BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF023O23

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36508.1|  hypothetical protein MIMGU_mgv1a008665mg                183   3e-52   Erythranthe guttata [common monkey flower]
gb|AFK36862.1|  unknown                                                 174   1e-51   Lotus japonicus
gb|KGN60339.1|  hypothetical protein Csa_3G895850                       174   2e-50   Cucumis sativus [cucumbers]
ref|XP_004136403.1|  PREDICTED: uncharacterized methyltransferase...    175   1e-49   
gb|KHN19749.1|  Putative methyltransferase, chloroplastic               176   1e-49   Glycine soja [wild soybean]
ref|XP_003522802.1|  PREDICTED: uncharacterized methyltransferase...    176   1e-49   Glycine max [soybeans]
ref|XP_007018799.1|  S-adenosylmethionine-dependent methyltransfe...    176   2e-49   
ref|XP_002285799.1|  PREDICTED: uncharacterized methyltransferase...    174   4e-49   Vitis vinifera
ref|XP_010105909.1|  putative methyltransferase                         172   5e-49   
emb|CDP01043.1|  unnamed protein product                                174   5e-49   Coffea canephora [robusta coffee]
gb|KDO80932.1|  hypothetical protein CISIN_1g018003mg                   170   1e-48   Citrus sinensis [apfelsine]
ref|XP_010059991.1|  PREDICTED: uncharacterized methyltransferase...    174   1e-48   Eucalyptus grandis [rose gum]
ref|XP_004161765.1|  PREDICTED: uncharacterized methyltransferase...    174   1e-48   
ref|XP_006434004.1|  hypothetical protein CICLE_v10001682mg             170   1e-48   
ref|XP_011074175.1|  PREDICTED: uncharacterized methyltransferase...    173   1e-48   Sesamum indicum [beniseed]
ref|XP_004500619.1|  PREDICTED: uncharacterized methyltransferase...    172   2e-48   Cicer arietinum [garbanzo]
gb|AFK47008.1|  unknown                                                 173   2e-48   Lotus japonicus
ref|XP_009106463.1|  PREDICTED: uncharacterized methyltransferase...    172   2e-48   
ref|XP_009106462.1|  PREDICTED: uncharacterized methyltransferase...    172   2e-48   Brassica rapa
emb|CDX88421.1|  BnaC06g38650D                                          171   1e-47   
ref|XP_006472621.1|  PREDICTED: uncharacterized methyltransferase...    170   2e-47   
ref|XP_006434005.1|  hypothetical protein CICLE_v10001682mg             170   2e-47   
gb|KDO80931.1|  hypothetical protein CISIN_1g018003mg                   170   2e-47   Citrus sinensis [apfelsine]
ref|XP_006472620.1|  PREDICTED: uncharacterized methyltransferase...    170   2e-47   
ref|XP_011016296.1|  PREDICTED: uncharacterized methyltransferase...    171   2e-47   Populus euphratica
emb|CDX87473.1|  BnaA07g34000D                                          170   3e-47   
ref|XP_007136240.1|  hypothetical protein PHAVU_009G030200g             170   3e-47   Phaseolus vulgaris [French bean]
ref|XP_010269234.1|  PREDICTED: uncharacterized methyltransferase...    169   4e-47   Nelumbo nucifera [Indian lotus]
ref|XP_008466034.1|  PREDICTED: uncharacterized methyltransferase...    169   4e-47   Cucumis melo [Oriental melon]
ref|XP_007222212.1|  hypothetical protein PRUPE_ppa007824mg             169   7e-47   Prunus persica
gb|KEH34908.1|  S-adenosylmethionine-dependent methyltransferase        168   7e-47   Medicago truncatula
ref|XP_010428929.1|  PREDICTED: uncharacterized methyltransferase...    168   9e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010428930.1|  PREDICTED: uncharacterized methyltransferase...    168   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_003527908.1|  PREDICTED: uncharacterized methyltransferase...    165   1e-46   
ref|XP_002889176.1|  predicted protein                                  168   1e-46   
ref|XP_002302290.2|  hypothetical protein POPTR_0002s09570g             168   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_006390018.1|  hypothetical protein EUTSA_v10018789mg             167   2e-46   Eutrema salsugineum [saltwater cress]
gb|KDP41368.1|  hypothetical protein JCGZ_15775                         167   3e-46   Jatropha curcas
ref|XP_002513908.1|  S-adenosylmethionine-dependent methyltransfe...    167   3e-46   
ref|XP_010416782.1|  PREDICTED: uncharacterized methyltransferase...    167   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010416783.1|  PREDICTED: uncharacterized methyltransferase...    167   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_008219673.1|  PREDICTED: uncharacterized methyltransferase...    166   5e-46   Prunus mume [ume]
gb|AAG52104.1|AC012680_15  hypothetical protein; 38642-36701            165   7e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565170.1|  S-adenosyl-L-methionine-dependent methyltransfe...    166   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472019.1|  PREDICTED: uncharacterized methyltransferase...    165   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010472020.1|  PREDICTED: uncharacterized methyltransferase...    165   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004299641.1|  PREDICTED: uncharacterized methyltransferase...    165   2e-45   Fragaria vesca subsp. vesca
emb|CDY14625.1|  BnaC02g24880D                                          164   2e-45   Brassica napus [oilseed rape]
ref|XP_009128280.1|  PREDICTED: uncharacterized methyltransferase...    164   2e-45   Brassica rapa
emb|CDY26853.1|  BnaA02g18780D                                          164   2e-45   Brassica napus [oilseed rape]
gb|KJB59931.1|  hypothetical protein B456_009G281700                    164   2e-45   Gossypium raimondii
gb|KHN03912.1|  Putative methyltransferase, chloroplastic               160   3e-45   Glycine soja [wild soybean]
ref|XP_002306578.1|  methyltransferase-related family protein           161   3e-45   
gb|KJB59929.1|  hypothetical protein B456_009G281700                    164   3e-45   Gossypium raimondii
ref|XP_006300528.1|  hypothetical protein CARUB_v10020572mg             164   3e-45   
gb|KCW67137.1|  hypothetical protein EUGRSUZ_F00926                     162   5e-45   Eucalyptus grandis [rose gum]
ref|XP_010061813.1|  PREDICTED: uncharacterized methyltransferase...    163   7e-45   Eucalyptus grandis [rose gum]
ref|XP_010064389.1|  PREDICTED: uncharacterized methyltransferase...    162   2e-44   
gb|KHG01878.1|  hypothetical protein F383_23026                         162   3e-44   Gossypium arboreum [tree cotton]
ref|XP_006386404.1|  hypothetical protein POPTR_0002s09570g             161   5e-44   
gb|KDO80930.1|  hypothetical protein CISIN_1g018003mg                   160   5e-44   Citrus sinensis [apfelsine]
ref|XP_010064206.1|  PREDICTED: uncharacterized methyltransferase...    160   8e-44   Eucalyptus grandis [rose gum]
ref|XP_010667997.1|  PREDICTED: uncharacterized methyltransferase...    160   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010937469.1|  PREDICTED: uncharacterized methyltransferase...    158   5e-43   Elaeis guineensis
ref|XP_009373157.1|  PREDICTED: uncharacterized methyltransferase...    158   8e-43   Pyrus x bretschneideri [bai li]
ref|XP_008391145.1|  PREDICTED: uncharacterized methyltransferase...    155   2e-42   
ref|XP_008391080.1|  PREDICTED: uncharacterized methyltransferase...    156   3e-42   
ref|XP_008374488.1|  PREDICTED: uncharacterized methyltransferase...    156   4e-42   
ref|XP_008374425.1|  PREDICTED: uncharacterized methyltransferase...    156   4e-42   
ref|XP_010534071.1|  PREDICTED: uncharacterized methyltransferase...    155   1e-41   
ref|XP_010534070.1|  PREDICTED: uncharacterized methyltransferase...    154   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_008808068.1|  PREDICTED: uncharacterized methyltransferase...    153   4e-41   Phoenix dactylifera
ref|XP_009394964.1|  PREDICTED: uncharacterized methyltransferase...    151   4e-40   
ref|XP_009394965.1|  PREDICTED: uncharacterized methyltransferase...    150   5e-40   
ref|XP_010939635.1|  PREDICTED: uncharacterized methyltransferase...    148   2e-39   Elaeis guineensis
gb|KJB14720.1|  hypothetical protein B456_002G140100                    149   5e-39   Gossypium raimondii
ref|XP_008790838.1|  PREDICTED: uncharacterized methyltransferase...    145   2e-38   Phoenix dactylifera
ref|XP_008790837.1|  PREDICTED: uncharacterized methyltransferase...    146   2e-38   
ref|XP_009386973.1|  PREDICTED: uncharacterized methyltransferase...    135   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928270.1|  PREDICTED: uncharacterized methyltransferase...    134   6e-34   
ref|XP_010928269.1|  PREDICTED: uncharacterized methyltransferase...    134   6e-34   
ref|NP_001061786.1|  Os08g0411200                                       134   1e-33   
ref|XP_010928268.1|  PREDICTED: uncharacterized methyltransferase...    133   2e-33   
ref|XP_010928267.1|  PREDICTED: uncharacterized methyltransferase...    133   2e-33   Elaeis guineensis
ref|XP_008788786.1|  PREDICTED: uncharacterized methyltransferase...    133   2e-33   
gb|EEE68668.1|  hypothetical protein OsJ_27281                          133   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659389.1|  PREDICTED: uncharacterized methyltransferase...    132   3e-33   
ref|XP_002445476.1|  hypothetical protein SORBIDRAFT_07g020130          132   4e-33   Sorghum bicolor [broomcorn]
ref|NP_001150427.1|  S-adenosylmethionine-dependent methyltransfe...    132   5e-33   Zea mays [maize]
ref|XP_003574470.1|  PREDICTED: uncharacterized methyltransferase...    131   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_004973409.1|  PREDICTED: uncharacterized methyltransferase...    130   2e-32   Setaria italica
gb|EEE66113.1|  hypothetical protein OsJ_22149                          128   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563313.1|  PREDICTED: uncharacterized methyltransferase...    130   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_004974685.1|  PREDICTED: uncharacterized methyltransferase...    129   5e-32   
ref|XP_004488470.1|  PREDICTED: uncharacterized methyltransferase...    128   1e-31   Cicer arietinum [garbanzo]
gb|AFW76188.1|  hypothetical protein ZEAMMB73_680706                    125   2e-31   
ref|NP_001058196.1|  Os06g0646000                                       128   2e-31   
ref|XP_004965743.1|  PREDICTED: uncharacterized methyltransferase...    125   9e-31   Setaria italica
dbj|BAJ94151.1|  predicted protein                                      125   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91607.1|  predicted protein                                      125   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006657188.1|  PREDICTED: uncharacterized methyltransferase...    125   1e-30   
ref|XP_002438745.1|  hypothetical protein SORBIDRAFT_10g025400          125   2e-30   Sorghum bicolor [broomcorn]
gb|ACG27569.1|  S-adenosylmethionine-dependent methyltransferase        124   3e-30   Zea mays [maize]
ref|XP_011470644.1|  PREDICTED: uncharacterized methyltransferase...    124   3e-30   Fragaria vesca subsp. vesca
gb|ACF85541.1|  unknown                                                 124   3e-30   Zea mays [maize]
ref|XP_004965742.1|  PREDICTED: uncharacterized methyltransferase...    124   3e-30   Setaria italica
gb|EMT30153.1|  Putative methyltransferase                              125   3e-30   
ref|NP_001132053.1|  uncharacterized LOC100193465                       124   3e-30   Zea mays [maize]
gb|EMT07919.1|  Putative methyltransferase                              124   3e-30   
ref|XP_011470680.1|  PREDICTED: uncharacterized methyltransferase...    123   6e-30   Fragaria vesca subsp. vesca
ref|XP_004287240.1|  PREDICTED: uncharacterized methyltransferase...    123   6e-30   Fragaria vesca subsp. vesca
gb|EMT00494.1|  Putative methyltransferase                              124   1e-29   
ref|XP_011017926.1|  PREDICTED: uncharacterized methyltransferase...    122   1e-29   Populus euphratica
ref|XP_010099510.1|  putative methyltransferase                         122   3e-29   Morus notabilis
ref|XP_008336947.1|  PREDICTED: uncharacterized methyltransferase...    120   5e-29   
ref|XP_011078555.1|  PREDICTED: uncharacterized methyltransferase...    120   6e-29   Sesamum indicum [beniseed]
ref|XP_003546595.1|  PREDICTED: uncharacterized methyltransferase...    120   7e-29   Glycine max [soybeans]
gb|KDP30197.1|  hypothetical protein JCGZ_16979                         120   1e-28   Jatropha curcas
ref|XP_002268107.1|  PREDICTED: uncharacterized methyltransferase...    120   1e-28   Vitis vinifera
ref|XP_002324579.2|  methyltransferase-related family protein           119   2e-28   
emb|CDP10502.1|  unnamed protein product                                119   3e-28   Coffea canephora [robusta coffee]
ref|XP_010050326.1|  PREDICTED: uncharacterized methyltransferase...    119   3e-28   Eucalyptus grandis [rose gum]
gb|EYU34934.1|  hypothetical protein MIMGU_mgv1a009522mg                119   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_006381066.1|  methyltransferase-related family protein           118   3e-28   
ref|XP_006586686.1|  PREDICTED: uncharacterized protein LOC100798...    118   5e-28   Glycine max [soybeans]
ref|XP_002988667.1|  hypothetical protein SELMODRAFT_46133              117   5e-28   
ref|XP_011020252.1|  PREDICTED: uncharacterized methyltransferase...    118   6e-28   Populus euphratica
gb|KHN28439.1|  Putative methyltransferase, chloroplastic               118   6e-28   Glycine soja [wild soybean]
ref|NP_001242875.1|  uncharacterized protein LOC100798970               118   6e-28   
gb|KJB53960.1|  hypothetical protein B456_009G013400                    117   6e-28   Gossypium raimondii
ref|XP_008242913.1|  PREDICTED: uncharacterized methyltransferase...    116   7e-28   
gb|KEH37884.1|  S-adenosylmethionine-dependent methyltransferase        117   8e-28   Medicago truncatula
gb|KJB53958.1|  hypothetical protein B456_009G013400                    117   1e-27   Gossypium raimondii
ref|XP_007013645.1|  S-adenosyl-L-methionine-dependent methyltran...    117   1e-27   
ref|XP_008336950.1|  PREDICTED: uncharacterized methyltransferase...    117   1e-27   
ref|XP_002531454.1|  phosphatidylethanolamine n-methyltransferase...    116   1e-27   
ref|XP_002986403.1|  hypothetical protein SELMODRAFT_235009             117   2e-27   Selaginella moellendorffii
gb|KHG21340.1|  hypothetical protein F383_03824                         117   2e-27   Gossypium arboreum [tree cotton]
ref|XP_008456635.1|  PREDICTED: uncharacterized methyltransferase...    116   2e-27   Cucumis melo [Oriental melon]
gb|ACJ84583.1|  unknown                                                 116   3e-27   Medicago truncatula
emb|CBI25578.3|  unnamed protein product                                116   3e-27   Vitis vinifera
ref|XP_002268200.1|  PREDICTED: uncharacterized methyltransferase...    116   3e-27   Vitis vinifera
ref|XP_010656529.1|  PREDICTED: uncharacterized methyltransferase...    116   4e-27   Vitis vinifera
ref|XP_007202300.1|  hypothetical protein PRUPE_ppa007882mg             116   4e-27   Prunus persica
gb|AFK46366.1|  unknown                                                 115   6e-27   Medicago truncatula
ref|XP_008344066.1|  PREDICTED: uncharacterized methyltransferase...    115   6e-27   
ref|XP_009338403.1|  PREDICTED: uncharacterized methyltransferase...    115   7e-27   Pyrus x bretschneideri [bai li]
ref|XP_009358530.1|  PREDICTED: uncharacterized methyltransferase...    115   8e-27   
ref|XP_010687777.1|  PREDICTED: uncharacterized methyltransferase...    115   9e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO59312.1|  hypothetical protein CISIN_1g019950mg                   114   1e-26   Citrus sinensis [apfelsine]
ref|XP_006453728.1|  hypothetical protein CICLE_v10008875mg             114   1e-26   Citrus clementina [clementine]
gb|KDO59313.1|  hypothetical protein CISIN_1g019950mg                   114   1e-26   Citrus sinensis [apfelsine]
ref|XP_004139262.1|  PREDICTED: uncharacterized methyltransferase...    114   1e-26   Cucumis sativus [cucumbers]
ref|XP_010047200.1|  PREDICTED: uncharacterized methyltransferase...    114   2e-26   Eucalyptus grandis [rose gum]
ref|XP_006473930.1|  PREDICTED: uncharacterized methyltransferase...    114   2e-26   
ref|XP_004167998.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    114   2e-26   
gb|EMT14235.1|  Putative methyltransferase                              114   2e-26   
