARUB_v10000340mg [Capsella rubella]
 gb|EOA20067.1| hypothetical protein CARUB_v10000340mg [Capsella rubella]
Length=709

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 84/136 (62%), Gaps = 15/136 (11%)
 Frame = +1

Query  274  SGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK------  435
            SG+ M    S   EV+ K+E+D A  SEKL NL +L M + TREN+FE+FV++K      
Sbjct  38   SGQVMNPQLSSAGEVLTKVELDFAFISEKLVNLSLLTMQLGTRENDFESFVSKKVEEEEE  97

Query  436  ----EQSSN-----DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCED  588
                E SSN     DS +KA+EF+LLS +L+SEV+EL  LL  LQ EI  +R +I   + 
Sbjct  98   EEEEEPSSNGDDNDDSAEKALEFDLLSSILNSEVKELESLLGFLQNEIQSARAMISPFQH  157

Query  589  AGELYGVIEEKLNDAE  636
             GE +  +E KL+DAE
Sbjct  158  DGEAFSDLEGKLHDAE  173



>emb|CAB96674.1| putative protein [Arabidopsis thaliana]
Length=696

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = +1

Query  274  SGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQ----  441
            +G+ M    S   EV+ K+E+D A  SEKL NL +L M + TREN+FE+FV++KE+    
Sbjct  37   TGQVMNPQLSSAGEVLTKVELDFAFVSEKLVNLSLLTMQLGTRENDFESFVSKKEEDEEE  96

Query  442  -SSN-----DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELY  603
             SSN     DS +KA+EF+LLS +L+SEV+EL  LL  LQ EI  +R +I   +  GE +
Sbjct  97   PSSNVDDDDDSAEKALEFDLLSSILNSEVKELESLLGFLQNEIQSARVMISPFQHDGEAF  156

Query  604  GVIEEKLNDAE  636
              +E KLND E
Sbjct  157  LDLEGKLNDTE  167



>ref|XP_006287168.1| hypothetical protein CARUB_v10000340mg [Capsella rubella]
 gb|EOA20066.1| hypothetical protein CARUB_v10000340mg [Capsella rubella]
Length=695

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 84/136 (62%), Gaps = 15/136 (11%)
 Frame = +1

Query  274  SGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK------  435
            SG+ M    S   EV+ K+E+D A  SEKL NL +L M + TREN+FE+FV++K      
Sbjct  38   SGQVMNPQLSSAGEVLTKVELDFAFISEKLVNLSLLTMQLGTRENDFESFVSKKVEEEEE  97

Query  436  ----EQSSN-----DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCED  588
                E SSN     DS +KA+EF+LLS +L+SEV+EL  LL  LQ EI  +R +I   + 
Sbjct  98   EEEEEPSSNGDDNDDSAEKALEFDLLSSILNSEVKELESLLGFLQNEIQSARAMISPFQH  157

Query  589  AGELYGVIEEKLNDAE  636
             GE +  +E KL+DAE
Sbjct  158  DGEAFSDLEGKLHDAE  173



>gb|AAM96967.1| putative protein [Arabidopsis thaliana]
 gb|AAN15713.1| putative protein [Arabidopsis thaliana]
Length=703

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = +1

Query  274  SGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQ----  441
            +G+ M    S   EV+ K+E+D A  SEKL NL +L M + TREN+FE+FV++KE+    
Sbjct  37   TGQVMNPQLSSAGEVLTKVELDFAFVSEKLVNLSLLTMQLGTRENDFESFVSKKEEDEEE  96

Query  442  -SSN-----DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELY  603
             SSN     DS +KA+EF+LLS +L+SEV+EL  LL  LQ EI  +R +I   +  GE +
Sbjct  97   PSSNVDDDDDSAEKALEFDLLSSILNSEVKELESLLGFLQNEIQSARVMISPFQHDGEAF  156

Query  604  GVIEEKLNDAE  636
              +E KLND E
Sbjct  157  LDLEGKLNDTE  167



>ref|NP_196700.2| WPP domain-interacting tail-anchored protein 1 [Arabidopsis thaliana]
 sp|Q8L7E5.2|WIT1_ARATH RecName: Full=WPP domain-interacting tail-anchored protein 1 
[Arabidopsis thaliana]
 gb|AED91671.1| WPP domain-interacting tail-anchored protein 1 [Arabidopsis thaliana]
Length=703

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = +1

Query  274  SGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQ----  441
            +G+ M    S   EV+ K+E+D A  SEKL NL +L M + TREN+FE+FV++KE+    
Sbjct  37   TGQVMNPQLSSAGEVLTKVELDFAFVSEKLVNLSLLTMQLGTRENDFESFVSKKEEDEEE  96

Query  442  -SSN-----DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELY  603
             SSN     DS +KA+EF+LLS +L+SEV+EL  LL  LQ EI  +R +I   +  GE +
Sbjct  97   PSSNVDDDDDSAEKALEFDLLSSILNSEVKELESLLGFLQNEIQSARVMISPFQHDGEAF  156

Query  604  GVIEEKLNDAE  636
              +E KLND E
Sbjct  157  LDLEGKLNDTE  167



>ref|XP_010491870.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Camelina sativa]
Length=706

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 82/132 (62%), Gaps = 11/132 (8%)
 Frame = +1

Query  274  SGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK------  435
            +G+ M    S   EV+ K+E+D A  SEKL NL +L M + TREN+FE+FV++K      
Sbjct  39   TGQVMNPQLSSAGEVLTKVELDFAFVSEKLVNLSLLTMQLGTRENDFESFVSKKVDEEEE  98

Query  436  -----EQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGEL  600
                   S++DS +KA+EF+LLS +L+SEV EL  LL  LQ EI  +R +I   +  GE 
Sbjct  99   EEEEESLSNDDSAEKALEFDLLSSILNSEVNELESLLGFLQGEIQSARVMISPFQHDGEA  158

Query  601  YGVIEEKLNDAE  636
            +  +E KL+DAE
Sbjct  159  FLDLEGKLHDAE  170



>ref|XP_010491871.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X2 [Camelina sativa]
Length=616

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 82/132 (62%), Gaps = 11/132 (8%)
 Frame = +1

Query  274  SGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK------  435
            +G+ M    S   EV+ K+E+D A  SEKL NL +L M + TREN+FE+FV++K      
Sbjct  39   TGQVMNPQLSSAGEVLTKVELDFAFVSEKLVNLSLLTMQLGTRENDFESFVSKKVDEEEE  98

Query  436  -----EQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGEL  600
                   S++DS +KA+EF+LLS +L+SEV EL  LL  LQ EI  +R +I   +  GE 
Sbjct  99   EEEEESLSNDDSAEKALEFDLLSSILNSEVNELESLLGFLQGEIQSARVMISPFQHDGEA  158