gb|KJB27062.1|  hypothetical protein B456_004G275300                    114   2e-26   Gossypium raimondii
ref|XP_006411367.1|  hypothetical protein EUTSA_v10016844mg             114   2e-26   Eutrema salsugineum [saltwater cress]
ref|XP_009141962.1|  PREDICTED: uncharacterized methyltransferase...    114   2e-26   Brassica rapa
ref|XP_008456627.1|  PREDICTED: uncharacterized methyltransferase...    113   3e-26   Cucumis melo [Oriental melon]
ref|XP_009338401.1|  PREDICTED: uncharacterized methyltransferase...    113   3e-26   Pyrus x bretschneideri [bai li]
emb|CDY06948.1|  BnaA04g23670D                                          116   3e-26   
gb|KHG26587.1|  hypothetical protein F383_01046                         113   4e-26   Gossypium arboreum [tree cotton]
ref|XP_009337420.1|  PREDICTED: uncharacterized methyltransferase...    106   8e-26   Pyrus x bretschneideri [bai li]
ref|XP_010533098.1|  PREDICTED: uncharacterized methyltransferase...    112   9e-26   Tarenaya hassleriana [spider flower]
emb|CDY57579.1|  BnaC04g56820D                                          112   1e-25   Brassica napus [oilseed rape]
ref|XP_009337419.1|  PREDICTED: uncharacterized methyltransferase...    106   2e-25   Pyrus x bretschneideri [bai li]
gb|KGN60753.1|  hypothetical protein Csa_2G009410                       111   2e-25   Cucumis sativus [cucumbers]
ref|XP_004287239.1|  PREDICTED: uncharacterized methyltransferase...    110   2e-25   Fragaria vesca subsp. vesca
ref|XP_009602551.1|  PREDICTED: uncharacterized methyltransferase...    107   4e-25   
ref|XP_009802104.1|  PREDICTED: uncharacterized methyltransferase...    110   6e-25   Nicotiana sylvestris
ref|XP_008348560.1|  PREDICTED: uncharacterized methyltransferase...    110   9e-25   
ref|NP_181637.2|  uncharacterized methyltransferase                     109   9e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879904.1|  hypothetical protein ARALYDRAFT_903411             109   1e-24   
ref|XP_010517586.1|  PREDICTED: uncharacterized methyltransferase...    109   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010508773.1|  PREDICTED: uncharacterized methyltransferase...    109   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006293382.1|  hypothetical protein CARUB_v10023510mg             108   1e-24   Capsella rubella
ref|XP_008336951.1|  PREDICTED: uncharacterized methyltransferase...    108   1e-24   
ref|XP_010505866.1|  PREDICTED: uncharacterized methyltransferase...    108   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009363912.1|  PREDICTED: uncharacterized methyltransferase...    108   2e-24   Pyrus x bretschneideri [bai li]
gb|KFK36957.1|  hypothetical protein AALP_AA4G194500                    108   3e-24   Arabis alpina [alpine rockcress]
ref|XP_003056709.1|  predicted protein                                  107   4e-24   Micromonas pusilla CCMP1545
ref|XP_006852799.1|  hypothetical protein AMTR_s00033p00159870          107   5e-24   
ref|XP_008374562.1|  PREDICTED: uncharacterized methyltransferase...    106   9e-24   
ref|XP_006359517.1|  PREDICTED: uncharacterized methyltransferase...    106   1e-23   Solanum tuberosum [potatoes]
ref|XP_001778776.1|  predicted protein                                  105   1e-23   
gb|EEC83568.1|  hypothetical protein OsI_29220                          105   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_004242719.1|  PREDICTED: uncharacterized methyltransferase...    103   9e-23   Solanum lycopersicum
ref|XP_007510827.1|  predicted protein                                  103   2e-22   Bathycoccus prasinos
ref|XP_004242718.1|  PREDICTED: uncharacterized methyltransferase...    102   2e-22   Solanum lycopersicum
gb|KDO80933.1|  hypothetical protein CISIN_1g018003mg                   102   2e-22   Citrus sinensis [apfelsine]
gb|KIY98469.1|  putative methyltransferase                              101   2e-22   Monoraphidium neglectum
ref|XP_002954755.1|  hypothetical protein VOLCADRAFT_106536             100   1e-21   Volvox carteri f. nagariensis
ref|XP_006359516.1|  PREDICTED: uncharacterized methyltransferase...  98.6    6e-21   Solanum tuberosum [potatoes]
ref|XP_002506188.1|  predicted protein                                98.2    8e-21   Micromonas commoda
ref|XP_009394966.1|  PREDICTED: uncharacterized methyltransferase...  96.3    3e-20   
gb|ABR16838.1|  unknown                                               96.3    4e-20   Picea sitchensis
ref|XP_001418638.1|  predicted protein                                94.7    5e-20   Ostreococcus lucimarinus CCE9901
ref|XP_002968407.1|  hypothetical protein SELMODRAFT_89857            94.7    1e-19   
ref|XP_003080221.1|  methyltransferase-related (ISS)                  93.2    6e-19   Ostreococcus tauri
ref|XP_001694737.1|  predicted protein                                90.5    2e-18   Chlamydomonas reinhardtii
ref|XP_002500021.1|  predicted protein                                87.0    8e-17   Micromonas commoda
dbj|BAC99645.1|  hypothetical protein                                 84.7    3e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CAN77779.1|  hypothetical protein VITISV_004172                   86.7    5e-16   Vitis vinifera
ref|XP_007227385.1|  hypothetical protein PRUPE_ppb016862mg           82.4    1e-15   
gb|KDO59315.1|  hypothetical protein CISIN_1g019950mg                 82.4    2e-15   Citrus sinensis [apfelsine]
gb|KJB27061.1|  hypothetical protein B456_004G275300                  82.4    2e-15   Gossypium raimondii
gb|KDO59316.1|  hypothetical protein CISIN_1g019950mg                 82.4    2e-15   Citrus sinensis [apfelsine]
gb|KCW79026.1|  hypothetical protein EUGRSUZ_C00449                   81.6    4e-15   Eucalyptus grandis [rose gum]
gb|KCW79027.1|  hypothetical protein EUGRSUZ_C00449                   81.3    5e-15   Eucalyptus grandis [rose gum]
ref|XP_005643537.1|  S-adenosyl-L-methionine-dependent methyltran...  80.9    1e-14   Coccomyxa subellipsoidea C-169
ref|XP_002967385.1|  hypothetical protein SELMODRAFT_408369           82.0    2e-14   
gb|EMS47735.1|  hypothetical protein TRIUR3_02804                     77.4    6e-14   Triticum urartu
ref|XP_002502147.1|  predicted protein                                72.0    2e-11   Micromonas commoda
ref|XP_005536724.1|  hypothetical protein, conserved                  70.5    8e-11   Cyanidioschyzon merolae strain 10D
ref|XP_003057905.1|  predicted protein                                67.4    1e-10   Micromonas pusilla CCMP1545
ref|XP_002960327.1|  hypothetical protein SELMODRAFT_402502           68.2    5e-10   
ref|XP_005824779.1|  hypothetical protein GUITHDRAFT_116106           67.0    8e-10   Guillardia theta CCMP2712
ref|XP_002185698.1|  predicted protein                                64.3    7e-09   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_010250394.1|  PREDICTED: uncharacterized protein LOC104592660  64.7    8e-09   
ref|XP_007514982.1|  predicted protein                                63.5    1e-08   Bathycoccus prasinos
ref|XP_002992310.1|  hypothetical protein SELMODRAFT_430530           61.2    2e-08   
ref|XP_005713645.1|  unnamed protein product                          61.6    4e-08   Chondrus crispus [carageen]
gb|EWM24600.1|  phosphatidylethanolamine n                            62.0    4e-08   Nannochloropsis gaditana
ref|XP_005855405.1|  hypothetical protein NGA_2005920                 62.0    4e-08   Nannochloropsis gaditana CCMP526
gb|EJK66010.1|  hypothetical protein THAOC_13088                      61.6    7e-08   Thalassiosira oceanica
ref|XP_002503324.1|  chloroplast envelope protein translocase family  60.5    2e-07   Micromonas commoda
ref|XP_005781281.1|  hypothetical protein EMIHUDRAFT_442892           60.1    2e-07   Emiliania huxleyi CCMP1516
emb|CBJ26935.1|  S-adenosyl-L-methionine-dependent methyltransfer...  59.7    3e-07   Ectocarpus siliculosus
ref|WP_037584032.1|  hypothetical protein                             57.8    6e-07   
gb|ADO73882.1|  Methyltransferase type 11                             57.8    7e-07   Stigmatella aurantiaca DW4/3-1
gb|KIE07218.1|  hypothetical protein DA73_0239355                     56.6    2e-06   Tolypothrix bouteillei VB521301
ref|XP_005705444.1|  phosphatidylethanolamine n-methyltransferase...  56.2    3e-06   Galdieria sulphuraria
ref|XP_010040339.1|  PREDICTED: uncharacterized methyltransferase...  55.5    5e-06   Eucalyptus grandis [rose gum]
gb|KJB59930.1|  hypothetical protein B456_009G281700                  54.3    1e-05   Gossypium raimondii
ref|WP_044509270.1|  SAM-dependent methyltransferase                  53.9    2e-05   Mycobacterium simiae
ref|XP_008389527.1|  PREDICTED: uncharacterized methyltransferase...  54.3    2e-05   
ref|XP_003079346.1|  non-transporter ABC protein (ISS)                54.7    2e-05   
emb|CEF97980.1|  Methyltransferase type 11                            53.9    2e-05   Ostreococcus tauri
ref|WP_014739643.1|  ubiquinone biosynthesis methyltransferase UbiE   53.1    2e-05   Modestobacter marinus
ref|WP_022122196.1|  hypothetical protein                             53.1    2e-05   
ref|WP_042432128.1|  methyltransferase                                52.4    2e-05   Clostridium jeddahense
ref|WP_043403276.1|  hypothetical protein                             53.1    2e-05   
ref|WP_011557522.1|  MULTISPECIES: SAM-dependent methyltransferase    53.1    3e-05   Mycobacteriaceae
gb|KFA90141.1|  hypothetical protein Q664_29640                       53.1    3e-05   Archangium violaceum Cb vi76
ref|WP_006242682.1|  SAM-dependent methyltransferase                  53.1    3e-05   Mycolicibacterium tusciae
ref|WP_009647626.1|  SAM-dependent methyltransferase                  52.4    3e-05   Actinomyces sp. ICM47
ref|WP_033335056.1|  hypothetical protein                             50.4    3e-05   
ref|XP_003056909.1|  predicted protein                                53.5    3e-05   Micromonas pusilla CCMP1545
ref|WP_003790083.1|  SAM-dependent methyltransferase                  52.4    3e-05   Actinomyces odontolyticus
ref|WP_009254158.1|  MULTISPECIES: methyltransferase                  52.4    3e-05   Clostridiales
gb|AAD12007.1|  hypothetical protein                                  53.1    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|WP_003794338.1|  SAM-dependent methyltransferase                  52.4    4e-05   Actinomyces odontolyticus
ref|WP_036550599.1|  hypothetical protein                             52.4    4e-05   
ref|WP_034465932.1|  SAM-dependent methyltransferase                  52.0    4e-05   Actinomyces sp. ICM54
ref|WP_005984449.1|  SAM-dependent methyltransferase                  52.0    5e-05   Actinomyces graevenitzii
ref|XP_006434006.1|  hypothetical protein CICLE_v10001682mg           52.8    6e-05   
gb|KDO59317.1|  hypothetical protein CISIN_1g019950mg                 52.4    7e-05   Citrus sinensis [apfelsine]
ref|WP_018358192.1|  hypothetical protein                             51.6    7e-05   Porphyromonas levii
gb|KJB53959.1|  hypothetical protein B456_009G013400                  52.0    8e-05   Gossypium raimondii
ref|WP_006617666.1|  methyltransferase type 11                        51.2    9e-05   Arthrospira platensis
ref|WP_032076775.1|  ubiquinone/menaquinone biosynthesis protein      51.2    9e-05   Clostridium drakei
gb|AJR18080.1|  methyltransferase                                     51.6    1e-04   Pimelobacter simplex
gb|AEJ88263.1|  putative S-adenosylmethionine-dependent methyltra...  51.6    1e-04   Wolffia arrhiza
ref|WP_028655549.1|  hypothetical protein                             50.8    1e-04   
ref|WP_007577247.1|  putative methyltransferase                       51.6    1e-04   
ref|WP_022382324.1|  hypothetical protein                             51.2    1e-04   Dialister sp. Marseille-P5638
ref|WP_020074409.1|  methyltransferase [                              50.8    1e-04   [Clostridium] sporosphaeroides
ref|WP_040710863.1|  SAM-dependent methyltransferase                  50.8    1e-04   Nocardia takedensis
ref|WP_021591497.1|  hypothetical protein                             50.4    1e-04   Actinomadura madurae
ref|WP_006905290.1|  type 11 methyltransferase                        50.1    2e-04   Shuttleworthia
ref|WP_024984910.1|  methylase                                        50.8    2e-04   Brevibacillus borstelensis
gb|ACV59992.1|  Methyltransferase type 11                             50.8    2e-04   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
ref|WP_041554685.1|  hypothetical protein                             48.9    2e-04   
ref|WP_033359706.1|  hypothetical protein                             50.8    3e-04   Dactylosporangium aurantiacum
ref|WP_008521718.1|  MULTISPECIES: methyltransferase                  50.1    3e-04   Jonquetella
gb|EEJ52634.1|  methyltransferase domain protein                      50.1    3e-04   Oribacterium sinus F0268
ref|WP_007588477.1|  SAM-dependent methyltransferase                  49.7    3e-04   Actinomyces sp. ICM39
ref|WP_036227573.1|  hypothetical protein                             49.3    3e-04   
ref|WP_023347129.1|  hypothetical protein                             49.7    3e-04   
ref|WP_018511596.1|  methyltransferase                                50.1    3e-04   
ref|WP_003387235.1|  hypothetical protein                             50.4    3e-04   
ref|WP_043644505.1|  hypothetical protein                             49.3    3e-04   
ref|WP_008332456.1|  methyltransferase, UbiE/COQ5 family protein      49.7    3e-04   
ref|WP_043106945.1|  malonyl-CoA O-methyltransferase                  50.1    4e-04   
ref|WP_017662802.1|  hypothetical protein                             49.7    4e-04   
gb|AFR47307.1|  Methyltransferase                                     49.7    4e-04   
ref|WP_022107680.1|  methyltransferase domain protein                 49.7    4e-04   
ref|WP_010842823.1|  Methyltransferase                                49.7    4e-04   
ref|WP_014902748.1|  methyltransferase                                49.7    4e-04   
ref|WP_044505825.1|  methyltransferase type 11                        49.7    4e-04   
ref|WP_027728386.1|  SAM-dependent methyltransferase                  49.3    4e-04   
ref|WP_034501983.1|  SAM-dependent methyltransferase                  49.3    4e-04   
gb|ACL04197.1|  Methyltransferase type 11                             50.1    4e-04   
ref|WP_013330439.1|  type 11 methyltransferase                        49.7    4e-04   
ref|WP_035316534.1|  methyltransferase                                49.3    4e-04   
ref|WP_006695867.1|  methyltransferase                                49.3    5e-04   
gb|EJF41683.1|  methyltransferase domain protein                      49.7    5e-04   
ref|WP_044543828.1|  SAM-dependent methyltransferase                  49.3    6e-04   
ref|WP_006694759.1|  methyltransferase                                48.9    6e-04   
ref|WP_040692770.1|  hypothetical protein                             49.3    6e-04   
ref|WP_032753181.1|  methyltransferase                                49.3    6e-04   
ref|WP_038683354.1|  hypothetical protein                             47.4    7e-04   
ref|WP_015608375.1|  Methyltransferase type 11                        49.3    7e-04   
ref|WP_020681005.1|  hypothetical protein                             48.9    7e-04   
ref|WP_037908141.1|  methyltransferase                                49.3    7e-04   
ref|WP_022848725.1|  type 11 methyltransferase                        48.9    7e-04   
ref|WP_035783042.1|  ubiquinone biosynthesis methyltransferase UbiE   48.1    7e-04   
ref|WP_037345954.1|  hypothetical protein                             47.8    9e-04   
ref|WP_014184768.1|  methyltransferase                                48.5    9e-04   
ref|WP_023863049.1|  SAM-dependent methyltransferase                  47.0    0.001   
ref|WP_013624051.1|  methyltransferase                                48.5    0.001   
ref|WP_016521175.1|  hypothetical protein                             48.5    0.001   
gb|AFS14590.1|  Ubiquinone/menaquinone biosynthesis methyl transf...  48.5    0.001   
ref|WP_007722294.1|  methylase                                        48.9    0.001   
ref|WP_011323603.1|  S-adenosylmethionine-dependent methyltransfe...  48.1    0.001   