Query  601  YGVIEEKLNDAE  636
            +  +E KL+DAE
Sbjct  159  FLDLEGKLHDAE  170



>ref|XP_010553942.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X2 [Tarenaya hassleriana]
Length=703

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = +1

Query  316  VIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvl  495
            ++ K+E+DLA  SEKL NL VL MH+ T E++FEAF +EKE S  DS  KAMEF+LLSV+
Sbjct  43   ILTKVELDLAFCSEKLVNLSVLMMHLGTMESDFEAFASEKEPSGVDSAGKAMEFDLLSVI  102

Query  496  ldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            LDSEV +L  L+  LQ E    R +I   ++  E +  + EKL +AE
Sbjct  103  LDSEVNDLEKLIQHLQTETQSVRDMISPFQEVEEAFPEMIEKLCNAE  149



>ref|XP_010553941.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Tarenaya hassleriana]
Length=828

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = +1

Query  316  VIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvl  495
            ++ K+E+DLA  SEKL NL VL MH+ T E++FEAF +EKE S  DS  KAMEF+LLSV+
Sbjct  43   ILTKVELDLAFCSEKLVNLSVLMMHLGTMESDFEAFASEKEPSGVDSAGKAMEFDLLSVI  102

Query  496  ldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            LDSEV +L  L+  LQ E    R +I   ++  E +  + EKL +AE
Sbjct  103  LDSEVNDLEKLIQHLQTETQSVRDMISPFQEVEEAFPEMIEKLCNAE  149



>ref|XP_009355657.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009355665.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X1 [Pyrus x bretschneideri]
Length=691

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 96/162 (59%), Gaps = 18/162 (11%)
 Frame = +1

Query  154  GSSVCSSKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGET-MQELGSIEEEVIAKI  330
            G +VC      D N+G     + ELE     ++ +   V S E+ +QEL S   +V+ K+
Sbjct  3    GHAVC------DINAG-----NPELE-----INHIHERVPSNESGVQELES-SMKVLTKV  45

Query  331  EVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsev  510
            ++DLA SSEKLANL V  M++  ++N+ EA          D V+K + F LLS +LDSEV
Sbjct  46   DLDLAYSSEKLANLHVPLMYLLAQQNDLEAMATTNNYILADFVEKVLVFNLLSSILDSEV  105

Query  511  relsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            REL   + +L++EI  +RQ I SC   GELY +++ KLND+E
Sbjct  106  RELDNYMDNLRVEIVDARQKISSCRHLGELYSIMKGKLNDSE  147



>ref|XP_009355671.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X2 [Pyrus x bretschneideri]
Length=624

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 96/162 (59%), Gaps = 18/162 (11%)
 Frame = +1

Query  154  GSSVCSSKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGET-MQELGSIEEEVIAKI  330
            G +VC      D N+G     + ELE     ++ +   V S E+ +QEL S   +V+ K+
Sbjct  3    GHAVC------DINAG-----NPELE-----INHIHERVPSNESGVQELES-SMKVLTKV  45

Query  331  EVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsev  510
            ++DLA SSEKLANL V  M++  ++N+ EA          D V+K + F LLS +LDSEV
Sbjct  46   DLDLAYSSEKLANLHVPLMYLLAQQNDLEAMATTNNYILADFVEKVLVFNLLSSILDSEV  105

Query  511  relsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            REL   + +L++EI  +RQ I SC   GELY +++ KLND+E
Sbjct  106  RELDNYMDNLRVEIVDARQKISSCRHLGELYSIMKGKLNDSE  147



>ref|XP_008352936.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X1 [Malus domestica]
Length=691

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 81/124 (65%), Gaps = 2/124 (2%)
 Frame = +1

Query  268  VSSGET-MQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQS  444
            V S E+ +QEL S   +V+ K+++DLA SSEKLANL V  M++  ++N+ EA        
Sbjct  25   VPSNESGVQELES-SMKVLTKVDLDLAYSSEKLANLHVPLMYLLAQQNDLEAMATTNNYI  83

Query  445  SNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKL  624
              D V+K + F LLS +LDSEVREL   + +L++EI  +RQ I SC   GELY +++ KL
Sbjct  84   LADFVEKVLVFNLLSSILDSEVRELDNYMDNLRVEIVDARQKISSCRHLGELYSIMKGKL  143

Query  625  NDAE  636
            ND+E
Sbjct  144  NDSE  147



>ref|XP_008339737.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X1 [Malus domestica]
Length=691

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 81/124 (65%), Gaps = 2/124 (2%)
 Frame = +1

Query  268  VSSGET-MQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQS  444
            V S E+ +QEL S   +V+ K+++DLA SSEKLANL V  M++  ++N+ EA        
Sbjct  25   VPSNESGVQELES-SMKVLTKVDLDLAYSSEKLANLHVPLMYLLAQQNDLEAMATTNNYI  83

Query  445  SNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKL  624
              D V+K + F LLS +LDSEVREL   + +L++EI  +RQ I SC   GELY +++ KL
Sbjct  84   LADFVEKVLVFNLLSSILDSEVRELDNYMDNLRVEIVDARQKISSCRHLGELYSIMKGKL  143

Query  625  NDAE  636
            ND+E
Sbjct  144  NDSE  147



>ref|XP_008352937.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X2 [Malus domestica]
Length=624

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 81/124 (65%), Gaps = 2/124 (2%)
 Frame = +1

Query  268  VSSGET-MQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQS  444
            V S E+ +QEL S   +V+ K+++DLA SSEKLANL V  M++  ++N+ EA        
Sbjct  25   VPSNESGVQELES-SMKVLTKVDLDLAYSSEKLANLHVPLMYLLAQQNDLEAMATTNNYI  83

Query  445  SNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKL  624
              D V+K + F LLS +LDSEVREL   + +L++EI  +RQ I SC   GELY +++ KL
Sbjct  84   LADFVEKVLVFNLLSSILDSEVRELDNYMDNLRVEIVDARQKISSCRHLGELYSIMKGKL  143

Query  625  NDAE  636
            ND+E
Sbjct  144  NDSE  147



>ref|XP_010453184.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Camelina 
sativa]
Length=703

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 83/129 (64%), Gaps = 8/129 (6%)
 Frame = +1

Query  274  SGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK------  435
            +G+ M    S   EV+ K+E+D A  SEKL NL +L M + TREN+FE+FV++K      
Sbjct  39   TGQVMNPQLSSAGEVLTKVELDFAFVSEKLVNLSLLTMQLGTRENDFESFVSKKVEEEEE  98

Query  436  EQSSN--DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGV  609
            E SSN  DS +KA+EF+LLS +L+SEV+EL  LL  LQ EI  +R +I   +  GE +  
Sbjct  99   EPSSNDDDSAEKALEFDLLSSILNSEVKELESLLGFLQDEIQSARVMISPFQHDGEAFLD  158

Query  610  IEEKLNDAE  636
            +E  L+DAE
Sbjct  159  LEGNLHDAE  167



>ref|XP_008339738.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X2 [Malus domestica]
Length=624

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 81/124 (65%), Gaps = 2/124 (2%)
 Frame = +1

Query  268  VSSGET-MQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQS  444
            V S E+ +QEL S   +V+ K+++DLA SSEKLANL V  M++  ++N+ EA        
Sbjct  25   VPSNESGVQELES-SMKVLTKVDLDLAYSSEKLANLHVPLMYLLAQQNDLEAMATTNNYI  83

Query  445  SNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKL  624
              D V+K + F LLS +LDSEVREL   + +L++EI  +RQ I SC   GELY +++ KL
Sbjct  84   LADFVEKVLVFNLLSSILDSEVRELDNYMDNLRVEIVDARQKISSCRHLGELYSIMKGKL  143

Query  625  NDAE  636
            ND+E
Sbjct  144  NDSE  147



>ref|XP_010942237.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Elaeis guineensis]
 ref|XP_010942238.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Elaeis guineensis]
Length=694

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 80/122 (66%), Gaps = 2/122 (2%)
 Frame = +1

Query  271  SSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSN  450
            S GE M E  ++E  V+ ++E+DLA SSEKL NL +L M V +R ++FEA   E E  SN
Sbjct  17   SRGERMSEGTAME--VLTRLELDLAYSSEKLLNLEILLMQVSSRASDFEALTTEYEDISN  74

Query  451  DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLND  630
            +S++KA EF+ +S +L++EV+EL   ++SLQM+I  + Q +   +   E    IEEKL D
Sbjct  75   ESIEKAFEFDAMSGILNTEVKELDNFMASLQMDIMDAHQKLSHDDHFRESSIKIEEKLLD  134

Query  631  AE  636
            A+
Sbjct  135  AQ  136



>ref|XP_006430992.1| hypothetical protein CICLE_v10011306mg [Citrus clementina]
 gb|ESR44232.1| hypothetical protein CICLE_v10011306mg [Citrus clementina]
Length=617

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 66/104 (63%), Gaps = 7/104 (7%)
 Frame = +1

Query  184  MDANSGKDEHCS-----GELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAG  348
            MD ++ ++   S     G+ E ES  V SL+ I ++G+ ++EL S  E V +++E+ +A 
Sbjct  1    MDTDADQETSASVVVNVGDSESESNKVYSLEGISANGDVIEELRSAGE-VFSQLELHIAC  59

Query  349  SSEKLANLGVLKMHVETRENEFEAFVAEKEQ-SSNDSVQKAMEF  477
            SSEKL NL +L MHV TRE+EFEA   ++E    +DSV+ A+ F
Sbjct  60   SSEKLVNLNILTMHVATRESEFEASAKKREHILDDDSVETALAF  103



>gb|EPS71176.1| hypothetical protein M569_03583, partial [Genlisea aurea]
Length=249

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  319  IAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEF  477
            + ++E+DLA  SEKLANL +L MHV +REN+FEAF   KEQS    V KA+EF
Sbjct  1    LTQVELDLAFCSEKLANLDILVMHVASRENDFEAFALGKEQSEVVHVDKALEF  53



>ref|XP_010091658.1| hypothetical protein L484_026512 [Morus notabilis]
 gb|EXB44924.1| hypothetical protein L484_026512 [Morus notabilis]
Length=679

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsv  492
            EV+ K+++DLA SSEKL NL  L MH+  +ENE EA       +S + V+K + F+LLS 
Sbjct  36   EVLTKLDLDLAYSSEKLVNLHGLSMHLSAQENELEARAMGNNYTSTEFVEKTLVFDLLSG  95

Query  493  lldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            +L+SEVREL   + SLQ EI  + Q I SC    E Y ++EEKL+D+E
Sbjct  96   VLESEVRELDSFMVSLQAEIVDAHQKISSCRHLTEPYTMMEEKLHDSE  143



>ref|XP_008797571.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Phoenix dactylifera]
 ref|XP_008797572.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Phoenix dactylifera]
 ref|XP_008797573.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Phoenix dactylifera]
 ref|XP_008797574.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Phoenix dactylifera]
Length=696

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = +1

Query  316  VIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvl  495
            V+ + E+DLA SSEKL NL +L M V +R ++FEA   E E  SN+S++KA EF+ LS +
Sbjct  30   VLTRTELDLAYSSEKLLNLEILLMQVSSRASDFEALTTEYEDISNESIEKAFEFDALSGI  89

Query  496  ldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            L+ EV+EL   ++SLQMEI  +   +   +  GE    IEEKL DAE
Sbjct  90   LNMEVKELDNFMASLQMEIMDAHPKLSWDDHLGESSIKIEEKLRDAE  136



>ref|XP_009356475.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009356476.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X1 [Pyrus x bretschneideri]
Length=678

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = +1

Query  256  LDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK  435
            ++V+ S+   +QEL S   +V+ K+++DLA SSEKLANL V  M++  ++N+ EA     
Sbjct  9    INVVPSNESGVQELES-SMKVLTKVDLDLAYSSEKLANLHVPLMYLLAQQNDLEAMATAN  67

Query  436  EQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIE  615
                 D ++K + F LLS +LDSEVREL   + +L++EI  +   I SC   GELY +++
Sbjct  68   NYILADFIEKVLVFNLLSSILDSEVRELDSYMDNLRVEIVDAHPKISSCRHLGELYSIMK  127

Query  616  EKLNDAE  636
             KLND+E
Sbjct  128  GKLNDSE  134



>gb|KDP31424.1| hypothetical protein JCGZ_11800 [Jatropha curcas]
Length=705

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = +1

Query  271  SSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSN  450
            S  E MQ++ S  E V+ + ++DLA SSEKL NL V+ MH+   +N+FE    E    S 
Sbjct  18   SRAEGMQDVESTME-VLTRSDLDLAYSSEKLVNLHVILMHLLAWDNDFELMTLENSSLSE  76

Query  451  DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLND  630
             S++KA+ F+LLS +LDSEVRE+   + ++Q +I   R  I SC    EL+ ++EEKL +
Sbjct  77   TSIEKALVFDLLSGILDSEVREVENFMDNIQADIVDVRHKIFSCRHPTELFKIMEEKLRE  136

Query  631  AE  636
            +E
Sbjct  137  SE  138



>ref|XP_009356477.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X2 [Pyrus x bretschneideri]
Length=611

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = +1

Query  256  LDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK  435
            ++V+ S+   +QEL S   +V+ K+++DLA SSEKLANL V  M++  ++N+ EA     
Sbjct  9    INVVPSNESGVQELES-SMKVLTKVDLDLAYSSEKLANLHVPLMYLLAQQNDLEAMATAN  67