>gb|EYU36508.1| hypothetical protein MIMGU_mgv1a008665mg [Erythranthe guttata]
Length=366

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAALHCWPSPS+AVAEISRVL+PGG+FVATTYIVDG++S+ P  RPL
Sbjct  258  LPFPSSSVDAVHAGAALHCWPSPSSAVAEISRVLKPGGMFVATTYIVDGLFSYLPLSRPL  317

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+N AQISGSH+FL EKELE+LCT+CGLV F   RNR F+M++AMKP
Sbjct  318  RQNIAQISGSHVFLSEKELEELCTSCGLVNFTSTRNRMFVMISAMKP  364



>gb|AFK36862.1| unknown [Lotus japonicus]
Length=132

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF +SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI+DG ++F PF+  +
Sbjct  25   LPFVTSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYILDGPFTFVPFLSTV  84

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+N  Q SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KP
Sbjct  85   RQNIRQASGSYIFLSERELEDLCRACGLVGFKCIRNGPFVMISAAKP  131



>gb|KGN60339.1| hypothetical protein Csa_3G895850 [Cucumis sativus]
Length=220

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSSVDAVHAGAALHCWPSPSAAVAEISR+LRPGGVFVA+T+I+DG YSF PF+R  
Sbjct  113  LPFASSSVDAVHAGAALHCWPSPSAAVAEISRILRPGGVFVASTFIMDGPYSFVPFLRIQ  172

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             E   QISGS IFL E+ELE+LCT CGLV FKC+RNR+F+ML+A K S
Sbjct  173  IEGIQQISGSRIFLSERELEELCTACGLVDFKCLRNRQFVMLSATKCS  220



>ref|XP_004136403.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=313

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSSVDAVHAGAALHCWPSPSAAVAEISR+LRPGGVFVA+T+I+DG YSF PF+R  
Sbjct  206  LPFASSSVDAVHAGAALHCWPSPSAAVAEISRILRPGGVFVASTFIMDGPYSFVPFLRIQ  265

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             E   QISGS IFL E+ELE+LCT CGLV FKC+RNR+F+ML+A K S
Sbjct  266  IEGIQQISGSRIFLSERELEELCTACGLVDFKCLRNRQFVMLSATKCS  313



>gb|KHN19749.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=353

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAALHCWPSP AAVAEISRVLRPGGVFVATTYI+DG +S  PF+  L
Sbjct  246  LPFVSSSVDAVHAGAALHCWPSPLAAVAEISRVLRPGGVFVATTYILDGPFSVIPFLSSL  305

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  Q+SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KPS
Sbjct  306  RQNVRQVSGSYIFLSERELEDLCRACGLVGFKCIRNGLFVMISATKPS  353



>ref|XP_003522802.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=352

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAALHCWPSP AAVAEISRVLRPGGVFVATTYI+DG +S  PF+  L
Sbjct  245  LPFVSSSVDAVHAGAALHCWPSPLAAVAEISRVLRPGGVFVATTYILDGPFSVIPFLSSL  304

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  Q+SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KPS
Sbjct  305  RQNVRQVSGSYIFLSERELEDLCRACGLVGFKCIRNGLFVMISATKPS  352



>ref|XP_007018799.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
 gb|EOY16024.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
Length=366

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTYI+DG + F PF+R  
Sbjct  259  LPFKSSSVDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYILDGPFGFVPFLRTF  318

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N   I+GSHIFL E+EL+DLC TCGLVGF C+RN  F+M++A KPS
Sbjct  319  RQNIMGIAGSHIFLSERELKDLCRTCGLVGFTCVRNGLFVMISARKPS  366



>ref|XP_002285799.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Vitis vinifera]
 emb|CBI19149.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSSVDAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTY++DG +S  PF++ L
Sbjct  243  LPFASSSVDAVHAGAALHCWPSPSIAVAEISRVLRPGGVFVATTYLLDGPFSVLPFLKTL  302

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  +++GSH FL E+ELEDLCT CGL GF C+RN RF+M++A KPS
Sbjct  303  RQNMVRVAGSHAFLSERELEDLCTACGLGGFTCVRNGRFVMISATKPS  350



>ref|XP_010105909.1| putative methyltransferase [Morus notabilis]
 gb|EXC06728.1| putative methyltransferase [Morus notabilis]
Length=266

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSS+DAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI+DG ++F PF+R L
Sbjct  159  LPFVSSSIDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYILDGPFTFVPFLREL  218

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   QISG++ FL E+ELEDLC  CGLVGF C+RN  F+M++A KP+
Sbjct  219  RQYTRQISGNYSFLSERELEDLCKACGLVGFTCVRNGAFVMISATKPT  266



>emb|CDP01043.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFAS +VDAVHAGAALHCWPSPS AVAEISRVLRPGG+FVATTYI+DG++S+ P V PL
Sbjct  251  LPFASGTVDAVHAGAALHCWPSPSVAVAEISRVLRPGGMFVATTYILDGLFSYIPLVGPL  310

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+N AQ+SGSH+FL  KELEDLCT CGLV  K  RNR F+M+ A KP
Sbjct  311  RQNVAQVSGSHVFLSNKELEDLCTACGLVDAKVTRNRMFVMICATKP  357



>gb|KDO80932.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=235

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIVDG ++  PF R L
Sbjct  126  LPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLL  185

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KPS
Sbjct  186  RQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKPS  233



>ref|XP_010059991.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66499.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
 gb|KCW66500.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
Length=364

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFAS S+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTY++DG ++  P +RPL
Sbjct  257  LPFASGSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYLLDGPFALFPLLRPL  316

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             +N +QISGSHIFL E ELEDLC TCGL+GFK +RN RF+M++A +P
Sbjct  317  CQNISQISGSHIFLSEGELEDLCRTCGLIGFKFLRNERFVMISASRP  363



>ref|XP_004161765.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=376

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSSVDAVHAGAALHCWPSPSAAVAEISR+LRPGGVFVA+T+I+DG YSF PF+R  
Sbjct  269  LPFASSSVDAVHAGAALHCWPSPSAAVAEISRILRPGGVFVASTFIMDGPYSFVPFLRIQ  328

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             E   QISGS IFL E+ELE+LCT CGLV FKC+RNR+F+ML+A K S
Sbjct  329  IEGIQQISGSRIFLSERELEELCTACGLVDFKCLRNRQFVMLSATKCS  376



>ref|XP_006434004.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47244.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=233

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIVDG ++  PF R L
Sbjct  126  LPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLL  185

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KPS
Sbjct  186  RQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKPS  233



>ref|XP_011074175.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Sesamum indicum]
Length=360

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASS+VDAVHAGAALHCWPSPSA VAEISRVL+PGG+FVA+TYI DG+ S+ P    L
Sbjct  253  LPFASSTVDAVHAGAALHCWPSPSAGVAEISRVLKPGGMFVASTYIADGLVSYIPLRGAL  312

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+N AQ SGSH+FL + ELEDLC +CGL+ F C RNRRF+ML+AMKP
Sbjct  313  RQNIAQFSGSHVFLSDTELEDLCKSCGLIDFTCTRNRRFVMLSAMKP  359



>ref|XP_004500619.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cicer arietinum]
Length=338

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI+DG ++  PF+  L
Sbjct  231  LPFVSSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYILDGPFTPVPFLSTL  290

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+N  Q+SGS+IFL E+ELE LC  CGLVGFKCIRN  F+M++A KP
Sbjct  291  RQNIRQVSGSYIFLSERELEALCKACGLVGFKCIRNGLFVMISATKP  337



>gb|AFK47008.1| unknown [Lotus japonicus]
Length=352

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF +SSVDAVHAGAALHCWPSPSA VAEISRVLRPGGVFVATTYI+DG ++F PF+  +
Sbjct  245  LPFVTSSVDAVHAGAALHCWPSPSAVVAEISRVLRPGGVFVATTYILDGPFTFVPFLSTV  304

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+N  Q SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KP
Sbjct  305  RQNIRQASGSYIFLSERELEDLCRACGLVGFKCIRNGPFVMISAAKP  351



>ref|XP_009106463.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=337

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG++ F PF++ L
Sbjct  229  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGLFRFVPFLKEL  288

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   + SGSH+FL E+ELEDLC +CGLVGF C+RN  FIML+A KP+
Sbjct  289  RQEIMRYSGSHMFLSERELEDLCKSCGLVGFTCVRNGLFIMLSATKPT  336



>ref|XP_009106462.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=348

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG++ F PF++ L
Sbjct  240  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGLFRFVPFLKEL  299

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   + SGSH+FL E+ELEDLC +CGLVGF C+RN  FIML+A KP+
Sbjct  300  RQEIMRYSGSHMFLSERELEDLCKSCGLVGFTCVRNGLFIMLSATKPT  347



>emb|CDX88421.1| BnaC06g38650D [Brassica napus]
Length=353

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG+  F PF++ L
Sbjct  240  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGLVRFVPFLKEL  299

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS*LL  333
            R+     SGSH+FL E+ELEDLC +CGLVGF C+RN  FIML+A KP+ +L
Sbjct  300  RQEVMGYSGSHMFLSERELEDLCKSCGLVGFTCVRNGLFIMLSATKPTDML  350



>ref|XP_006472621.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=333

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SS+DAVHAGAA+HCWPSPS  VAEISRVLRPGGVFV TTYI DG ++  PF R L
Sbjct  224  LPFAASSIDAVHAGAAIHCWPSPSTGVAEISRVLRPGGVFVGTTYIFDGPFNLIPFSRLL  283

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KPS
Sbjct  284  RQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKPS  331



>ref|XP_006434005.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 ref|XP_006434007.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47245.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47247.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=349

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIVDG ++  PF R L
Sbjct  242  LPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLL  301

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KPS
Sbjct  302  RQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKPS  349



>gb|KDO80931.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=351

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIVDG ++  PF R L
Sbjct  242  LPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLL  301

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KPS
Sbjct  302  RQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKPS  349



>ref|XP_006472620.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=351

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SS+DAVHAGAA+HCWPSPS  VAEISRVLRPGGVFV TTYI DG ++  PF R L
Sbjct  242  LPFAASSIDAVHAGAAIHCWPSPSTGVAEISRVLRPGGVFVGTTYIFDGPFNLIPFSRLL  301

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KPS
Sbjct  302  RQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKPS  349



>ref|XP_011016296.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Populus euphratica]
Length=379

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHAGAA+HCWPSPSAAVAE+SRVLRPGGVFVATTYI+DG +SF PF++P+
Sbjct  272  LPFVSGSLDAVHAGAAIHCWPSPSAAVAEVSRVLRPGGVFVATTYILDGPFSFIPFLKPI  331

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             + F Q+SGS+ FL E+ELE +C  CGLV F C RNR+FIM +A KPS
Sbjct  332  SQRFTQVSGSNFFLSERELEAVCRACGLVNFTCTRNRQFIMFSATKPS  379



>emb|CDX87473.1| BnaA07g34000D [Brassica napus]
Length=356

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S  VDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG++ F PF++ L
Sbjct  248  LPFLSGVVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGLFRFVPFLKKL  307

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   + SGSH+FL E+ELEDLC +CGLVGF C+RN  FIML+A KP+
Sbjct  308  RQEVMRYSGSHMFLSERELEDLCESCGLVGFTCVRNGLFIMLSATKPT  355



>ref|XP_007136240.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
 gb|ESW08234.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
Length=376

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S+SVDAVHAGAALHCWPSP AAVAEISRVLRPGGVFVATTYI+DG  S  PF   L
Sbjct  269  LPFVSNSVDAVHAGAALHCWPSPLAAVAEISRVLRPGGVFVATTYILDGPLSVIPFRSTL  328

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  Q SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KPS
Sbjct  329  RQNIRQASGSYIFLSERELEDLCRACGLVGFKCIRNGLFVMISARKPS  376



>ref|XP_010269234.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Nelumbo nucifera]
Length=349

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSS+DAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGI    P  R L
Sbjct  242  LPFVSSSIDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIVGALPVSRIL  301

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   QIS SHIFL E+ELEDLC  CGLVGF C RN  FIM++A KP+
Sbjct  302  RQYIGQISSSHIFLSERELEDLCKACGLVGFTCTRNGPFIMMSATKPT  349



>ref|XP_008466034.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Cucumis melo]
Length=356

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSSVDAVHAGAA+HCWPSPSA VAEISR+LRPGGVFVA+T+I+DG +SF PF+R  
Sbjct  249  LPFASSSVDAVHAGAAVHCWPSPSAGVAEISRILRPGGVFVASTFIMDGPFSFVPFLRIQ  308

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             E   QI+GS IFL E+ELE+LCT CGLV FKC+RNR+F+ML+A K S
Sbjct  309  IEGIQQIAGSRIFLSERELEELCTACGLVDFKCLRNRQFVMLSATKRS  356



>ref|XP_007222212.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
 gb|EMJ23411.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
Length=354

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SSVDAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTYI+DG  S+ PF+R +
Sbjct  247  LPFATSSVDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYILDGPLSYIPFLRNI  306

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             +   QISGS IF  E+ELEDLC  CGLVG+ C+RN  F+M++A KPS
Sbjct  307  TQRTKQISGSQIFTSERELEDLCKACGLVGYTCVRNGLFVMISATKPS  354



>gb|KEH34908.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSS+DAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI+DG ++  PF+  L
Sbjct  235  LPFVSSSIDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYILDGPFTIVPFLSTL  294

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+   Q+SG + FL E+ELE LC TCGLVGFKCIRN  F+M++A KP
Sbjct  295  RQTINQVSGIYTFLSERELEALCKTCGLVGFKCIRNGPFVMISAAKP  341



>ref|XP_010428929.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=356

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG++SF PFV+  
Sbjct  249  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGLFSFIPFVKNF  308

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  309  RQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  355



>ref|XP_010428930.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=355

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG++SF PFV+  
Sbjct  248  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGLFSFIPFVKNF  307

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  308  RQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  354



>ref|XP_003527908.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=248

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAALHCWPSP A VAEISRVLRPGGVFV TTY++DG +S  PF+  L
Sbjct  141  LPFVSSSVDAVHAGAALHCWPSPIAVVAEISRVLRPGGVFVVTTYMLDGPFSVIPFLSTL  200

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  Q+SGS+IFL E+ELED C  CGLVGFKCIRN  F M++A KPS
Sbjct  201  RQNARQVSGSYIFLSERELEDHCRACGLVGFKCIRNGLFEMISATKPS  248



>ref|XP_002889176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ L
Sbjct  245  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNL  304

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   + SGSH+FL+E+ELEDLC  CGLVGF  +RN  FIML+A KPS
Sbjct  305  RQELMRYSGSHMFLNERELEDLCKACGLVGFTRVRNGPFIMLSATKPS  352



>ref|XP_002302290.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|EEE81563.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=349

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHAGAA+HCWPSPSAAVAE+SRVLRPGGVFVATTYI+DG +SF PF++P+
Sbjct  242  LPFVSGSLDAVHAGAAIHCWPSPSAAVAEVSRVLRPGGVFVATTYILDGPFSFIPFLKPI  301

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             + F Q SG++ FL E+ELE +C  CGLV F C RNR+FIM +A KPS
Sbjct  302  SQRFTQASGNNFFLSERELEAVCRACGLVNFTCTRNRQFIMFSATKPS  349



>ref|XP_006390018.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
 gb|ESQ27304.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
Length=351

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVL+PGGVFVATT+I DG +SF PF++ +
Sbjct  243  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLKPGGVFVATTFIYDGPFSFIPFLKNI  302

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   + SGSHIFL E+EL+D+C  CGLVGF C+RN  FIML+A KPS
Sbjct  303  RQEIMRYSGSHIFLSERELKDICGACGLVGFTCVRNGPFIMLSATKPS  350



>gb|KDP41368.1| hypothetical protein JCGZ_15775 [Jatropha curcas]
Length=350

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAA+HCWPSPS AVAEISRVLRPGGV VA+TYI+DG ++F P + PL
Sbjct  243  LPFRSGSVDAVHAGAAIHCWPSPSVAVAEISRVLRPGGVLVASTYILDGPFNFVPLLGPL  302

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+N AQ+SGS IFL E+ELED+C  CGLVGF   RNR+F+M +A KP
Sbjct  303  RQNIAQVSGSQIFLRERELEDICRACGLVGFTATRNRQFVMFSARKP  349



>ref|XP_002513908.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48491.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=351

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF   SVDAVHAGAA+HCWPSPSAAVAEISRVLRPGGVFVA+T+I+DG +SF P + PL
Sbjct  244  LPFLFGSVDAVHAGAAIHCWPSPSAAVAEISRVLRPGGVFVASTFILDGPFSFVPLMGPL  303

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+N AQISGS IFL E ELED+C  CGLVGF  IR+R+F+M +A KP
Sbjct  304  RQNIAQISGSQIFLREYELEDICRACGLVGFTAIRDRQFVMFSARKP  350



>ref|XP_010416782.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=360

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG++SF PF++  
Sbjct  253  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGLFSFIPFLKNF  312

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  313  RQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  359



>ref|XP_010416783.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=359

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG++SF PF++  
Sbjct  252  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGLFSFIPFLKNF  311

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  312  RQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  358



>ref|XP_008219673.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Prunus mume]
Length=354

 Score =   166 bits (421),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SSVDAVHAGAALHCWPSP+  VAEISRVLRPGGVFVATTYI+DG  S+ PF+R +
Sbjct  247  LPFATSSVDAVHAGAALHCWPSPATGVAEISRVLRPGGVFVATTYILDGPLSYIPFLRNI  306

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             +   QISGS IF  E+ELEDLC  CGLVG+ C+RN  F+M++A KPS
Sbjct  307  TQRTKQISGSQIFTSERELEDLCKACGLVGYTCVRNGLFVMISATKPS  354



>gb|AAG52104.1|AC012680_15 hypothetical protein; 38642-36701 [Arabidopsis thaliana]
Length=317

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ L
Sbjct  210  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNL  269

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   + SGSHIFL+E+ELED+C  CGLV F  +RN  FIML+A KPS
Sbjct  270  RQEIMRYSGSHIFLNERELEDICKACGLVNFTRVRNGPFIMLSATKPS  317