Query  436  EQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIE  615
                 D ++K + F LLS +LDSEVREL   + +L++EI  +   I SC   GELY +++
Sbjct  68   NYILADFIEKVLVFNLLSSILDSEVRELDSYMDNLRVEIVDAHPKISSCRHLGELYSIMK  127

Query  616  EKLNDAE  636
             KLND+E
Sbjct  128  GKLNDSE  134



>ref|XP_008243770.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 isoform 
X1 [Prunus mume]
 ref|XP_008243771.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 isoform 
X1 [Prunus mume]
Length=681

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 82/131 (63%), Gaps = 2/131 (2%)
 Frame = +1

Query  247  VDSLDVIVSSGET-MQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAF  423
            ++ L+  V S E+ MQEL S  + V+ K+++DLA SSEKLANL V  +++  ++N+ EA 
Sbjct  18   INYLNQRVQSNESGMQELESYLK-VLTKLDLDLAYSSEKLANLHVPLIYLLAQQNDLEAM  76

Query  424  VAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELY  603
                     D ++K + F  LS +LDSEVREL   + +LQ  I  +R+ I SC   G+LY
Sbjct  77   ATVNNYILTDFIEKVLVFNFLSSILDSEVRELDNFMDALQAGIIDARKKISSCRHLGKLY  136

Query  604  GVIEEKLNDAE  636
             ++E KLND+E
Sbjct  137  SIMEGKLNDSE  147



>gb|KCW51982.1| hypothetical protein EUGRSUZ_J01428 [Eucalyptus grandis]
Length=141

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLK  384
            D  CS   E  S  VDSL   + SGE   ELG    EV+ +IE+D+A +SEK  NL +L 
Sbjct  17   DTDCS---ELGSCKVDSLVGAMFSGEINGELGR-AGEVLTRIELDVACTSEKFYNLNILM  72

Query  385  MHVETRENEFEAFVAEKEQSSNDSVQKAM  471
            MHV T E+EFE    E+ Q    S +K +
Sbjct  73   MHVATEESEFEVLDLERCQKMPSSFEKGL  101



>ref|XP_008389358.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 isoform 
X1 [Malus domestica]
Length=678

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +1

Query  256  LDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK  435
            ++V+ S+   +QEL S   +V+ K+++DLA SSEKLANL V  +++  ++ + EA     
Sbjct  9    INVVPSNESGVQELES-SMKVLTKVDLDLAYSSEKLANLHVPLVYLLAQQXDLEAMATAN  67

Query  436  EQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIE  615
                 D ++K + F LLS +LDSEVREL   + +L+++I  +RQ I SC   GELY +++
Sbjct  68   NYILADFIEKVLAFNLLSSILDSEVRELDSYMDNLRVDIVDARQKISSCRHLGELYSIMK  127

Query  616  EKLNDAE  636
             KLND+E
Sbjct  128  GKLNDSE  134



>ref|XP_008243772.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 isoform 
X2 [Prunus mume]
 ref|XP_008243774.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 isoform 
X2 [Prunus mume]
Length=624

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 82/131 (63%), Gaps = 2/131 (2%)
 Frame = +1

Query  247  VDSLDVIVSSGET-MQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAF  423
            ++ L+  V S E+ MQEL S  + V+ K+++DLA SSEKLANL V  +++  ++N+ EA 
Sbjct  18   INYLNQRVQSNESGMQELESYLK-VLTKLDLDLAYSSEKLANLHVPLIYLLAQQNDLEAM  76

Query  424  VAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELY  603
                     D ++K + F  LS +LDSEVREL   + +LQ  I  +R+ I SC   G+LY
Sbjct  77   ATVNNYILTDFIEKVLVFNFLSSILDSEVRELDNFMDALQAGIIDARKKISSCRHLGKLY  136

Query  604  GVIEEKLNDAE  636
             ++E KLND+E
Sbjct  137  SIMEGKLNDSE  147



>ref|XP_008389359.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 isoform 
X2 [Malus domestica]
Length=611

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +1

Query  256  LDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK  435
            ++V+ S+   +QEL S   +V+ K+++DLA SSEKLANL V  +++  ++ + EA     
Sbjct  9    INVVPSNESGVQELES-SMKVLTKVDLDLAYSSEKLANLHVPLVYLLAQQXDLEAMATAN  67

Query  436  EQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIE  615
                 D ++K + F LLS +LDSEVREL   + +L+++I  +RQ I SC   GELY +++
Sbjct  68   NYILADFIEKVLAFNLLSSILDSEVRELDSYMDNLRVDIVDARQKISSCRHLGELYSIMK  127

Query  616  EKLNDAE  636
             KLND+E
Sbjct  128  GKLNDSE  134



>ref|XP_007225684.1| hypothetical protein PRUPE_ppa002890mg [Prunus persica]
 gb|EMJ26883.1| hypothetical protein PRUPE_ppa002890mg [Prunus persica]
Length=624

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 81/131 (62%), Gaps = 2/131 (2%)
 Frame = +1

Query  247  VDSLDVIVSSGET-MQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAF  423
            ++ L+  V S E+ MQEL S   +V+ K+++DLA SSEKLANL V  + +  ++N+ EA 
Sbjct  18   INYLNQQVQSNESGMQELES-HLKVLTKLDLDLAYSSEKLANLHVPLIFLLAQQNDLEAM  76

Query  424  VAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELY  603
                     D ++K + F  LS +LDSEVREL   + +LQ  I  +RQ I SC   G+LY
Sbjct  77   ATVNNYILADFIEKVLVFNFLSSILDSEVRELDNFMDALQAGIIDARQKISSCRHLGKLY  136

Query  604  GVIEEKLNDAE  636
             ++E KLND+E
Sbjct  137  SIMEGKLNDSE  147



>ref|XP_009378298.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Pyrus x bretschneideri]
 ref|XP_009378299.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Pyrus x bretschneideri]
 ref|XP_009378300.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Pyrus x bretschneideri]
Length=692

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 91/138 (66%), Gaps = 1/138 (1%)
 Frame = +1

Query  223  ELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETR  402
            +LE ES    +L  + S G  + EL  + E V+ ++E+DLA +SEKL NL VL MHV TR
Sbjct  20   DLEVESSIACNLGSVSSDGVVIGELRHLGE-VLTRVELDLACASEKLVNLNVLMMHVATR  78

Query  403  ENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSC  582
            E+EFEAF +E+EQ+S   ++KA+E   LS +LDSE+ EL  L++ LQ EI  ++ I+ S 
Sbjct  79   ESEFEAFASEEEQTSAYYLEKALELSHLSGILDSELSELDKLMAILQTEITSAQGILSSY  138