>ref|NP_565170.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q8LBV4.1|Y1814_ARATH RecName: Full=Uncharacterized methyltransferase At1g78140, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM64539.1| unknown [Arabidopsis thaliana]
 gb|AAO42148.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50518.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36071.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=355

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ L
Sbjct  248  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNL  307

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   + SGSHIFL+E+ELED+C  CGLV F  +RN  FIML+A KPS
Sbjct  308  RQEIMRYSGSHIFLNERELEDICKACGLVNFTRVRNGPFIMLSATKPS  355



>ref|XP_010472019.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=357

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++  
Sbjct  250  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNF  309

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  310  RQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  356



>ref|XP_010472020.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=356

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++  
Sbjct  249  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNF  308

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  309  RQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  355



>ref|XP_004299641.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=345

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SS+DAVHAGAA+HCWPSP+ AVAEISRVLRPGGVFVATTYI+DG ++F PF+R  
Sbjct  238  LPFATSSIDAVHAGAAIHCWPSPTGAVAEISRVLRPGGVFVATTYILDGPFAFVPFLREG  297

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             +   Q+SGS IFL E ELED+CT CGLVG   +RNR+F+M++A KPS
Sbjct  298  TKRARQVSGSQIFLSEGELEDICTACGLVGVTVVRNRQFVMISATKPS  345



>emb|CDY14625.1| BnaC02g24880D [Brassica napus]
Length=339

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ L
Sbjct  231  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNL  290

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   + SGSHIFL E+ELEDLC   GLVGF  +RN  FIML+A KPS
Sbjct  291  RQELMRYSGSHIFLSERELEDLCKAGGLVGFTRVRNGLFIMLSATKPS  338



>ref|XP_009128280.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Brassica rapa]
Length=341

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ L
Sbjct  233  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNL  292

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   + SGSHIFL E+ELEDLC   GLVGF  +RN  FIML+A KPS
Sbjct  293  RQELMRYSGSHIFLSERELEDLCKAGGLVGFTRVRNGLFIMLSATKPS  340



>emb|CDY26853.1| BnaA02g18780D [Brassica napus]
Length=341

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ L
Sbjct  233  LPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNL  292

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+   + SGSHIFL E+ELEDLC   GLVGF  +RN  FIML+A KPS
Sbjct  293  RQELMRYSGSHIFLSERELEDLCKAGGLVGFTRVRNGLFIMLSATKPS  340



>gb|KJB59931.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=339

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTYIVDG ++F PFV   
Sbjct  231  LPFESSSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYIVDGPFTFLPFVNAF  290

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N   I+GS+  + E+ELEDLC TCGLVGF C+RN  F+M++A K S
Sbjct  291  RQNMMGIAGSYFAVSERELEDLCRTCGLVGFTCMRNGPFVMISARKRS  338



>gb|KHN03912.1| Putative methyltransferase, chloroplastic, partial [Glycine soja]
Length=213

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAALHCWPSP  AVAEISRVLRPGGVFV TTY++DG +S  PF+  L
Sbjct  107  LPFVSSSVDAVHAGAALHCWPSP-IAVAEISRVLRPGGVFVVTTYMLDGPFSVIPFLSTL  165

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N  Q+SGS+IFL E+ELED C  CGLVGFKCIRN  F M++A KPS
Sbjct  166  RQNARQVSGSYIFLSERELEDHCRACGLVGFKCIRNGLFEMISATKPS  213



>ref|XP_002306578.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEE93574.1| methyltransferase-related family protein [Populus trichocarpa]
Length=244

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAV AGAA+HCWPSPS AVAE+SRVLRPGGVFVATTYI+DG +S  PF++P+
Sbjct  137  LPFISGSLDAVPAGAAIHCWPSPSVAVAEVSRVLRPGGVFVATTYILDGHFSLIPFLKPI  196

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             + F Q+SGS+IFL E+ELED+C  CGLV F C RN RF+M +A KP
Sbjct  197  SQRFTQVSGSNIFLSERELEDVCRACGLVDFTCTRNGRFVMFSATKP  243



>gb|KJB59929.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=349

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTYIVDG ++F PFV   
Sbjct  241  LPFESSSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYIVDGPFTFLPFVNAF  300

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N   I+GS+  + E+ELEDLC TCGLVGF C+RN  F+M++A K S
Sbjct  301  RQNMMGIAGSYFAVSERELEDLCRTCGLVGFTCMRNGPFVMISARKRS  348



>ref|XP_006300528.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
 gb|EOA33426.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
Length=348

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ L
Sbjct  239  LPFLSGSLDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNL  298

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            R+ F   SGSH+FL E+ELEDLC  CGLVGF  +RN  FIML+A K
Sbjct  299  RQEFMSYSGSHVFLSERELEDLCKACGLVGFTRVRNGPFIMLSATK  344



>gb|KCW67137.1| hypothetical protein EUGRSUZ_F00926, partial [Eucalyptus grandis]
Length=294

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSS+DAVHAGAALHCWPSPS A+AEISRVLRPGGVFVATT+++DG  +  P +RPL
Sbjct  187  LPFASSSIDAVHAGAALHCWPSPSTAIAEISRVLRPGGVFVATTFLLDGPSALFPLLRPL  246

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             +   Q+SGSHIFL E ELE LC TCGL+G K +RN RF+M++A KPS
Sbjct  247  CQISTQLSGSHIFLSEGELEGLCRTCGLIGVKFVRNERFVMISASKPS  294



>ref|XP_010061813.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW68836.1| hypothetical protein EUGRSUZ_F02436 [Eucalyptus grandis]
Length=346

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAA+HCW SPS+AVAEISRVLRPGG+FVATT+I DG Y+  PF + +
Sbjct  239  LPFVSSSVDAVHAGAAVHCWSSPSSAVAEISRVLRPGGIFVATTFIYDGPYALNPFSKLM  298

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            ++N  +ISG   FL E ELEDLC TCGL  FKC RNRRF+M++A KPS
Sbjct  299  QKNMFRISGGQFFLSEHELEDLCKTCGLEDFKCTRNRRFVMISATKPS  346



>ref|XP_010064389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
Length=354

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSS+DAVHAGAALHCWPSPS A+AEISRVLRPGGVFVATT+++DG  +  P +RPL
Sbjct  247  LPFASSSIDAVHAGAALHCWPSPSTAIAEISRVLRPGGVFVATTFLLDGPSALFPLLRPL  306

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             +   Q+SGSHIFL E ELE LC TCGL+G K +RN RF+M++A KPS
Sbjct  307  CQISTQLSGSHIFLSEGELEGLCRTCGLIGVKFVRNERFVMISASKPS  354



>gb|KHG01878.1| hypothetical protein F383_23026 [Gossypium arboreum]
Length=349

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S+S+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTYI DG ++F PFV   
Sbjct  241  LPFESNSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYIFDGPFTFLPFVNTF  300

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+N   I+GS+  + E+ELEDLC TCGLVGF C+RN  F+M++A K S
Sbjct  301  RQNMMGIAGSYFAVSEQELEDLCRTCGLVGFTCMRNGPFVMISARKRS  348



>ref|XP_006386404.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|ERP64201.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=355

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 90/114 (79%), Gaps = 6/114 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAA------VAEISRVLRPGGVFVATTYIVDGIYSFT  162
            LPF S S+DAVHAGAA+HCWPSPSAA      VAE+SRVLRPGGVFVATTYI+DG +SF 
Sbjct  242  LPFVSGSLDAVHAGAAIHCWPSPSAALFFNSQVAEVSRVLRPGGVFVATTYILDGPFSFI  301

Query  163  PFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            PF++P+ + F Q SG++ FL E+ELE +C  CGLV F C RNR+FIM +A KPS
Sbjct  302  PFLKPISQRFTQASGNNFFLSERELEAVCRACGLVNFTCTRNRQFIMFSATKPS  355



>gb|KDO80930.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=334

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  7    FASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRE  186
            F   S+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIVDG ++  PF R LR+
Sbjct  227  FPKDSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQ  286

Query  187  NFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KPS
Sbjct  287  NMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKPS  332



>ref|XP_010064206.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66498.1| hypothetical protein EUGRSUZ_F00305 [Eucalyptus grandis]
Length=354

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSS+DAVHAGAALHCWPSPS A+AEISRVLRPGGV VATT ++DG ++  P +RPL
Sbjct  247  LPFASSSIDAVHAGAALHCWPSPSTAIAEISRVLRPGGVLVATTLLLDGPFALFPLLRPL  306

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             +   Q+SGSHIF  E ELE LC TCGL+G K +RN+RF+M++A KPS
Sbjct  307  SQISTQLSGSHIFRSEGELEGLCRTCGLIGVKFVRNKRFVMISASKPS  354



>ref|XP_010667997.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=349

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHAGAALHCWPSPS A AEISR+LRPGGVFVATT I DG ++  PF    
Sbjct  242  LPFVSGSIDAVHAGAALHCWPSPSNAGAEISRILRPGGVFVATTTIGDGPFTLVPFRSNF  301

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            RE   QISGS IFL E+ELEDLCTTCGLV F+C RN  F+M++A KP+
Sbjct  302  REYLQQISGSRIFLSERELEDLCTTCGLVDFRCTRNGLFVMISATKPN  349



>ref|XP_010937469.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=345

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATT+++D I    P  R +
Sbjct  234  LPFVSSSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTFVLDTIPPAVPIFRAI  293

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            RE F++ SG H++L E ELED+C  CGL+GF CIRN  FIM++A KPS
Sbjct  294  REFFSRNSGQHLYLSEGELEDICRACGLIGFTCIRNGFFIMISATKPS  341



>ref|XP_009373157.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Pyrus x bretschneideri]
Length=348

 Score =   158 bits (399),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SSVDAVHAGAA+HCWPSPS+AVAEISRVLRPGGVFVATT+I DG +S  PF R +
Sbjct  241  LPFATSSVDAVHAGAAIHCWPSPSSAVAEISRVLRPGGVFVATTFIWDGPFSLIPFQRNI  300

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             +   Q+SG+ +F  E ELED+C  CGLVGF  +RNRRF+M++  KP
Sbjct  301  AQRTKQMSGNQLFTSESELEDICQACGLVGFTKVRNRRFVMISCTKP  347



>ref|XP_008391145.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=291

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SSVDAVHAGAA+HCWPSPS+AVAEISRVLRPGGVFVATT+I DG +S  PF R +
Sbjct  184  LPFATSSVDAVHAGAAIHCWPSPSSAVAEISRVLRPGGVFVATTFIWDGPFSLIPFQRNI  243

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             +   Q+SG+ +F  E EL+D+C  CGLVGF  +RN RF+M++A KP
Sbjct  244  AQRTKQMSGNQLFTSESELQDICQACGLVGFTKVRNGRFVMISATKP  290



>ref|XP_008391080.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=355

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+ SVDAVHAGAA+HCWPSPS AVAEISRVLRPGGVFVA+TYI+DG +S  PF+R +
Sbjct  248  LPFATGSVDAVHAGAAIHCWPSPSTAVAEISRVLRPGGVFVASTYILDGPFSLIPFLRNI  307

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             +   QISG  +F  E ELED+C  CGLV F  +RNR F+M++A KP+
Sbjct  308  TQRTKQISGGQVFTSESELEDICQACGLVXFTKVRNRLFVMISATKPT  355



>ref|XP_008374488.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Malus domestica]
Length=348

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA+TYI+DG +S  PF+R +
Sbjct  241  LPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVASTYILDGRFSLIPFLRNI  300

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
                 QISGS +F  E E EDLC  CGLVGF  +R   F+M++A KP+
Sbjct  301  TRVTKQISGSQVFTSESEFEDLCQACGLVGFTKVRYGLFVMISATKPT  348



>ref|XP_008374425.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Malus domestica]
Length=355

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA+TYI+DG +S  PF+R +
Sbjct  248  LPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVASTYILDGRFSLIPFLRNI  307

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
                 QISGS +F  E E EDLC  CGLVGF  +R   F+M++A KP+
Sbjct  308  TRVTKQISGSQVFTSESEFEDLCQACGLVGFTKVRYGLFVMISATKPT  355



>ref|XP_010534071.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=349

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSP++AVAE+SRVLRPGGVFVATT+I + + SF PF R +
Sbjct  243  LPFLSGSVDAVHAGAALHCWPSPASAVAEVSRVLRPGGVFVATTFINEPL-SFIPFSRNI  301

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+   + SGSH FL E+ELED+C  CGLVGF C+RN  FIML+A KP
Sbjct  302  RQGVIRYSGSHFFLSERELEDVCRACGLVGFNCVRNGPFIMLSATKP  348



>ref|XP_010534070.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSP++AVAE+SRVLRPGGVFVATT+I + + SF PF R +
Sbjct  250  LPFLSGSVDAVHAGAALHCWPSPASAVAEVSRVLRPGGVFVATTFINEPL-SFIPFSRNI  308

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            R+   + SGSH FL E+ELED+C  CGLVGF C+RN  FIML+A KP
Sbjct  309  RQGVIRYSGSHFFLSERELEDVCRACGLVGFNCVRNGPFIMLSATKP  355



>ref|XP_008808068.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Phoenix dactylifera]
Length=339

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATT+++D I    P  R +
Sbjct  232  LPFVSSSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTFVLDTIPPAVPIFRAI  291

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            RE + + SG H++L E ELED+C+ CGL+GF  IRN  FIM++A KP
Sbjct  292  RELYTRTSGQHLYLSEGELEDICSACGLIGFTRIRNGSFIMISATKP  338



>ref|XP_009394964.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=355

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAA+HCWPSPSA VAEISRVLRPGGVFVATT+I+D +    P ++ +
Sbjct  248  LPFVSSSVDAVHAGAAIHCWPSPSAGVAEISRVLRPGGVFVATTFILDVLPPVIPILKTV  307

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+ + + S ++++L E ELEDLC TCGLV F C+RN  F+M++A KPS
Sbjct  308  RQYYIRASSNYLYLSEGELEDLCQTCGLVNFTCVRNGPFVMISATKPS  355



>ref|XP_009394965.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=352

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAA+HCWPSPSA VAEISRVLRPGGVFVATT+I+D +    P ++ +
Sbjct  245  LPFVSSSVDAVHAGAAIHCWPSPSAGVAEISRVLRPGGVFVATTFILDVLPPVIPILKTV  304

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+ + + S ++++L E ELEDLC TCGLV F C+RN  F+M++A KPS
Sbjct  305  RQYYIRASSNYLYLSEGELEDLCQTCGLVNFTCVRNGPFVMISATKPS  352



>ref|XP_010939635.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=313

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSS+DAVHAGAALHCW SPSAAVAEISR+LRPGGVFVATT+I D I    P +R L
Sbjct  206  LPFVSSSIDAVHAGAALHCWSSPSAAVAEISRILRPGGVFVATTFIFDAIPIAVPVLRML  265

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+ +   SG ++FL E EL+DLC  CGLV   CIRNR F+M+ A KPS
Sbjct  266  RKFYIGNSGKYMFLSEGELKDLCQACGLVDVTCIRNRLFVMIAATKPS  313



>gb|KJB14720.1| hypothetical protein B456_002G140100, partial [Gossypium raimondii]
Length=386

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 86/112 (77%), Gaps = 6/112 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAA----VAEISRVLRPGGVFVATTYIVDGIYSFTPF  168
            LPF SSSVDA+HAGAALHCWPSPS A      ++ +VLRPGG+FVATTYI+DG   F PF
Sbjct  277  LPFKSSSVDALHAGAALHCWPSPSTACLLYAGQLQQVLRPGGLFVATTYILDG--PFIPF  334

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            +R   +N   I+GSH+FL E+ELEDLC TCGL+GF CIRN  F+M++A K S
Sbjct  335  LRTFHQNVMGIAGSHVFLSERELEDLCRTCGLIGFTCIRNSCFVMISARKRS  386



>ref|XP_008790838.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=313

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSS+DAVHAGAALHCW SPSAAVAEISR+LRPGGVFVATT+I D I    P +R L
Sbjct  206  LPFVSSSIDAVHAGAALHCWSSPSAAVAEISRILRPGGVFVATTFIFDVIPIAVPVLRML  265

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+ +   S ++IFL E EL+DLC  CGLVG  CIR+R F+M++A+KP+
Sbjct  266  RKFYIGNSSNYIFLSEGELKDLCEACGLVGVTCIRHRLFVMISAIKPN  313



>ref|XP_008790837.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=315

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSS+DAVHAGAALHCW SPSAAVAEISR+LRPGGVFVATT+I D I    P +R L
Sbjct  208  LPFVSSSIDAVHAGAALHCWSSPSAAVAEISRILRPGGVFVATTFIFDVIPIAVPVLRML  267

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R+ +   S ++IFL E EL+DLC  CGLVG  CIR+R F+M++A+KP+
Sbjct  268  RKFYIGNSSNYIFLSEGELKDLCEACGLVGVTCIRHRLFVMISAIKPN  315



>ref|XP_009386973.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=353

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 81/109 (74%), Gaps = 2/109 (2%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF--VR  174
            LPFAS S+DAVHAGAALHCWPSPS AVAEISRVLR GGVFVATT++V  + +  P    +
Sbjct  245  LPFASGSIDAVHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLVSPLNTPLPLEAFQ  304

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             LR++F Q++ S+ +  EKE+EDLC +CGLV +     R FIM +A KP
Sbjct  305  SLRQSFGQVTNSYNYFTEKEIEDLCRSCGLVNYTSTVRRSFIMFSAQKP  353



>ref|XP_010928270.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X4 [Elaeis guineensis]
Length=314

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR GGVFVATT++   + S  PF    
Sbjct  206  LPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLSSPLNS--PFSSGA  263

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ +     R FIM +A KP
Sbjct  264  LRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYTSKVQRSFIMFSAQKP  314



>ref|XP_010928269.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=315

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR GGVFVATT++   + S  PF    
Sbjct  207  LPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLSSPLNS--PFSSGA  264

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ +     R FIM +A KP
Sbjct  265  LRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYTSKVQRSFIMFSAQKP  315



>ref|NP_001061786.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAF23700.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAH00216.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHA AA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ D +    P +R  
Sbjct  251  LPFVSGSIDAVHAAAAIHCWPSPACAVAEISRVLRPGGVFVASTFVADILPPAVPVLRIG  310

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R   +Q +GS+IFL E E EDLC  CGL+ FK +RN  +IM +A K S
Sbjct  311  RPYISQFTGSNIFLSEAEFEDLCRACGLIDFKFVRNGFYIMFSATKAS  358



>ref|XP_010928268.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=354

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR GGVFVATT++   + S  PF    
Sbjct  246  LPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLSSPLNS--PFSSGA  303

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ +     R FIM +A KP
Sbjct  304  LRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYTSKVQRSFIMFSAQKP  354



>ref|XP_010928267.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=355

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR GGVFVATT++   + S  PF    
Sbjct  247  LPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLSSPLNS--PFSSGA  304

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ +     R FIM +A KP
Sbjct  305  LRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYTSKVQRSFIMFSAQKP  355



>ref|XP_008788786.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Phoenix dactylifera]
Length=348

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 81/111 (73%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR GGVFVATT++   + +  PF    
Sbjct  240  LPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLSSPLNN--PFSSEA  297

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ +     R FIM +A KP
Sbjct  298  LRPLRQFFGQENNSYNYFTEKEIEDLCKSCGLINYTSKVQRSFIMFSAQKP  348



>gb|EEE68668.1| hypothetical protein OsJ_27281 [Oryza sativa Japonica Group]
Length=369

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHA AA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ D +    P +R  
Sbjct  262  LPFVSGSIDAVHAAAAIHCWPSPACAVAEISRVLRPGGVFVASTFVADILPPAVPVLRIG  321

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R   +Q +GS+IFL E E EDLC  CGL+ FK +RN  +IM +A K S
Sbjct  322  RPYISQFTGSNIFLSEAEFEDLCRACGLIDFKFVRNGFYIMFSATKAS  369



>ref|XP_006659389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Oryza brachyantha]
Length=358

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHAGAA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ D +    P +R  
Sbjct  251  LPFVSGSIDAVHAGAAIHCWPSPACAVAEISRVLRPGGVFVASTFVADILPPAVPVLRIG  310

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R   +Q +G++IFL E E EDLC  CGLV F  +RN  +IM +A K S
Sbjct  311  RPYISQFTGTNIFLSEVEFEDLCRACGLVDFTFVRNGFYIMFSATKAS  358



>ref|XP_002445476.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
 gb|EES14971.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
Length=352

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHAGAA+HCWPSP+ AVA+ISRVLRPGGVFVA+T++ D I    P +R  
Sbjct  245  LPFVSGSIDAVHAGAAIHCWPSPACAVADISRVLRPGGVFVASTFVADVIPPVIPVLRIG  304

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R   +QI+G++ FL E E EDLC  CGLV FK +R+  +IM +A K S
Sbjct  305  RPYISQITGNNTFLSEVEFEDLCKACGLVDFKFVRSGFYIMFSATKAS  352



>ref|NP_001150427.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 gb|ACG39054.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 tpg|DAA49108.1| TPA: S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=348

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DA+HAGAA+HCWPSP+ AVA+ISRVLRPGG+FVA+T++ D I    P ++ +
Sbjct  241  LPFVSGSIDALHAGAAIHCWPSPACAVADISRVLRPGGIFVASTFVADVIPPAIPVLKIV  300

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            R   +QI+G++ FL E ELEDLC  CGLV FK +R+  +IM +A K
Sbjct  301  RPYISQITGNNTFLSEVELEDLCKACGLVDFKFVRSGFYIMFSATK  346



>ref|XP_003574470.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
 ref|XP_010235114.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
Length=361

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF + S+D VHAGAALHCWPSP+ AVAEISRVLRPGG+FVA+T++ D +    P +R  
Sbjct  254  LPFVNGSIDVVHAGAALHCWPSPACAVAEISRVLRPGGIFVASTFVADVLPPVVPLLRIG  313

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            R    Q++G++ FL E ELEDLC  CGLV F  +RN  +I+ +A K
Sbjct  314  RSYIGQLTGNNTFLSEAELEDLCKACGLVDFTFVRNGFYIIFSATK  359



>ref|XP_004973409.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Setaria italica]
Length=350

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF + S+DAVHAGAA+HCWPSP+ AVAEISRVLR GG+FVA+T++ D I    P +R  
Sbjct  243  LPFVNGSIDAVHAGAAIHCWPSPACAVAEISRVLRSGGIFVASTFVADVIPPAIPILRIA  302

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R   +QI G++ FL E ELEDLC  CGLV FK +R+  +IM +A K S
Sbjct  303  RPYISQIGGNNTFLSEVELEDLCKACGLVDFKFVRSGFYIMFSATKAS  350



>gb|EEE66113.1| hypothetical protein OsJ_22149 [Oryza sativa Japonica Group]
Length=237

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFASSS+DA+HAGAA+HCWPSPS AVAEISRVLRPGGVFVATT++        PF    
Sbjct  129  LPFASSSIDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVATTFLSSP--RNNPFSVEA  186

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  187  LRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIMFSGQKP  237



>ref|XP_003563313.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brachypodium distachyon]
Length=356

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPF  168
            LPFAS S+DA+HAGAA+HCWPSPS AVAEISRVLRPGGVFVATT++      G +S  P 
Sbjct  247  LPFASCSIDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVATTFLSTPTNSGPFSVGP-  305

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ F  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  306  LRPLRQIVGPVNSSYNFFTEAELEDLCKSCGLVNYSSKVQRSFIMFSGQKP  356



>ref|XP_004974685.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Setaria italica]
Length=323

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF + S+DAVHAGAA+HCWPSPS AVAEISRVLRPGGV VA+T++ D I    P +R  
Sbjct  217  LPFVNGSIDAVHAGAAIHCWPSPSCAVAEISRVLRPGGVLVASTFVED-IPLAIPILRIG  275

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            R   ++I+G +IFL E ELEDLC  CGLV F+ +RN  +IM +A K S
Sbjct  276  RPYISRITGMNIFLSEAELEDLCRACGLVDFEFVRNGFYIMFSATKAS  323



>ref|XP_004488470.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cicer arietinum]
Length=346

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++     S TP++ RP
Sbjct  244  LPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFLR--YTSSTPWILRP  301

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE  +Q  G   FL E+E++DLCT+CGL  + C     FIM TA KP
Sbjct  302  FRERTSQGYG---FLKEEEIKDLCTSCGLTNYSCKIQNSFIMFTAQKP  346



>gb|AFW76188.1| hypothetical protein ZEAMMB73_680706 [Zea mays]
Length=206

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++        PF    
Sbjct  97   LPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEA  154

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  155  LRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSNVQRSFIMFSGQKP  205



>ref|NP_001058196.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAD37452.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAD37605.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAF20110.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAG91023.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81074.1| hypothetical protein OsI_23892 [Oryza sativa Indica Group]
Length=345

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFASSS+DA+HAGAA+HCWPSPS AVAEISRVLRPGGVFVATT++        PF    
Sbjct  237  LPFASSSIDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVATTFLSSP--RNNPFSVEA  294

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  295  LRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIMFSGQKP  345



>ref|XP_004965743.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Setaria italica]
Length=299

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++        PF    
Sbjct  190  LPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEA  247

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  248  LRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIMFSGQKP  298



>dbj|BAJ94151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPF  168
            LPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++      G++S    
Sbjct  239  LPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLSTPTNSGLFSIDA-  297

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            ++PLR+    ++ S+ F  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  298  LKPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNYSSKVQRSFIMFSGQKP  348



>dbj|BAJ91607.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPF  168
            LPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++      G++S    
Sbjct  239  LPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLSTPTNSGLFSIDA-  297

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            ++PLR+    ++ S+ F  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  298  LKPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNYSSKVQRSFIMFSGQKP  348



>ref|XP_006657188.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Oryza brachyantha]
Length=353

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 77/111 (69%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS S+DA+HAGAA+HCWPSPS AVAEISRVLRPGGVFVATT++        PF    
Sbjct  244  LPFASCSIDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVATTFLSSP--RNNPFSVEA  301

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  302  LRPLRQVVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRAFIMFSGQKP  352



>ref|XP_002438745.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
 gb|EER90112.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
Length=352

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++        PF    
Sbjct  243  LPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEA  300

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  301  LRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIMFSGQKP  351



>gb|ACG27569.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=344

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++        PF    
Sbjct  235  LPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEA  292

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  293  LRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSNVQRSFIMFSGQKP  343



>ref|XP_011470644.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=337

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 78/111 (70%), Gaps = 12/111 (11%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----F  168
            LPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++      +TP    +
Sbjct  235  LPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFL-----RYTPTTPWY  289

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RP RE  AQ    + +L E+E++DLCT+CGL  +     + FIM +A KP
Sbjct  290  IRPFRERIAQ---GYSYLTEEEIQDLCTSCGLTNYSSKVQQSFIMFSAQKP  337



>gb|ACF85541.1| unknown [Zea mays]
 gb|ACF88073.1| unknown [Zea mays]
Length=346

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++        PF    
Sbjct  237  LPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEA  294

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  295  LRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSNVQRSFIMFSGQKP  345



>ref|XP_004965742.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Setaria italica]
Length=354

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++        PF    
Sbjct  245  LPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEA  302

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  303  LRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIMFSGQKP  353



>gb|EMT30153.1| Putative methyltransferase [Aegilops tauschii]
Length=416

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPF  168
            LPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++      G++S    
Sbjct  307  LPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLSTPTNSGLFSIDA-  365

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            ++PLR+    ++ S+ F  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  366  LKPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNYSSKVQRSFIMFSGQKP  416



>ref|NP_001132053.1| uncharacterized LOC100193465 [Zea mays]
 gb|ACF80738.1| unknown [Zea mays]
 gb|AFW76186.1| LOW QUALITY PROTEIN: S-adenosylmethionine-dependent methyltransferase 
[Zea mays]
Length=356

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 6/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++        PF    
Sbjct  247  LPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEA  304

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  305  LRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSNVQRSFIMFSGQKP  355



>gb|EMT07919.1| Putative methyltransferase [Aegilops tauschii]
Length=358

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++     S  PF    
Sbjct  249  LPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLSTPTNS-GPFSIDA  307

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RPLR+    ++ S+ F  E EL+DLC +CGLV +     R FIM +  KP
Sbjct  308  LRPLRQIVGPVNSSYNFFTEGELKDLCISCGLVNYSSKVQRSFIMFSGQKP  358



>ref|XP_011470680.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=336

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 11/111 (10%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----F  168
            LPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++      +TP    +
Sbjct  233  LPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFL-----RYTPTTPWY  287

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RP RE   +I+  + +L E+E++DLCT+CGL  +     + FIM +A KP
Sbjct  288  IRPFREQ--RIAQGYSYLTEEEIQDLCTSCGLTNYSSKVQQSFIMFSAQKP  336



>ref|XP_004287240.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=338

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 11/111 (10%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----F  168
            LPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++      +TP    +
Sbjct  235  LPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFL-----RYTPTTPWY  289

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            +RP RE   +I+  + +L E+E++DLCT+CGL  +     + FIM +A KP
Sbjct  290  IRPFREQ--RIAQGYSYLTEEEIQDLCTSCGLTNYSSKVQQSFIMFSAQKP  338



>gb|EMT00494.1| Putative methyltransferase [Aegilops tauschii]
Length=493

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPF  168
            LPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++      G++S    
Sbjct  384  LPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLSTPTNSGLFSIDA-  442

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            ++PLR+    ++ S+ F  E ELEDLC +CGLV +     R FIM +  KP
Sbjct  443  LKPLRQIVGPVNSSYNFFIEGELEDLCRSCGLVNYSSKVQRSFIMFSRQKP  493



>ref|XP_011017926.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017927.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017928.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=336

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 77/108 (71%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPFAS SVDAVHAGAA+HCWPSPS AVAEI RVLR GGVFV TT++     S TP + RP
Sbjct  234  LPFASGSVDAVHAGAAMHCWPSPSNAVAEICRVLRSGGVFVGTTFL--RYSSTTPRIERP  291

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   +IS ++ F  E+E+EDLC+TCGL  +     R FIM +A KP
Sbjct  292  FRE---RISRNYNFFTEEEIEDLCSTCGLTNYSKKVQRTFIMFSAQKP  336



>ref|XP_010099510.1| putative methyltransferase [Morus notabilis]
 gb|EXB79361.1| putative methyltransferase [Morus notabilis]
Length=346

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF-VRP  177
            LPF+S SVDAVHAGAALHCWPSP+ AVAEI+R+LR GG+FV TT++     S TP  VRP
Sbjct  244  LPFSSGSVDAVHAGAALHCWPSPTNAVAEITRILRSGGIFVGTTFLR--YTSSTPLIVRP  301

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            LR+   Q   ++ +L E+E+EDLCT+CGL  +     + FIM +A KP
Sbjct  302  LRQRVLQ---NYNYLTEEEIEDLCTSCGLTNYSSKVQQSFIMFSAQKP  346



>ref|XP_008336947.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336948.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336949.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
Length=325

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPFAS SVDAVHAGAALHCWPSPS AVAEI+R+LR G +FV TT++    Y  TP++ +P
Sbjct  220  LPFASGSVDAVHAGAALHCWPSPSNAVAEITRILRSGAIFVGTTFLRSSPY--TPWIFKP  277

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             RE  ++ S S  +L E+E+EDLC +CGL  +     + FIM +A KP+
Sbjct  278  FREKMSRSSNS--YLTEREIEDLCRSCGLTNYSSKVQQSFIMFSARKPA  324



>ref|XP_011078555.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Sesamum indicum]
Length=338

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF S SVDAVHAGAALHCWPSPS AVAEI+R+LR GGVFV +T++   I S TP  +RP
Sbjct  236  LPFPSGSVDAVHAGAALHCWPSPSNAVAEINRILRSGGVFVGSTFLR--ISSSTPILLRP  293

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             R+   +I+  + +L E+E+EDLCT+CGLV +     + FIM +A KP
Sbjct  294  FRQ---RITNDYNYLTEEEIEDLCTSCGLVNYSKKVQQSFIMFSAEKP  338



>ref|XP_003546595.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Glycine max]
 gb|KHN41316.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF S SVDAVHAGAALHCWPSPS AVAEI+RVL+ GGVFV +T++     S TP F+RP
Sbjct  239  LPFPSGSVDAVHAGAALHCWPSPSNAVAEITRVLKSGGVFVGSTFLR--YSSLTPWFLRP  296

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q  G   +L E+E++DLCT+CGL  +     + FIM TA KP
Sbjct  297  FRERIPQGYG---YLTEEEIKDLCTSCGLTNYSSKIQQAFIMFTAQKP  341



>gb|KDP30197.1| hypothetical protein JCGZ_16979 [Jatropha curcas]
Length=345

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 77/110 (70%), Gaps = 8/110 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP--FVR  174
            LPF S SVDAVHAGAALHCWPSPS A+AEI RVLR GGVFV TT++    YS T    +R
Sbjct  241  LPFPSGSVDAVHAGAALHCWPSPSNAIAEICRVLRSGGVFVGTTFLQ---YSATTSWILR  297

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            P R+   +I  ++ +  E+E+EDLCT+CGL  +K    + FIM +A KPS
Sbjct  298  PFRQ---RIQENYFYFTEEEIEDLCTSCGLTNYKSKVQQSFIMFSAEKPS  344



>ref|XP_002268107.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Vitis vinifera]
 emb|CBI25579.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 78/108 (72%), Gaps = 3/108 (3%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD--GIYSFTPFVR  174
            LPF++ SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV TT++    G  S T  +R
Sbjct  236  LPFSTGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGTTFLRPSFGNSSITSILR  295

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            P R+ + +   ++  L EKE+EDLCT+CGL+ ++    R FIM +A K
Sbjct  296  PFRQ-WERSLQNYNNLTEKEIEDLCTSCGLINYRSKVQRSFIMFSAQK  342



>ref|XP_002324579.2| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEF03144.2| methyltransferase-related family protein [Populus trichocarpa]
Length=332

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPFAS SVDAVHAGAA+HCWPSPS AVAEI RVLR GGVFV TT++     S TP + RP
Sbjct  230  LPFASGSVDAVHAGAAMHCWPSPSNAVAEICRVLRSGGVFVGTTFL--RYSSTTPRIERP  287