Query  583  EDAGELYGVIEEKLNDAE  636
               GE   VIEEKL D+E
Sbjct  139  TYLGETVAVIEEKLCDSE  156



>ref|XP_006373525.1| hypothetical protein POPTR_0017s14520g [Populus trichocarpa]
 gb|ERP51322.1| hypothetical protein POPTR_0017s14520g [Populus trichocarpa]
Length=703

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 86/145 (59%), Gaps = 17/145 (12%)
 Frame = +1

Query  223  ELEEESKNVDSLDVIVSSGETMQEL---GSIEEEVIAKIEVDLAGSSEKLANLGVLKMHV  393
            +L+ ES N D +    S+G+  +EL   G I    +  +E+DLA  +EKL NL VL MHV
Sbjct  20   DLDVESINTDLVVEASSNGDKSRELETAGGI----LTGVELDLACVAEKLVNLSVLMMHV  75

Query  394  ETRENEFEAFVAEKEQSSN----DSVQKAMEFellsvlldsevrelsvllsslQMEIGYS  561
             T+E +FEAF      SSN    DSV+KA+EF+ LS +LD+E  EL  L+ ++Q  I   
Sbjct  76   ATKETDFEAFA-----SSNDILADSVEKALEFDFLSEILDAETMELDKLMMNIQKYIFEV  130

Query  562  RQIIPSCEDAGELYGVIEEKLNDAE  636
             +II S    GE +  +EEKL D++
Sbjct  131  GEIISS-NGPGETFMALEEKLRDSQ  154



>ref|XP_004297183.2| PREDICTED: WPP domain-interacting tail-anchored protein 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=695

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 79/140 (56%), Gaps = 14/140 (10%)
 Frame = +1

Query  259  DVIVSSGE-----TMQELGSIEE---------EVIAKIEVDLAGSSEKLANLGVLKMHVE  396
            DV VSS E     T QE+ S E          +V+ K+++DLA S+EKLANL  L M + 
Sbjct  8    DVSVSSPEFEISHTDQEVSSNESGAQDLESSMKVLTKVDLDLAYSAEKLANLQALMMRLF  67

Query  397  TRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIP  576
            ++EN+ EA          D  +K + F LLS +LDSEVRE+   + +LQ EI  +R  I 
Sbjct  68   SQENDLEAMATANNYILADFHEKVLVFNLLSSILDSEVREMESFMDTLQAEIVGARHTIF  127

Query  577  SCEDAGELYGVIEEKLNDAE  636
            SC   GE Y  +EEKL D+E
Sbjct  128  SCSHLGEQYTAMEEKLYDSE  147



>ref|XP_008365431.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
[Malus domestica]
Length=693

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 95/157 (61%), Gaps = 7/157 (4%)
 Frame = +1

Query  184  MDANSGKDEHCSG------ELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLA  345
            MD  +G +   SG      +LE ES    +L  + S G  + EL  + E V+ ++E+DLA
Sbjct  1    MDYGAGHEASVSGNDVNVDDLEVESSIACNLGSVSSDGVVVGELRHLGE-VLTRVELDLA  59

Query  346  GSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsv  525
             +SEKL NL VL M V T+E+EFEAF +E+E +S   ++KAME  LL  + D+E+ EL  
Sbjct  60   CASEKLVNLNVLMMRVATKESEFEAFASEEEHTSAYYLEKAMELSLLFGIXDAELSELEK  119

Query  526  llsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            L++ LQ EI  ++ I+ S    GE   VIEEKL D+E
Sbjct  120  LMAVLQTEITSAQGILSSYTYLGETVAVIEEKLXDSE  156



>ref|XP_007151430.1| hypothetical protein PHAVU_004G045500g [Phaseolus vulgaris]
 gb|ESW23424.1| hypothetical protein PHAVU_004G045500g [Phaseolus vulgaris]
Length=560

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = +1

Query  259  DVIVS--SGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAE  432
            DV+VS  SG  M +LG +   ++ ++++ +AG SEK++NL +  M+VET E EFEA V +
Sbjct  16   DVVVSPSSGNVMGDLGDVCSRMLTRLDLGVAGFSEKVSNLSIFVMYVETMECEFEALVLK  75

Query  433  KEQSSNDS-VQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGV  609
            KE+  +   ++K + F+LLSV+LDSEVREL  +L++LQ  +G +R+ + S    GE +  
Sbjct  76   KEEEDHTGCLEKGVMFDLLSVVLDSEVRELGEVLNTLQGWVGEARERVCSYTHLGEAFVA  135

Query  610  IEEKLNDAE  636
            +++KL D E
Sbjct  136  MQDKLVDYE  144



>ref|XP_011462968.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=626

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 79/140 (56%), Gaps = 14/140 (10%)
 Frame = +1

Query  259  DVIVSSGE-----TMQELGSIEE---------EVIAKIEVDLAGSSEKLANLGVLKMHVE  396
            DV VSS E     T QE+ S E          +V+ K+++DLA S+EKLANL  L M + 
Sbjct  8    DVSVSSPEFEISHTDQEVSSNESGAQDLESSMKVLTKVDLDLAYSAEKLANLQALMMRLF  67

Query  397  TRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIP  576
            ++EN+ EA          D  +K + F LLS +LDSEVRE+   + +LQ EI  +R  I 
Sbjct  68   SQENDLEAMATANNYILADFHEKVLVFNLLSSILDSEVREMESFMDTLQAEIVGARHTIF  127

Query  577  SCEDAGELYGVIEEKLNDAE  636
            SC   GE Y  +EEKL D+E
Sbjct  128  SCSHLGEQYTAMEEKLYDSE  147



>ref|XP_011021128.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Populus 
euphratica]
 ref|XP_011021129.1| PREDICTED: WPP domain-interacting tail-anchored protein 1 [Populus 
euphratica]
Length=705

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 71/111 (64%), Gaps = 10/111 (9%)
 Frame = +1

Query  316  VIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSN----DSVQKAMEFel  483
            ++  +E+DLA  +EKL NL VL MHV T+E +FEAF      SSN    DSV+KA+EF+ 
Sbjct  52   ILTGVELDLACVAEKLVNLSVLMMHVATKETDFEAFA-----SSNDILADSVEKALEFDF  106

Query  484  lsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE  636
            LS +LD+E  EL  L+ ++Q  I    +II S    GE +  +EEKL+D++
Sbjct  107  LSEILDAETMELDKLMMNIQNYIFEVGEIISS-NGPGETFMALEEKLHDSQ  156



>ref|XP_002514564.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47670.1| conserved hypothetical protein [Ricinus communis]
Length=601

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 75/123 (61%), Gaps = 2/123 (2%)
 Frame = +1

Query  268  VSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSS  447
            +S G   Q++ S  E V+ + ++DL  SSEKL NL  L MH+   +N  E  +AE    S
Sbjct  26   LSGGRGTQDIESTME-VLTRADLDLGFSSEKLVNLHGLLMHLLAWDNNLEV-MAEYSYIS  83

Query  448  NDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLN  627
              SV++A+EF+LLS +LDSE+R +     ++Q EI  +R  I SC  + +L  +IE+KL 
Sbjct  84   ATSVERALEFDLLSGILDSELRVVENFTDNIQAEIVDARHKISSCRHSAKLVAIIEKKLR  143

Query  628  DAE  636
            D+E
Sbjct  144  DSE  146



>ref|XP_010915281.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010915282.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Elaeis guineensis]
Length=688

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  265  IVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK-EQ  441
            I +SGE + +  ++E  V+ ++E+DLA SSEKL NL +L M V +R ++ EA + E  E 
Sbjct  4    ITASGERVSKGTAME--VLTRVELDLAYSSEKLLNLEMLFMQVSSRASDIEALITEYVED  61

Query  442  SSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGV-IEE  618
             SN+S++KA EF+ LS +L++EV+EL   +SSLQ+EI  + Q +   ++  E     IEE
Sbjct  62   ISNESIEKAFEFDALSGILNTEVKELDNFMSSLQLEIVDAHQKLSHRDNRLEEQSTEIEE  121

Query  619  KLNDAE  636
            KL+DA+
Sbjct  122  KLHDAQ  127



>ref|XP_010915283.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X2 [Elaeis guineensis]
Length=633

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  265  IVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK-EQ  441
            I +SGE + +  ++E  V+ ++E+DLA SSEKL NL +L M V +R ++ EA + E  E 
Sbjct  4    ITASGERVSKGTAME--VLTRVELDLAYSSEKLLNLEMLFMQVSSRASDIEALITEYVED  61

Query  442  SSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGV-IEE  618
             SN+S++KA EF+ LS +L++EV+EL   +SSLQ+EI  + Q +   ++  E     IEE
Sbjct  62   ISNESIEKAFEFDALSGILNTEVKELDNFMSSLQLEIVDAHQKLSHRDNRLEEQSTEIEE  121

Query  619  KLNDAE  636
            KL+DA+
Sbjct  122  KLHDAQ  127



>ref|XP_010915284.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X3 [Elaeis guineensis]
Length=632

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  265  IVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK-EQ  441
            I +SGE + +  ++E  V+ ++E+DLA SSEKL NL +L M V +R ++ EA + E  E 
Sbjct  4    ITASGERVSKGTAME--VLTRVELDLAYSSEKLLNLEMLFMQVSSRASDIEALITEYVED  61

Query  442  SSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGV-IEE  618
             SN+S++KA EF+ LS +L++EV+EL   +SSLQ+EI  + Q +   ++  E     IEE
Sbjct  62   ISNESIEKAFEFDALSGILNTEVKELDNFMSSLQLEIVDAHQKLSHRDNRLEEQSTEIEE  121

Query  619  KLNDAE  636
            KL+DA+
Sbjct  122  KLHDAQ  127



>emb|CDX97101.1| BnaC09g45240D [Brassica napus]
Length=660

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 74/115 (64%), Gaps = 7/115 (6%)
 Frame = +1

Query  301  SIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAE-KEQSSNDSVQKAMEF  477
            S   +V+ K+E+D A  SEKL NL +L M + +RE++FE+F +  KE+  +D  +KA+EF
Sbjct  48   STASQVLIKVELDFAFVSEKLVNLSLLTMQLGSREHDFESFASHNKEEEDDDLAEKALEF  107

Query  478  ellsvlldsevrelsvllsslQMEIGYSR--QIIPSCEDAGELYGVIEEKLNDAE  636
            +LLS  L+SEV+E+  L+  LQ EI  +R   I P  +D G+L G    K +DAE
Sbjct  108  DLLSSFLNSEVKEVESLVGFLQNEIQNARVTMISPFQDDDGDLEG----KFHDAE  158



>ref|XP_004137264.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
[Cucumis sativus]
Length=534

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSND  453
            EVI ++E+D+A +SEKL NL VL M + TRE+EFEAF  E +    D
Sbjct  41   EVITRLELDVARASEKLVNLNVLMMRIATRESEFEAFALENDHMGTD  87



>ref|XP_009611110.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 [Nicotiana 
tomentosiformis]
 ref|XP_009611111.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 [Nicotiana 
tomentosiformis]
 ref|XP_009611112.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 [Nicotiana 
tomentosiformis]
Length=698

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 76/122 (62%), Gaps = 2/122 (2%)
 Frame = +1

Query  271  SSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSN  450
            S  + M+E+ S   E+++++++DLA S EKLANL  L M + T ENE EA   E +  S 
Sbjct  28   SEAKEMEEMRS-SMEILSRVDLDLAYSDEKLANLDNLLMRILTWENEVEAISFENDDISP  86

Query  451  DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLND  630
            DS++K +  + LS +L SE+R+L   + +LQ  +  +RQ I +C +  +L+ ++E K +D
Sbjct  87   DSIEKVLALDHLSSILSSEIRQLDNFIGTLQDLVTGARQKI-TCRELNDLHVIMENKFHD  145

Query  631  AE  636
             E
Sbjct  146  TE  147



>ref|XP_006844124.1| hypothetical protein AMTR_s00006p00257300 [Amborella trichopoda]
 gb|ERN05799.1| hypothetical protein AMTR_s00006p00257300 [Amborella trichopoda]
Length=637

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  313  EVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAMEF  477
            E++ ++E+D+A SSEK+ NL +  +HV  R  E+E F   KE    DSV+KA+EF
Sbjct  42   ELLTRVELDVACSSEKVQNLEIFFIHVAARAGEYEDFATRKEDILEDSVEKALEF  96



>ref|XP_008782515.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X1 [Phoenix dactylifera]
Length=677

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 81/125 (65%), Gaps = 3/125 (2%)
 Frame = +1

Query  265  IVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK-EQ  441
            I +SGE + +  ++E  V+ ++E+DLA SSEKL NL +L + V +R ++ +A + E  E 
Sbjct  4    ITASGERVSKESAME--VLTRVELDLAYSSEKLLNLEMLFLQVSSRASDIDAPITEYLED  61

Query  442  SSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEK  621
             SN+S++KA EF+ LS +L++EV+EL   +SSLQMEI  + Q +   +   E    IE K
Sbjct  62   ISNESIEKAFEFDALSGILNTEVKELDSFMSSLQMEIMDAHQKLSHSDHLEESTIEIEGK  121

Query  622  LNDAE  636
             +DA+
Sbjct  122  FHDAQ  126



>ref|XP_004239005.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 [Solanum 
lycopersicum]
 ref|XP_010320814.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 [Solanum 
lycopersicum]
Length=702