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   +IS +  F  E+E+EDLC+TCGL  +     + FIM +A KP
Sbjct  288  FRE---RISRNSNFFTEEEIEDLCSTCGLTNYSKKVQQTFIMFSAQKP  332



>emb|CDP10502.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 77/108 (71%), Gaps = 7/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF S SVD VHAGAALHCWPSPS AVAEI+R+LR GGVFV TT++     S TP F+RP
Sbjct  234  LPFPSGSVDGVHAGAALHCWPSPSNAVAEINRILRSGGVFVGTTFLR--FSSSTPAFLRP  291

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            LR    Q   ++ +L E+E+ED+CT+CGL+ +     + FIM +A KP
Sbjct  292  LR----QAGRNYNYLTEEEIEDVCTSCGLINYTSKVQQSFIMFSAQKP  335



>ref|XP_010050326.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=350

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 12/111 (11%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----F  168
            LPF+S SVDAVHAGAALHCWPSPS A+AEISRVLR GGVFV TT++      +TP     
Sbjct  248  LPFSSGSVDAVHAGAALHCWPSPSNAIAEISRVLRSGGVFVGTTFL-----RYTPSTPWI  302

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            ++P R+  +Q   ++ FL  +E+EDLCT+CGL  +     + FIM +A KP
Sbjct  303  IQPFRQRASQ---NYSFLTAEEIEDLCTSCGLTNYTSKTQQSFIMFSAQKP  350



>gb|EYU34934.1| hypothetical protein MIMGU_mgv1a009522mg [Erythranthe guttata]
Length=339

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 83/109 (76%), Gaps = 7/109 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPFAS SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV +T++   + S TP ++RP
Sbjct  236  LPFASGSVDAVHAGAALHCWPSPSNAIAEINRILRSGGVFVGSTFLR--VSSSTPTWLRP  293

Query  178  L-RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            L RE   +I+ ++ +L E+E+E++C +CGLV +  I  + FIM +A KP
Sbjct  294  LIRE---RITSNYNYLTEEEIEEVCKSCGLVNYTKIVQQSFIMFSAQKP  339



>ref|XP_006381066.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|ERP58863.1| methyltransferase-related family protein [Populus trichocarpa]
Length=308

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 73/109 (67%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP--FVR  174
            LPFAS SVDA+HAGAALHCWPS S AVAEI R LR GGVFV TT++    YS T     R
Sbjct  206  LPFASGSVDAIHAGAALHCWPSASNAVAEICRALRSGGVFVGTTFLQ---YSSTTSWIER  262

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P RE   Q   ++ +  E+E+EDLCTTCGL  +  I  R FIM +A KP
Sbjct  263  PFRERIMQ---NYNYFTEEEIEDLCTTCGLTNYTRIVQRSFIMFSAQKP  308



>ref|XP_006586686.1| PREDICTED: uncharacterized protein LOC100798970 isoform X1 [Glycine 
max]
Length=336

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF+S SVDAVHAGAALHCWPSPS AVAEI+R L+ GGVFV +T++     S TP F+RP
Sbjct  234  LPFSSGSVDAVHAGAALHCWPSPSNAVAEITRTLKNGGVFVGSTFLR--YSSKTPWFLRP  291

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q  G   +L E+E++DLCT+CGL  +     + FIM TA KP
Sbjct  292  FRERTPQGYG---YLTEEEIKDLCTSCGLTNYSSKIQQAFIMFTAQKP  336



>ref|XP_002988667.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
 gb|EFJ10178.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
Length=269

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 73/106 (69%), Gaps = 9/106 (8%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFAS +V A+HAGAALHCWPSPS+AVAEI RVL+PGGVFVATT++ + I+ F P  R  
Sbjct  173  LPFASGTVSAIHAGAALHCWPSPSSAVAEICRVLKPGGVFVATTFLSNSIFPFLPQRR--  230

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
                   S S  +  EKELE+LC  CGLV ++      FIMLTA K
Sbjct  231  -------SSSLRYWTEKELEELCKLCGLVDYQKKIKGNFIMLTARK  269



>ref|XP_011020252.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=338

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 73/109 (67%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP--FVR  174
            LPFAS SVDA+HAGAALHCWPS S AVAEI R LR GGVFV TT++    YS T     R
Sbjct  236  LPFASGSVDAIHAGAALHCWPSASNAVAEICRALRSGGVFVGTTFLQ---YSSTTSWIER  292

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P RE   Q   ++ +  E+E+EDLCTTCGL  +  I  R FIM +A KP
Sbjct  293  PFRERIMQ---NYNYFTEEEIEDLCTTCGLTNYTRIVQRSFIMFSAQKP  338



>gb|KHN28439.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF+S SVDAVHAGAALHCWPSPS AVAEI+R L+ GGVFV +T++     S TP F+RP
Sbjct  239  LPFSSGSVDAVHAGAALHCWPSPSNAVAEITRTLKNGGVFVGSTFLR--YSSKTPWFLRP  296

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q  G   +L E+E++DLCT+CGL  +     + FIM TA KP
Sbjct  297  FRERTPQGYG---YLTEEEIKDLCTSCGLTNYSSKIQQAFIMFTAQKP  341



>ref|NP_001242875.1| uncharacterized protein LOC100798970 [Glycine max]
 gb|ACU18789.1| unknown [Glycine max]
Length=341

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF+S SVDAVHAGAALHCWPSPS AVAEI+R L+ GGVFV +T++     S TP F+RP
Sbjct  239  LPFSSGSVDAVHAGAALHCWPSPSNAVAEITRTLKNGGVFVGSTFLR--YSSKTPWFLRP  296

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q  G   +L E+E++DLCT+CGL  +     + FIM TA KP
Sbjct  297  FRERTPQGYG---YLTEEEIKDLCTSCGLTNYSSKIQQAFIMFTAQKP  341



>gb|KJB53960.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=300

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF-VRP  177
            LPF+S S+DAVHAGAALHCWPSPS A+AEISR+LR GGVFV +T++     S TP+ +RP
Sbjct  198  LPFSSGSIDAVHAGAALHCWPSPSNAIAEISRILRSGGVFVGSTFLR--YTSSTPWIIRP  255

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q   S+ +L E+E+E++CT  GL  F     R FIM +A KP
Sbjct  256  FRERVMQ---SYNYLTEEEIEEVCTNSGLTNFSKKVQRSFIMFSAQKP  300



>ref|XP_008242913.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic, 
partial [Prunus mume]
Length=263

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPF S S+ AVHAGAALHCWPSPS A+AEISR+LR GG+FV TT++     S TP++ RP
Sbjct  161  LPFPSGSIGAVHAGAALHCWPSPSNAIAEISRILRSGGIFVGTTFLR--YTSSTPWILRP  218

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            LRE   Q    + +L E+E+EDLCT+ GL+ +     + FIM +A KP
Sbjct  219  LRERALQ---DYSYLTEEEIEDLCTSSGLINYSSKVQQSFIMFSAQKP  263



>gb|KEH37884.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=277

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++     S T +V R 
Sbjct  175  LPFESGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFLR--YTSSTSWVARL  232

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   + S  + +L E+E++DLCT+CGL  + C   + FIM TA KP
Sbjct  233  FRE---RSSLGYGYLTEEEIKDLCTSCGLTNYSCKIQKSFIMFTAQKP  277



>gb|KJB53958.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=343

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF-VRP  177
            LPF+S S+DAVHAGAALHCWPSPS A+AEISR+LR GGVFV +T++     S TP+ +RP
Sbjct  241  LPFSSGSIDAVHAGAALHCWPSPSNAIAEISRILRSGGVFVGSTFL--RYTSSTPWIIRP  298

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q   S+ +L E+E+E++CT  GL  F     R FIM +A KP
Sbjct  299  FRERVMQ---SYNYLTEEEIEEVCTNSGLTNFSKKVQRSFIMFSAQKP  343



>ref|XP_007013645.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY31264.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=340

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 77/108 (71%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF-VRP  177
            LPF+S S+DAVHAGAALHCWPS S AVAEISR+LR GGVFV +T++     S TP+ VRP
Sbjct  238  LPFSSGSIDAVHAGAALHCWPSTSNAVAEISRILRSGGVFVGSTFL--RYSSTTPWIVRP  295

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q   ++ +L E+E+ED+CT+CGL  F     + FIM +A KP
Sbjct  296  FRERILQ---NYNYLTEEEIEDVCTSCGLTNFTKKVQQSFIMFSAQKP  340



>ref|XP_008336950.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Malus domestica]
Length=324

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 76/109 (70%), Gaps = 6/109 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPFAS SVDAVHAGAALHCWPSPS AVAEI+R+LR G +FV TT++    Y  TP++ +P
Sbjct  220  LPFASGSVDAVHAGAALHCWPSPSNAVAEITRILRSGAIFVGTTFLRSSPY--TPWIFKP  277

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             RE       S+ +L E+E+EDLC +CGL  +     + FIM +A KP+
Sbjct  278  FRE---MSRSSNSYLTEREIEDLCRSCGLTNYSSKVQQSFIMFSARKPA  323



>ref|XP_002531454.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
 gb|EEF30941.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
Length=290

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 73/108 (68%), Gaps = 4/108 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF+S SVDAVHAGAALHCWPSPS A+AEI R LR GGVFV TT++     S +   R  
Sbjct  186  LPFSSGSVDAVHAGAALHCWPSPSNAIAEICRTLRSGGVFVGTTFLRYNATS-SWIERSF  244

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            RE   +I   + +  E+E+EDLCT+CGL  ++    R FIM TA KPS
Sbjct  245  RE---RIMSGYNYYTEEEIEDLCTSCGLTNYQSKVQRSFIMFTAEKPS  289



>ref|XP_002986403.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
 gb|EFJ12612.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
Length=340

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 73/106 (69%), Gaps = 9/106 (8%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFAS +V A+HAGAALHCWPSPS+AVAEI RVL+PGGVFVATT++ + I+ F P  R  
Sbjct  243  LPFASGTVSAIHAGAALHCWPSPSSAVAEICRVLKPGGVFVATTFLSNSIFPFLPQRR--  300

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
                   S S  +  EKELE+LC  CGLV ++      FIMLTA K
Sbjct  301  -------SSSLRYWTEKELEELCKLCGLVDYQKKIKGNFIMLTARK  339



>gb|KHG21340.1| hypothetical protein F383_03824 [Gossypium arboreum]
Length=394

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF-VRP  177
            LPF+S S+DAVHAGAALHCWPSPS A+AEISR+LR GGVFV +T++     S TP+ +RP
Sbjct  292  LPFSSGSIDAVHAGAALHCWPSPSNAIAEISRILRSGGVFVGSTFL--RYTSSTPWIIRP  349

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q   S+ +L E+E+E++CT  GL  F     R FIM +A KP
Sbjct  350  FRERVMQ---SYNYLTEEEIEEVCTNSGLTNFSKKVQRSFIMFSAQKP  394



>ref|XP_008456635.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Cucumis melo]
Length=338

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 77/108 (71%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R GGVFV TT++     S TP ++R 
Sbjct  236  LPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRSGGVFVGTTFLR--YTSSTPWYLRF  293

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            LRE   Q  G   +L E+E+E+LC +CGL+ +     R FIM +A KP
Sbjct  294  LRERGFQPYG---YLTEEEIEELCKSCGLINYSSKVQRSFIMFSAQKP  338



>gb|ACJ84583.1| unknown [Medicago truncatula]
 gb|KEH37883.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++     S T +V R 
Sbjct  240  LPFESGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFLR--YTSSTSWVARL  297

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   + S  + +L E+E++DLCT+CGL  + C   + FIM TA KP
Sbjct  298  FRE---RSSLGYGYLTEEEIKDLCTSCGLTNYSCKIQKSFIMFTAQKP  342



>emb|CBI25578.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY---SFTPFV  171
            LPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV TT++   IY   S    +
Sbjct  233  LPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGTTFL-RPIYTNSSIPAIL  291

Query  172  RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            RP R++  Q S    +L EKE+EDLC +C L+ +     + FIM +A K
Sbjct  292  RPFRQSILQTSN---YLTEKEIEDLCRSCALINYTSTIQQSFIMFSAQK  337



>ref|XP_002268200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Vitis vinifera]
Length=340

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY---SFTPFV  171
            LPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV TT++   IY   S    +
Sbjct  235  LPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGTTFL-RPIYTNSSIPAIL  293

Query  172  RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            RP R++  Q S    +L EKE+EDLC +C L+ +     + FIM +A K
Sbjct  294  RPFRQSILQTSN---YLTEKEIEDLCRSCALINYTSTIQQSFIMFSAQK  339



>ref|XP_010656529.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=343

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY---SFTPFV  171
            LPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV TT++   IY   S    +
Sbjct  238  LPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGTTFL-RPIYTNSSIPAIL  296

Query  172  RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            RP R++  Q S    +L EKE+EDLC +C L+ +     + FIM +A K
Sbjct  297  RPFRQSILQTSN---YLTEKEIEDLCRSCALINYTSTIQQSFIMFSAQK  342



>ref|XP_007202300.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
 gb|EMJ03499.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
Length=352

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 77/108 (71%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPF S SV AVHAGAALHCWPSPS A+AEISR+LR GG+FV TT++     S TP++ RP
Sbjct  250  LPFPSGSVGAVHAGAALHCWPSPSNAIAEISRILRTGGIFVGTTFLR--YTSSTPWILRP  307

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            LRE   Q   ++ +L E+E+EDLCT+ GL+ +     + FIM +A KP
Sbjct  308  LRERALQ---NYSYLTEEEIEDLCTSSGLINYSSKVQQSFIMFSAQKP  352



>gb|AFK46366.1| unknown [Medicago truncatula]
Length=342

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 75/108 (69%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT+      S T +V R 
Sbjct  240  LPFESGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFFR--YTSSTSWVARL  297

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   + S  + +L E+E++DLCT+CGL  + C   + FIM TA KP
Sbjct  298  FRE---RSSLGYGYLTEEEIKDLCTSCGLTNYSCKIQKSFIMFTAQKP  342



>ref|XP_008344066.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=327

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 74/111 (67%), Gaps = 12/111 (11%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----F  168
            LPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++      +TP     
Sbjct  225  LPFPSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGGVFVGTTFL-----RYTPSTPWI  279

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             R LRE+  Q    + +L E+E+EDLC +CGL  +     + FIM +A KP
Sbjct  280  TRQLRESALQ---GYNYLTEEEIEDLCASCGLTNYTSNVQQAFIMFSAQKP  327



>ref|XP_009338403.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=345

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 12/111 (11%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV---  171
            LPF+S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++      +TP     
Sbjct  243  LPFSSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGGVFVGTTFL-----RYTPSTSWI  297

Query  172  -RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             R LRE   Q   S+ +L E+E+ DLCT+CGL  +     + FIM +A KP
Sbjct  298  PRQLRERARQ---SYNYLTEEEIADLCTSCGLTNYTSNVQQSFIMFSAQKP  345



>ref|XP_009358530.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=345

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 12/111 (11%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV---  171
            LPF+S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++      +TP     
Sbjct  243  LPFSSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGGVFVGTTFL-----RYTPSTSWI  297

Query  172  -RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             R LRE   Q   S+ +L E+E+ DLCT+CGL  +     + FIM +A KP
Sbjct  298  PRQLRERARQ---SYNYLTEEEIADLCTSCGLTNYTSNVQQSFIMFSAQKP  345



>ref|XP_010687777.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=339

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF S+S+DAVHAGAALHCWPSPS+A+A+I+RVLR GGVFV TT++     + TP  +RP
Sbjct  237  LPFPSASIDAVHAGAALHCWPSPSSAIADITRVLRSGGVFVGTTFLR--YTASTPSLLRP  294

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            LRE   Q   ++ +L E+E+E LC +CGLV +     + FIM +A KP
Sbjct  295  LRERILQ---TYSYLIEEEIEALCKSCGLVDYSSKVQQSFIMFSARKP  339



>gb|KDO59312.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=328

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 73/108 (68%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR GGVFV TT++     S T    R 
Sbjct  226  LPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRSGGVFVGTTFLR--YTSSTSLTGRV  283

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            LRE   Q   ++ +L E+E+EDLCT+CGL  +     + FIM  A KP
Sbjct  284  LRERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQQSFIMFAAQKP  328



>ref|XP_006453728.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
 gb|ESR66968.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
Length=333

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR GGVFV TT++     S +   R L
Sbjct  231  LPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRSGGVFVGTTFL-RYTSSTSLTGRVL  289

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            RE   Q   ++ +L E+E+EDLCT+CGL  +     + FIM  A KP
Sbjct  290  RERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQQSFIMFAAQKP  333



>gb|KDO59313.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
 gb|KDO59314.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=333

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR GGVFV TT++     S +   R L
Sbjct  231  LPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRSGGVFVGTTFL-RYTSSTSLTGRVL  289

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            RE   Q   ++ +L E+E+EDLCT+CGL  +     + FIM  A KP
Sbjct  290  RERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQQSFIMFAAQKP  333



>ref|XP_004139262.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cucumis sativus]
Length=338

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R GGVFV TT++     S   ++R L
Sbjct  236  LPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRSGGVFVGTTFL-RYTSSTLWYLRFL  294