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = +1

Query  271  SSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSN  450
            S  + M+E+ S   E+++++++DLA S EKL NL  L M V   ENE EA   E ++ S 
Sbjct  29   SEAKDMEEMRS-SMEILSRVDLDLAYSDEKLTNLDNLLMRVLACENEVEAISFENDEISP  87

Query  451  DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLND  630
            +S++K +  + LS++L+SE+R+L   L +LQ  +  +RQ IP+  +  EL+ ++E K +D
Sbjct  88   ESIEKVLSLDHLSIILNSEIRQLDNFLGTLQDLVIEARQKIPTRREFSELHVIMENKFHD  147

Query  631  AE  636
             E
Sbjct  148  TE  149



>ref|XP_008782516.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like 
isoform X2 [Phoenix dactylifera]
Length=621

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 81/125 (65%), Gaps = 3/125 (2%)
 Frame = +1

Query  265  IVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK-EQ  441
            I +SGE + +  ++E  V+ ++E+DLA SSEKL NL +L + V +R ++ +A + E  E 
Sbjct  4    ITASGERVSKESAME--VLTRVELDLAYSSEKLLNLEMLFLQVSSRASDIDAPITEYLED  61

Query  442  SSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEK  621
             SN+S++KA EF+ LS +L++EV+EL   +SSLQMEI  + Q +   +   E    IE K
Sbjct  62   ISNESIEKAFEFDALSGILNTEVKELDSFMSSLQMEIMDAHQKLSHSDHLEESTIEIEGK  121

Query  622  LNDAE  636
             +DA+
Sbjct  122  FHDAQ  126



>gb|KDO70219.1| hypothetical protein CISIN_1g005569mg [Citrus sinensis]
 gb|KDO70221.1| hypothetical protein CISIN_1g005569mg [Citrus sinensis]
 gb|KDO70222.1| hypothetical protein CISIN_1g005569mg [Citrus sinensis]
 gb|KDO70223.1| hypothetical protein CISIN_1g005569mg [Citrus sinensis]
Length=670

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 86/148 (58%), Gaps = 6/148 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELG-SIEEEVIAKIEVDLAGSSEKLANLGVL  381
            D+ C G  E +   +   +V +SSG  MQE        V+ ++++DLA SSEKL NL VL
Sbjct  9    DDTCIGNPEPDKGYLH--EVTLSSGIDMQEKQIDCTMTVLTRVDLDLAYSSEKLVNLHVL  66

Query  382  KMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYS  561
             M++  R ++ E  V E    +  S++KA+ ++LL  +LDSE+RE+  LL ++ +EI   
Sbjct  67   LMYLLARGDDLETLVMENSDVAATSIEKALVYDLLFGILDSELREVERLLDTIHVEIVNV  126

Query  562  RQIIPSCEDAGELYGV---IEEKLNDAE  636
               I SC+   E++ +   +E+KL+D E
Sbjct  127  HHKISSCKHLREVFTIMEKMEKKLHDCE  154



>gb|KDO70218.1| hypothetical protein CISIN_1g005569mg [Citrus sinensis]
Length=658

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 86/148 (58%), Gaps = 6/148 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELG-SIEEEVIAKIEVDLAGSSEKLANLGVL  381
            D+ C G  E +   +   +V +SSG  MQE        V+ ++++DLA SSEKL NL VL
Sbjct  9    DDTCIGNPEPDKGYLH--EVTLSSGIDMQEKQIDCTMTVLTRVDLDLAYSSEKLVNLHVL  66

Query  382  KMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYS  561
             M++  R ++ E  V E    +  S++KA+ ++LL  +LDSE+RE+  LL ++ +EI   
Sbjct  67   LMYLLARGDDLETLVMENSDVAATSIEKALVYDLLFGILDSELREVERLLDTIHVEIVNV  126

Query  562  RQIIPSCEDAGELYGV---IEEKLNDAE  636
               I SC+   E++ +   +E+KL+D E
Sbjct  127  HHKISSCKHLREVFTIMEKMEKKLHDCE  154



>gb|KDO70216.1| hypothetical protein CISIN_1g005569mg [Citrus sinensis]
Length=690

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 86/148 (58%), Gaps = 6/148 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELG-SIEEEVIAKIEVDLAGSSEKLANLGVL  381
            D+ C G  E +   +   +V +SSG  MQE        V+ ++++DLA SSEKL NL VL
Sbjct  9    DDTCIGNPEPDKGYLH--EVTLSSGIDMQEKQIDCTMTVLTRVDLDLAYSSEKLVNLHVL  66

Query  382  KMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYS  561
             M++  R ++ E  V E    +  S++KA+ ++LL  +LDSE+RE+  LL ++ +EI   
Sbjct  67   LMYLLARGDDLETLVMENSDVAATSIEKALVYDLLFGILDSELREVERLLDTIHVEIVNV  126

Query  562  RQIIPSCEDAGELYGV---IEEKLNDAE  636
               I SC+   E++ +   +E+KL+D E
Sbjct  127  HHKISSCKHLREVFTIMEKMEKKLHDCE  154



>ref|XP_006484283.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X2 [Citrus sinensis]
Length=685

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 86/148 (58%), Gaps = 6/148 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELG-SIEEEVIAKIEVDLAGSSEKLANLGVL  381
            D+ C G  E +   +   +V +SSG  MQE        V+ ++++DLA SSEKL NL VL
Sbjct  9    DDTCIGNPEPDKGCLH--EVTLSSGIDMQEKQIDCTMTVLTRVDLDLAYSSEKLVNLHVL  66

Query  382  KMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYS  561
             M++  R ++ E  V E    S  S++KA+ ++LL  +LDSE+RE+  LL ++ +EI   
Sbjct  67   LMYLLARGDDLETLVMENSDVSATSIEKALVYDLLFGILDSELREVERLLDTIHVEIVDV  126

Query  562  RQIIPSCEDAGELYGV---IEEKLNDAE  636
               I SC+   E++ +   +E+KL+D E
Sbjct  127  HHKISSCKHLREVFTIMEKMEKKLHDCE  154



>ref|XP_006484282.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X1 [Citrus sinensis]
Length=691

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 86/148 (58%), Gaps = 6/148 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELG-SIEEEVIAKIEVDLAGSSEKLANLGVL  381
            D+ C G  E +   +   +V +SSG  MQE        V+ ++++DLA SSEKL NL VL
Sbjct  9    DDTCIGNPEPDKGCLH--EVTLSSGIDMQEKQIDCTMTVLTRVDLDLAYSSEKLVNLHVL  66

Query  382  KMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYS  561
             M++  R ++ E  V E    S  S++KA+ ++LL  +LDSE+RE+  LL ++ +EI   
Sbjct  67   LMYLLARGDDLETLVMENSDVSATSIEKALVYDLLFGILDSELREVERLLDTIHVEIVDV  126