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            RE   Q  G   +L E+E+E+LC +CGL+ +     R FIM +A KP
Sbjct  295  RERGFQPYG---YLTEEEIEELCKSCGLINYSSKVQRSFIMFSAQKP  338



>ref|XP_010047200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79025.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=336

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 12/111 (11%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----F  168
            LPF+S SVDAVHAGAALHCWPSPS A+AEI+RVLR GGVFV TT++      +TP     
Sbjct  234  LPFSSCSVDAVHAGAALHCWPSPSNAIAEITRVLRSGGVFVGTTFL-----RYTPSTPWI  288

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            + P R+  AQ   ++ +L  +E+EDLCT+CGL  +     + FIM +A KP
Sbjct  289  ILPFRQRTAQ---NYSYLTAEEIEDLCTSCGLTNYTRKIQQSFIMFSAQKP  336



>ref|XP_006473930.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=333

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPFAS  VDAVHAGAALHCWPSPS AVAEISR+L+ GGVFV TT++     S T  + R 
Sbjct  231  LPFASGFVDAVHAGAALHCWPSPSNAVAEISRILQSGGVFVGTTFLR--YTSSTSLIGRV  288

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            LRE   Q   ++ +L E+E+EDLCT+CGL  +     + FIM  A KP
Sbjct  289  LRERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQQSFIMFAAQKP  333



>ref|XP_004167998.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At2g41040, chloroplastic-like [Cucumis sativus]
Length=338

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF+S SVD VHAGAALHCWPSPS A+AEI+R++R GGVFV TT+      S TP ++R 
Sbjct  236  LPFSSGSVDGVHAGAALHCWPSPSNAIAEITRIMRSGGVFVGTTFXR--YTSSTPWYLRF  293

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            LRE   Q  G   +L E+E+E+LC +CGL+ +     R FIM +A KP
Sbjct  294  LRERGFQPYG---YLTEEEIEELCKSCGLINYSSKVQRSFIMFSAQKP  338



>gb|EMT14235.1| Putative methyltransferase [Aegilops tauschii]
Length=465

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 5/95 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++     S  PF    
Sbjct  222  LPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLSTPTNS-GPFSIDA  280

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGF  273
            +RPLR+    ++ S+ F  E ELEDLC +CGLV +
Sbjct  281  LRPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNY  315



>gb|KJB27062.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=337

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 75/108 (69%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF+S SVDAVHAGAALHCWPSP  AVAEISR+LR GGVFV +T++     S TP  +RP
Sbjct  235  LPFSSGSVDAVHAGAALHCWPSPLNAVAEISRILRSGGVFVGSTFL--RYTSSTPRIIRP  292

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q   ++ +L E+E+E LCT+CGL  +     + FIM +A KP
Sbjct  293  FRERILQ---NYSYLTEEEIEALCTSCGLTNYTRNIQQSFIMFSAQKP  337



>ref|XP_006411367.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
 gb|ESQ52820.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
Length=363

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPF SSSVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ +R
Sbjct  261  LPFPSSSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIR  317

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +E   Q   S+ +L + E++D+CT+CGL  +  +    FIM TA KP
Sbjct  318  PFQERILQ---SYNYLMQDEIKDVCTSCGLTDYADVVQDSFIMFTARKP  363



>ref|XP_009141962.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brassica rapa]
Length=355

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPFAS SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ +R
Sbjct  253  LPFASGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIR  309

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +    Q   ++ +L + E++D+CTTCGL  ++ I    FIM TA KP
Sbjct  310  PFQSRILQ---NYNYLMQDEIKDVCTTCGLTDYEDIVQDSFIMFTARKP  355



>ref|XP_008456627.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Cucumis melo]
Length=339

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 77/109 (71%), Gaps = 7/109 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R GGVFV TT++     S TP ++R 
Sbjct  236  LPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRSGGVFVGTTFLR--YTSSTPWYLRF  293

Query  178  LRENFA-QISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            LRE    Q  G   +L E+E+E+LC +CGL+ +     R FIM +A KP
Sbjct  294  LREQRGFQPYG---YLTEEEIEELCKSCGLINYSSKVQRSFIMFSAQKP  339



>ref|XP_009338401.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=350

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 11/113 (10%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV---  171
            LPF+S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++      +TP     
Sbjct  243  LPFSSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGGVFVGTTFL-----RYTPSTSWI  297

Query  172  -RPLRE--NFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             R LRE   + +   S+ +L E+E+ DLCT+CGL  +     + FIM +A KP
Sbjct  298  PRQLREVLMWQRARQSYNYLTEEEIADLCTSCGLTNYTSNVQQSFIMFSAQKP  350



>emb|CDY06948.1| BnaA04g23670D [Brassica napus]
Length=800

 Score =   116 bits (291),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPFAS SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ +R
Sbjct  698  LPFASGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIR  754

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +    Q   ++ +L + E++D+CTTCGL  ++ I    FIM TA KP
Sbjct  755  PFQSRILQ---NYNYLMQDEIKDVCTTCGLTDYEDIVQDSFIMFTARKP  800



>gb|KHG26587.1| hypothetical protein F383_01046 [Gossypium arboreum]
Length=337

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF+S S+DAVHAGAALHCWPSP  AVAEISR+LR GGVFV +T++     S TP  +RP
Sbjct  235  LPFSSGSIDAVHAGAALHCWPSPLNAVAEISRILRSGGVFVGSTFL--RYTSSTPRIIRP  292

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q   ++ +L E+E+E LCT+CGL  +     + FIM +A KP
Sbjct  293  FRERVLQ---NYSYLTEEEIEALCTSCGLANYTRKIQQSFIMFSAQKP  337



>ref|XP_009337420.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009337422.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=89

 Score =   106 bits (265),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 4/68 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA+TYI+DG +S  PF+R  
Sbjct  25   LPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVASTYILDGRFSHIPFLR--  82

Query  181  RENFAQIS  204
              N  Q++
Sbjct  83   --NITQVT  88



>ref|XP_010533098.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Tarenaya hassleriana]
Length=345

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 73/108 (68%), Gaps = 6/108 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF S SVDAVHAGAALHCWPSP+ A+AEISRVLR GGVFV TT++     + TP F+RP
Sbjct  243  LPFPSGSVDAVHAGAALHCWPSPTNAIAEISRVLRSGGVFVGTTFL--RYNASTPWFIRP  300

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             RE   Q   ++ +L   E++D+CT+CGL  +       FIM  A KP
Sbjct  301  FRERILQ---NYNYLLRDEIKDVCTSCGLTNYSDDVRSSFIMFAAQKP  345



>emb|CDY57579.1| BnaC04g56820D [Brassica napus]
Length=353

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 76/109 (70%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ +R
Sbjct  251  LPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIR  307

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +    Q   ++ +L + E++D+CTTCGL  ++ I    FIM TA KP
Sbjct  308  PFQSRILQ---NYNYLMQDEIKDVCTTCGLTDYEDIVQDSFIMFTARKP  353



>ref|XP_009337419.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009337421.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=110

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 65/89 (73%), Gaps = 6/89 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA+TYI+DG +S  PF+R  
Sbjct  25   LPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVASTYILDGRFSHIPFLR--  82

Query  181  RENFAQISGSHIFLDEKELEDL--CTTCG  261
              N  Q+  S+  L   +  D   C  C 
Sbjct  83   --NITQVHLSYSKLSLLQFWDSAECAPCS  109



>gb|KGN60753.1| hypothetical protein Csa_2G009410 [Cucumis sativus]
Length=339

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 75/108 (69%), Gaps = 5/108 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R GGVFV TT++     S   ++R L
Sbjct  236  LPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRSGGVFVGTTFL-RYTSSTLWYLRFL  294

Query  181  RENFA-QISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            RE    Q  G   +L E+E+E+LC +CGL+ +     R FIM +A KP
Sbjct  295  REQRGFQPYG---YLTEEEIEELCKSCGLINYSSKVQRSFIMFSAQKP  339



>ref|XP_004287239.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=289

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 6/107 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR GG+FV TT++     S +   +PL
Sbjct  189  LPFTSCSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGIFVGTTFLRS---SPSWIFKPL  245

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             E   +I  S  +  E+E+EDLCT+CGL  +     + FI+ +A KP
Sbjct  246  NE---RILPSGNYFTEEEIEDLCTSCGLTNYTSKVEQSFIIFSAKKP  289



>ref|XP_009602551.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Nicotiana tomentosiformis]
Length=181

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 4/107 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHAGAALHCWPSPS A+AEI+RVLR GGVFV TT++     + T F R L
Sbjct  79   LPFFSGSIDAVHAGAALHCWPSPSNAIAEINRVLRSGGVFVGTTFLRVNPSAPTIF-RAL  137

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             ++  +   ++ +   +E+EDL TTCGL+ +       FIM +A KP
Sbjct  138  EQSAGR---TYSYFTREEIEDLVTTCGLINYTSKVQNSFIMFSAQKP  181



>ref|XP_009802104.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Nicotiana sylvestris]
Length=345

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++     + T F R L
Sbjct  243  LPFFSGSIDAVHAGAALHCWPSPSNAIAEINRILRSGGVFVGTTFLRVNPSAPTIF-RAL  301

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             +N  +   ++ +  ++E+EDL TTCGL+ +       FIM +A KP
Sbjct  302  EQNVGR---TYSYFTQEEIEDLVTTCGLINYTSKVQNSFIMFSAQKP  345



>ref|XP_008348560.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=433

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+ SVDAVHAGAA+HCWPSPS AVAEISRVLRPGGVFVA+TYI+DG +S  PF+R +
Sbjct  248  LPFATGSVDAVHAGAAIHCWPSPSTAVAEISRVLRPGGVFVASTYILDGPFSLIPFLRNI  307

Query  181  RENFAQISGSH  213
             +   QI+GS 
Sbjct  308  TQRTKQIAGSE  318



>ref|NP_181637.2| uncharacterized methyltransferase [Arabidopsis thaliana]
 sp|Q0WPT7.1|Y2104_ARATH RecName: Full=Uncharacterized methyltransferase At2g41040, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF00862.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09918.1| uncharacterized methyltransferase [Arabidopsis thaliana]
Length=352

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ +R
Sbjct  250  LPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIR  306

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  307  PFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEDYIQDSFIMFTARKP  352



>ref|XP_002879904.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56163.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ +R
Sbjct  248  LPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIR  304

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  305  PFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEDYIQDSFIMFTARKP  350



>ref|XP_010517586.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Camelina sativa]
Length=355

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ +R
Sbjct  253  LPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIR  309

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  310  PFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEDYIQDSFIMFTARKP  355



>ref|XP_010508773.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=356

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ +R
Sbjct  254  LPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIR  310

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  311  PFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEDYIQDSFIMFTARKP  356



>ref|XP_006293382.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
 gb|EOA26280.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
Length=356

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ +R
Sbjct  254  LPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIR  310

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  311  PFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEEYIKDSFIMFTARKP  356



>ref|XP_008336951.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
 ref|XP_008336952.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=348

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 72/111 (65%), Gaps = 12/111 (11%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV---  171
            LPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR G VFV TT++      +TP     
Sbjct  246  LPFPSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGAVFVGTTFL-----RYTPSTSWI  300

Query  172  -RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             R L E   Q   S+ +L E+E+ DLCT+CGL  +     + FIM +A KP
Sbjct  301  PRQLXERARQ---SYNYLTEEEIADLCTSCGLTNYTSNVQQSFIMFSAQKP  348



>ref|XP_010505866.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=355

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPF S S+DAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ +R
Sbjct  253  LPFPSGSIDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIR  309

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  310  PFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEDYVQDSFIMFTARKP  355



>ref|XP_009363912.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=344

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (64%), Gaps = 12/111 (11%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----F  168
            LPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGV V TT++      +TP     
Sbjct  242  LPFPSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGGVLVGTTFL-----RYTPSTPWI  296

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             R LR    Q    + +L E+E+EDLC +CGL  +     + FIM +A KP
Sbjct  297  TRQLRGRALQ---GYNYLTEEEIEDLCASCGLTNYTSNVQQAFIMFSAQKP  344



>gb|KFK36957.1| hypothetical protein AALP_AA4G194500 [Arabis alpina]
Length=343

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 8/109 (7%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VR  174
            LPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++    YS  TP+ ++
Sbjct  241  LPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR---YSPTTPWIIK  297

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            P +    Q   ++ +L + E++D+CT CGL  +  I    FIM TA KP
Sbjct  298  PFQSRILQ---NYNYLMQDEIKDVCTACGLTDYADIVKDSFIMFTARKP  343



>ref|XP_003056709.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58354.1| predicted protein [Micromonas pusilla CCMP1545]
Length=384

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 76/118 (64%), Gaps = 11/118 (9%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI-----VDGIYSFTP  165
            LPFA+ S DAVHAGAA+HCWPSPSAAVAEISRVLRPGGVF+A+T++     +        
Sbjct  262  LPFATGSFDAVHAGAAMHCWPSPSAAVAEISRVLRPGGVFIASTFLDPTSMLGDALGSDE  321

Query  166  FVRPL----RENFAQISGS-HIFLDEKELEDLCT-TCGLVGFKCIRNRRFIMLTAMKP  321
             V+PL    RE+     G+ + F  EKEL DL T  CGL  F+  R R+FI  +  KP
Sbjct  322  MVQPLSAAFRESGLGTGGAFNQFWSEKELRDLTTGMCGLERFERKRERQFIFFSVRKP  379



>ref|XP_006852799.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
 gb|ERN14266.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
Length=343

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP--FVR  174
            LPF S SVDAVHAGAALHCWPSPS AVAEI R+LRPGGVFVATT++      + P   +R
Sbjct  217  LPFPSCSVDAVHAGAALHCWPSPSNAVAEICRILRPGGVFVATTFLSSVFSDYLPSDVLR  276

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCG  261
            PLR+    ++ ++ +L EKE+EDLC   G
Sbjct  277  PLRQAVQPLANTYSYLTEKEIEDLCLEPG  305



>ref|XP_008374562.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Malus domestica]
Length=334

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR  174
            LPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA+TYI+DG +S  PF+R
Sbjct  248  LPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVASTYILDGRFSLIPFLR  305



>ref|XP_006359517.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=345

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 4/106 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR GG+FV TT++     S  P +R L
Sbjct  243  LPFFSGSVDAVHAGAALHCWPSPSNAIAEINRILRSGGIFVGTTFLRVNP-SAPPILRAL  301

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            +++  +   ++ F  ++E+EDL TTCGL+ +       FIM +A K
Sbjct  302  QQSATR---TYSFFTQEEIEDLVTTCGLINYTSKVQGGFIMFSAQK  344



>ref|XP_001778776.1| predicted protein [Physcomitrella patens]
 gb|EDQ56362.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD-GIYSFTPFVRP  177
            LPFA+ S+DAVHAGAALHCWPSP+A +AEI+R+L+PGGVFVATT++    I  F    + 
Sbjct  202  LPFATGSIDAVHAGAALHCWPSPAAGMAEIARILKPGGVFVATTFLTPLPIIDFGN--KD  259

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            +R+  A  S +  + DE ELE+L   CGLV +  +R  +FIM++A +
Sbjct  260  IRKVGAISSSTLRYWDEAELEELMGVCGLVEYTRVRLNQFIMVSAKR  306



>gb|EEC83568.1| hypothetical protein OsI_29220 [Oryza sativa Indica Group]
Length=352

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHA AA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ D +    P +R  
Sbjct  264  LPFVSGSIDAVHAAAAIHCWPSPACAVAEISRVLRPGGVFVASTFVADILPPAVPVLRIG  323

Query  181  RENFAQISGSHIFLDEKELEDL  246
            R   +Q +GS+IFL E E EDL
Sbjct  324  RPYISQFTGSNIFLSEAEFEDL  345



>ref|XP_004242719.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Solanum lycopersicum]
Length=341

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++     S  P  R L
Sbjct  239  LPFFSGSVDAVHAGAALHCWPSPSNAIAEINRILRSGGVFVGTTFLRVNP-STPPIFRAL  297

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            +++  +   ++ F   +E+EDL TTCGL+ +       FI+ +A K
Sbjct  298  QQSATR---TYSFFTREEIEDLVTTCGLINYTSKVQGGFIIFSAQK  340



>ref|XP_007510827.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18360.1| predicted protein [Bathycoccus prasinos]
Length=390

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 6/114 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI-----VDGIYSFTP  165
            LPF + SVD VHAGAALHCWPSP+ AVAEISRVL+PGG FVA+T++     ++      P
Sbjct  254  LPFETGSVDVVHAGAALHCWPSPTQAVAEISRVLKPGGTFVASTFLDPSANLNNDDLTKP  313

Query  166  FVRPLRENFAQISGS-HIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            F    R+      G+ + F  E+EL+DLC   GL  FK  R R++I+    K S
Sbjct  314  FSDFFRDAKLGTGGAFNRFWTEQELKDLCQMVGLEDFKRERERQYILFAVKKNS  367



>ref|XP_004242718.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum lycopersicum]
Length=339

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (68%), Gaps = 4/106 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++     + T F R L
Sbjct  237  LPFPSGSIDAVHAGAALHCWPSPSNAIAEINRILRSGGVFVGTTFLRVNPSAPTIF-RAL  295

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
             ++  +   ++ +  ++E+EDL T+CGL+ +       FIM +A K
Sbjct  296  EQSALR---TYSYFTQEEIEDLVTSCGLINYTSKVQSSFIMFSAQK  338