Query  562  RQIIPSCEDAGELYGV---IEEKLNDAE  636
               I SC+   E++ +   +E+KL+D E
Sbjct  127  HHKISSCKHLREVFTIMEKMEKKLHDCE  154



>ref|XP_006484284.1| PREDICTED: WPP domain-interacting tail-anchored protein 2-like 
isoform X3 [Citrus sinensis]
Length=621

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 79/130 (61%), Gaps = 4/130 (3%)
 Frame = +1

Query  259  DVIVSSGETMQELG-SIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEK  435
            +V +SSG  MQE        V+ ++++DLA SSEKL NL VL M++  R ++ E  V E 
Sbjct  25   EVTLSSGIDMQEKQIDCTMTVLTRVDLDLAYSSEKLVNLHVLLMYLLARGDDLETLVMEN  84

Query  436  EQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGV--  609
               S  S++KA+ ++LL  +LDSE+RE+  LL ++ +EI      I SC+   E++ +  
Sbjct  85   SDVSATSIEKALVYDLLFGILDSELREVERLLDTIHVEIVDVHHKISSCKHLREVFTIME  144

Query  610  -IEEKLNDAE  636
             +E+KL+D E
Sbjct  145  KMEKKLHDCE  154



>gb|KDO70227.1| hypothetical protein CISIN_1g005569mg [Citrus sinensis]
Length=563

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 86/148 (58%), Gaps = 6/148 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELG-SIEEEVIAKIEVDLAGSSEKLANLGVL  381
            D+ C G  E +   +   +V +SSG  MQE        V+ ++++DLA SSEKL NL VL
Sbjct  9    DDTCIGNPEPDKGYLH--EVTLSSGIDMQEKQIDCTMTVLTRVDLDLAYSSEKLVNLHVL  66

Query  382  KMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYS  561
             M++  R ++ E  V E    +  S++KA+ ++LL  +LDSE+RE+  LL ++ +EI   
Sbjct  67   LMYLLARGDDLETLVMENSDVAATSIEKALVYDLLFGILDSELREVERLLDTIHVEIVNV  126

Query  562  RQIIPSCEDAGELYGV---IEEKLNDAE  636
               I SC+   E++ +   +E+KL+D E
Sbjct  127  HHKISSCKHLREVFTIMEKMEKKLHDCE  154



>gb|KDO70220.1| hypothetical protein CISIN_1g005569mg [Citrus sinensis]
Length=630

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 86/148 (58%), Gaps = 6/148 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELG-SIEEEVIAKIEVDLAGSSEKLANLGVL  381
            D+ C G  E +   +   +V +SSG  MQE        V+ ++++DLA SSEKL NL VL
Sbjct  9    DDTCIGNPEPDKGYLH--EVTLSSGIDMQEKQIDCTMTVLTRVDLDLAYSSEKLVNLHVL  66

Query  382  KMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYS  561
             M++  R ++ E  V E    +  S++KA+ ++LL  +LDSE+RE+  LL ++ +EI   
Sbjct  67   LMYLLARGDDLETLVMENSDVAATSIEKALVYDLLFGILDSELREVERLLDTIHVEIVNV  126

Query  562  RQIIPSCEDAGELYGV---IEEKLNDAE  636
               I SC+   E++ +   +E+KL+D E
Sbjct  127  HHKISSCKHLREVFTIMEKMEKKLHDCE  154



>gb|KDO70226.1| hypothetical protein CISIN_1g005569mg [Citrus sinensis]
Length=621

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 86/148 (58%), Gaps = 6/148 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELG-SIEEEVIAKIEVDLAGSSEKLANLGVL  381
            D+ C G  E +   +   +V +SSG  MQE        V+ ++++DLA SSEKL NL VL
Sbjct  9    DDTCIGNPEPDKGYLH--EVTLSSGIDMQEKQIDCTMTVLTRVDLDLAYSSEKLVNLHVL  66

Query  382  KMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYS  561
             M++  R ++ E  V E    +  S++KA+ ++LL  +LDSE+RE+  LL ++ +EI   
Sbjct  67   LMYLLARGDDLETLVMENSDVAATSIEKALVYDLLFGILDSELREVERLLDTIHVEIVNV  126

Query  562  RQIIPSCEDAGELYGV---IEEKLNDAE  636
               I SC+   E++ +   +E+KL+D E
Sbjct  127  HHKISSCKHLREVFTIMEKMEKKLHDCE  154



>gb|KDO70217.1| hypothetical protein CISIN_1g005569mg [Citrus sinensis]
Length=623

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 86/148 (58%), Gaps = 6/148 (4%)
 Frame = +1

Query  205  DEHCSGELEEESKNVDSLDVIVSSGETMQELG-SIEEEVIAKIEVDLAGSSEKLANLGVL  381
            D+ C G  E +   +   +V +SSG  MQE        V+ ++++DLA SSEKL NL VL
Sbjct  9    DDTCIGNPEPDKGYLH--EVTLSSGIDMQEKQIDCTMTVLTRVDLDLAYSSEKLVNLHVL  66

Query  382  KMHVETRENEFEAFVAEKEQSSNDSVQKAMEFellsvlldsevrelsvllsslQMEIGYS  561
             M++  R ++ E  V E    +  S++KA+ ++LL  +LDSE+RE+  LL ++ +EI   
Sbjct  67   LMYLLARGDDLETLVMENSDVAATSIEKALVYDLLFGILDSELREVERLLDTIHVEIVNV  126

Query  562  RQIIPSCEDAGELYGV---IEEKLNDAE  636
               I SC+   E++ +   +E+KL+D E
Sbjct  127  HHKISSCKHLREVFTIMEKMEKKLHDCE  154



>ref|XP_009800081.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 [Nicotiana 
sylvestris]
 ref|XP_009800082.1| PREDICTED: WPP domain-interacting tail-anchored protein 2 [Nicotiana 
sylvestris]
Length=699

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 73/122 (60%), Gaps = 2/122 (2%)
 Frame = +1

Query  271  SSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSN  450
            S  + M+E+ S   E++ ++++DLA S EKL NL  L MH+ T ENE E    E +  S 
Sbjct  29   SEAKEMEEMRS-SMEILNRVDLDLAYSDEKLTNLDNLLMHILTWENEVETISFENDDISP  87

Query  451  DSVQKAMEFellsvlldsevrelsvllsslQMEIGYSRQIIPSCEDAGELYGVIEEKLND  630
            DS++K +  + LS +L SE+R+L   + +LQ  I  +RQ I +C +  +L  ++E K +D
Sbjct  88   DSIEKILVLDHLSSILSSEIRQLDNFIGTLQDLITGARQKI-TCRELSDLDMIMENKFHD  146

Query  631  AE  636
             E
Sbjct  147  TE  148



Lambda      K        H        a         alpha
   0.314    0.132    0.361    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750