>gb|KDO80933.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=362

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIVDG ++  PF R L
Sbjct  242  LPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLL  301

Query  181  RE  186
            R+
Sbjct  302  RQ  303



>gb|KIY98469.1| putative methyltransferase [Monoraphidium neglectum]
Length=249

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 73/121 (60%), Gaps = 18/121 (15%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----  168
            LPFA+ SVDA+HAGAA+HCWP+P AA+AEISRVLRPGGVFVA+T++      F P     
Sbjct  63   LPFATGSVDAIHAGAAIHCWPNPQAALAEISRVLRPGGVFVASTFLT----PFAPIGELL  118

Query  169  ----VRPLRENFAQI------SGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
                VRP+ +   +       + ++   ++ EL +L    GL    C+R  RFI+  A K
Sbjct  119  GDDTVRPISQALERTPWARGRAATYRQWEQAELRELAGQVGLAWRGCVRANRFILFAADK  178

Query  319  P  321
            P
Sbjct  179  P  179



>ref|XP_002954755.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
 gb|EFJ44161.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
Length=369

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 72/117 (62%), Gaps = 9/117 (8%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD----GIYSFTPF  168
            LPFA+ SV AVHAGAA+HCWP+P  A+AEISRVL PGGVFVA+T++      G       
Sbjct  250  LPFATGSVAAVHAGAAIHCWPNPQVALAEISRVLAPGGVFVASTFLTATAPLGQVLGDDA  309

Query  169  VRPLRENFAQISGSHI-----FLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
            VRPL +     +G  +     + +E+EL DLCT  GL  ++  R  RFIM    KP+
Sbjct  310  VRPLSQLDPTTAGGIVGTPYRWWEEQELLDLCTAVGLQDWRRERTWRFIMFAVTKPN  366



>ref|XP_006359516.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=343

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF S S+DAVHAGAALHCWPSPS A+AEI+R+L  GGVFV TT++     + T F R L
Sbjct  241  LPFPSGSIDAVHAGAALHCWPSPSNAIAEINRILCSGGVFVGTTFLRVNPSAPTIF-RAL  299

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
             ++  +   ++ +  ++E+EDL T+CGL+ +       FIM +A K
Sbjct  300  EQSALR---TYSYFTQEEIEDLVTSCGLINYTSKVQSSFIMFSAQK  342



>ref|XP_002506188.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67446.1| predicted protein [Micromonas sp. RCC299]
Length=359

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 73/119 (61%), Gaps = 12/119 (10%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY-----IVDGIYSFTP  165
            LPFA+ SVD VHAGAA+HCWPSPSAA+ E++RVLRPGGVFVA+T+     +++ ++    
Sbjct  240  LPFATGSVDVVHAGAAMHCWPSPSAAMVEVARVLRPGGVFVASTFMDPTSMLEDVFGAGA  299

Query  166  FVRPLRENFAQISGS-------HIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
                     A ++         + F  EK+L DL   CGL GF+  R+R+FI+    KP
Sbjct  300  EAAAAPLAEAFVNSGVGTGGAFNQFWREKDLRDLTGMCGLEGFERRRSRQFILFRVNKP  358



>ref|XP_009394966.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=312

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF SSSVDAVHAGAA+HCWPSPSA VAEISRVLRPGGVFVATT+I+D +    P ++ +
Sbjct  248  LPFVSSSVDAVHAGAAIHCWPSPSAGVAEISRVLRPGGVFVATTFILDVLPPVIPILKTV  307

Query  181  RE  186
            R+
Sbjct  308  RQ  309



>gb|ABR16838.1| unknown [Picea sitchensis]
Length=326

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF + SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+++ GI   +  V+PL
Sbjct  251  LPFTAGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFVLSGILD-SDIVKPL  309

Query  181  RE  186
            R+
Sbjct  310  RQ  311



>ref|XP_001418638.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96931.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=227

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 63/113 (56%), Gaps = 7/113 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-----  165
            LPF   S+D VHAGAA+HCWP     VAEI+RVL+PG  F  TT++   +  F       
Sbjct  115  LPFPEGSLDGVHAGAAIHCWPDAKTGVAEIARVLKPGATFCGTTFMNPQVPFFDEDQQAI  174

Query  166  FVRPLRENFAQISGSHIF--LDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            F   +RE    ++    F    +KEL DLCT CGLV FKC    +FI  +A K
Sbjct  175  FDNAVREFSGTVNAERGFRWWSKKELRDLCTECGLVDFKCEIRNQFIFYSAKK  227



>ref|XP_002968407.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
 gb|EFJ30661.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
Length=315

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFAS S+ AV++GAALHCW SPS A+AEI RVLRPGGV VATT++           + +
Sbjct  203  LPFASGSISAVYSGAALHCWESPSIAIAEICRVLRPGGVLVATTFLPRWKSKLQTTQKFM  262

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            R  F    G+ IF  E EL++L  T GLV ++ I+   +IM+ A K
Sbjct  263  RLIF----GTKIFFFEDELDELFETSGLVSYQKIKIDSYIMVCARK  304



>ref|XP_003080221.1| methyltransferase-related (ISS) [Ostreococcus tauri]
 emb|CAL54388.1| Methyltransferase type 11 [Ostreococcus tauri]
Length=389

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 7/113 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF  SS+D VHAGAA+HCWP  + AVAEI+RVL+PG  F  TT++   +  F    + +
Sbjct  272  LPFPESSLDGVHAGAAIHCWPDSTTAVAEIARVLKPGATFCGTTFMNPQVPFFDEDQQEV  331

Query  181  RENFA-QISGSH------IFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
             +    Q SG+        +  +KEL DL T CGLV FKC   ++FI  +A K
Sbjct  332  FDGVVRQFSGTENAARGFRWWSKKELRDLFTECGLVDFKCETRQQFIFYSAKK  384



>ref|XP_001694737.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02321.1| predicted protein [Chlamydomonas reinhardtii]
Length=275

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA+ SV A+HAGAA+HCWP+P AA+AEISRVL PGGVFVA+T++     +  P  + L
Sbjct  159  LPFATGSVAAIHAGAAIHCWPNPQAALAEISRVLAPGGVFVASTFLT----ASAPLGQVL  214

Query  181  RENFAQ-ISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             ++  + +S S  + +E+EL DLC   GL GF+  R+ +FIM +A KP+
Sbjct  215  GDDLVRPLSQSMKYWEEQELRDLCEAVGLQGFQRERSWQFIMFSARKPA  263



>ref|XP_002500021.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61279.1| predicted protein [Micromonas sp. RCC299]
Length=385

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 66/123 (54%), Gaps = 19/123 (15%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRP-  177
            +P  S SV  VHAGAA+HCWP P  AVAEI RVL PGG F  TT++   +    PF    
Sbjct  264  IPMTSDSVGGVHAGAAIHCWPQPREAVAEICRVLEPGGSFCGTTFLTPQL----PFADDE  319

Query  178  --------LRENFAQI----SGSHIF--LDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  315
                    +RE  A +     G+  F   ++K+L DLC  CGLV F+C     FI  +A 
Sbjct  320  TQQRVDAAMRELQAAVVGRAGGARGFRQWNKKDLRDLCVECGLVDFECDIRGGFIFFSAR  379

Query  316  KPS  324
            KP+
Sbjct  380  KPA  382



>dbj|BAC99645.1| hypothetical protein [Oryza sativa Japonica Group]
Length=323

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR  174
            LPF S S+DAVHA AA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ D +    P +R
Sbjct  254  LPFVSGSIDAVHAAAAIHCWPSPACAVAEISRVLRPGGVFVASTFVADILPPAVPVLR  311



>emb|CAN77779.1| hypothetical protein VITISV_004172 [Vitis vinifera]
Length=714

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY---SFTPFV  171
            LPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV TT++   IY   S    +
Sbjct  409  LPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGTTFL-RPIYTNSSIPAIL  467

Query  172  RPLRE  186
            RP R+
Sbjct  468  RPFRQ  472


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 19/92 (21%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF++ SVDAVHAGAALHCWPSPS AV       R      +   +   I     + R L
Sbjct  145  LPFSTGSVDAVHAGAALHCWPSPSNAV-------RINSFMTSDMVLAKSI----EWERSL  193

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFK  276
             +N+  ++       EKE+EDLCT+CGL+ ++
Sbjct  194  -QNYNNLT-------EKEIEDLCTSCGLINYR  217



>ref|XP_007227385.1| hypothetical protein PRUPE_ppb016862mg [Prunus persica]
 gb|EMJ28584.1| hypothetical protein PRUPE_ppb016862mg [Prunus persica]
Length=205

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 59/107 (55%), Gaps = 24/107 (22%)
 Frame = +1

Query  4    PFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLR  183
            PFA+SS DAVHA  ++    +    VA+ISRVLRPGG                       
Sbjct  123  PFATSSADAVHAVYSVSNLAAMVLKVADISRVLRPGG-----------------------  159

Query  184  ENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
             N + I+GS  F+ + +LEDLC  CGLV F  +RNR F+M++A KP+
Sbjct  160  -NISHITGSQQFVSDGKLEDLCNVCGLVSFTSVRNRAFVMISATKPN  205



>gb|KDO59315.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=304

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 51/69 (74%), Gaps = 3/69 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RP  177
            LPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR GGVFV TT++     S T    R 
Sbjct  231  LPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRSGGVFVGTTFLR--YTSSTSLTGRV  288

Query  178  LRENFAQIS  204
            LRE+ A++ 
Sbjct  289  LREDSAELQ  297



>gb|KJB27061.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=332

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 3/63 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRP  177
            LPF+S SVDAVHAGAALHCWPSP  AVAEISR+LR GGVFV +T++     S TP  +RP
Sbjct  235  LPFSSGSVDAVHAGAALHCWPSPLNAVAEISRILRSGGVFVGSTFL--RYTSSTPRIIRP  292

Query  178  LRE  186
             RE
Sbjct  293  FRE  295



>gb|KDO59316.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=314

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  138
            LPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR GGVFV TT++
Sbjct  231  LPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRSGGVFVGTTFL  276



>gb|KCW79026.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=305

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  138
            LPF+S SVDAVHAGAALHCWPSPS A+AEI+RVLR GGVFV TT++
Sbjct  234  LPFSSCSVDAVHAGAALHCWPSPSNAIAEITRVLRSGGVFVGTTFL  279



>gb|KCW79027.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=304

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  138
            LPF+S SVDAVHAGAALHCWPSPS A+AEI+RVLR GGVFV TT++
Sbjct  234  LPFSSCSVDAVHAGAALHCWPSPSNAIAEITRVLRSGGVFVGTTFL  279



>ref|XP_005643537.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE18993.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=357

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 69/113 (61%), Gaps = 6/113 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI-----VDGIYSFTP  165
            LPF + SV A+HAGAA+HCWP+P+ AVAEISRVLRPGGVFV +T++     +  + +   
Sbjct  243  LPFPTGSVAAIHAGAAIHCWPNPTMAVAEISRVLRPGGVFVGSTFLKASAPLGQLLNNDD  302

Query  166  FVRPLRENFAQISGSHI-FLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             VRPL        GS+  + +E EL +L    GL  F+  R  RFIM    KP
Sbjct  303  LVRPLNSLDPMSGGSNYQWWEEAELRELTAAMGLQDFQRHRTNRFIMFAVQKP  355



>ref|XP_002967385.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
 gb|EFJ31984.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
Length=776

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 58/95 (61%), Gaps = 13/95 (14%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI-------VDGIYSF  159
            LP A+SSV AVH+GAA+HCWP P  AVAEISRVLRP G+FV +T++       +DGI   
Sbjct  89   LPLANSSVAAVHSGAAIHCWPEPIIAVAEISRVLRPQGLFVGSTFVFPEPPPPIDGI---  145

Query  160  TPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGL  264
               + P+RE   Q+        +KEL+ L    G+
Sbjct  146  ---INPVREAIMQLQVPFKAWTQKELQQLVEAGGM  177


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT-YIVDGIYSFTPFVRP  177
            LPF SSS+ AVH  AA+HCWP P  AVAEI+R+L+PGG+FVA+T             + P
Sbjct  404  LPFTSSSLAAVHTSAAIHCWPQPLHAVAEIARLLQPGGIFVASTFLFPLPPPPIDKLLEP  463

Query  178  LREN  189
            LR+ 
Sbjct  464  LRQQ  467



>gb|EMS47735.1| hypothetical protein TRIUR3_02804 [Triticum urartu]
Length=241

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 5/87 (6%)
 Frame = +1

Query  73   AAVAEISRVLRPGGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELE  240
            A +AEISRVL+PGGVFVATT++       ++S    ++PLR+    ++ S+ F  E ELE
Sbjct  156  ALIAEISRVLKPGGVFVATTFLSTPTNSSLFSIDA-LKPLRQIVGPVNSSYNFFTEGELE  214

Query  241  DLCTTCGLVGFKCIRNRRFIMLTAMKP  321
            DLC +CGLV +     R FIM +  KP
Sbjct  215  DLCRSCGLVNYSSKVQRSFIMFSGQKP  241



>ref|XP_002502147.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63405.1| predicted protein [Micromonas sp. RCC299]
Length=373

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 58/122 (48%), Gaps = 24/122 (20%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            +PF  SSVDAVH  A  HCWP P   + E+ R+L+PGGVFV +T +            P+
Sbjct  261  MPFGDSSVDAVHCSAGAHCWPDPMDGLREVERILKPGGVFVTSTVV---------LAPPI  311

Query  181  RENFAQISG--------------SHIFLDEKELEDLCTTCGLVGFKCIRNRR-FIMLTAM  315
            RE +A+                 +  F D   +  +    GL G + ++  + F+ML A 
Sbjct  312  REKYAKGGDCTDAQSYDDKVRTMNTPFWDTASVVAMLQKAGLKGVEIVKEDKCFVMLAAR  371

Query  316  KP  321
            KP
Sbjct  372  KP  373



>ref|XP_005536724.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80688.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=441

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 54/94 (57%), Gaps = 10/94 (11%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP-----GGVFVATTYIVDGIYSFTP  165
            LPFA+ S+D +HAGAALHCWP     + E+ R+LRP      G F+ATT+    ++S +P
Sbjct  327  LPFANESIDCIHAGAALHCWPCVQDGLHEVYRILRPSKGPGSGRFLATTF----LWSTSP  382

Query  166  FVRPLRE-NFAQISGSHIFLDEKELEDLCTTCGL  264
            F   +RE      S  + F D KELE L  + G 
Sbjct  383  FGLAVREGRLLSPSAGYRFFDAKELEWLVKSAGF  416



>ref|XP_003057905.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57856.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=235

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 62/118 (53%), Gaps = 11/118 (9%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV--------DGIYS  156
            +PF   SV  VHAGAA+HCWP P AA AEI+R L  GG F  TT++          G   
Sbjct  118  MPFPEGSVGGVHAGAAIHCWPDPRAAAAEIARALERGGSFCGTTFLTPRVPFLDDAGQQQ  177

Query  157  FTPFVRPLRENFA-QISGSHIF--LDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
                +R +++  + +  G+  F   +  +L+DLC  CGLV F+      FI  +A KP
Sbjct  178  LDAAMREVQDAISGRAGGARGFRMWNRADLKDLCEECGLVDFESDVRDGFIFFSAKKP  235



>ref|XP_002960327.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
 gb|EFJ37866.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
Length=604

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT-YIVDGIYSFTPFVRP  177
            LPF SSS+ AVH  AA+HCWP P  AVAEI+R+L+PGG+FVA+T             + P
Sbjct  232  LPFTSSSLAAVHTSAAIHCWPQPLHAVAEIARLLQPGGIFVASTFLFPLPPPPIDKLLEP  291

Query  178  LREN  189
            LR+ 
Sbjct  292  LRQQ  295



>ref|XP_005824779.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
 gb|EKX37799.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
Length=365

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 52/106 (49%), Gaps = 4/106 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF   S+DA+H+GAALHCWP     + E+ RVL+PGG F A+T+    ++     V  L
Sbjct  259  LPFVDGSLDAIHSGAALHCWPYVQDGLKEVHRVLKPGGRFFASTF----LWGVPDEVISL  314

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  318
            + N       + F   +ELE L    G       R  R  ++   K
Sbjct  315  QANLGPRQRQYRFFSVEELEWLMRGAGFKDVNVERRDRCALIRCRK  360



>ref|XP_002185698.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65168.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=412

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  138
            +P  ++SVD +HAGAA+HCWP   AA AEI RVL+PGG + ATT++
Sbjct  303  IPMKNASVDCLHAGAAMHCWPDLPAAAAEIYRVLKPGGRYFATTFL  348



>ref|XP_010250394.1| PREDICTED: uncharacterized protein LOC104592660 [Nelumbo nucifera]
Length=795

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +1

Query  70   SAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQI-SGSHIFLDEKELEDL  246
            +  VAEI+R+LR GG+FV TT++         F   +  N  Q+ S  + +L EKE+EDL
Sbjct  713  TGVVAEITRILRSGGIFVGTTFLAPRFGD--SFRSEIYRNLRQLASNGYGYLTEKEIEDL  770

Query  247  CTTCGLVGFKCIRNRRFIMLTAMK  318
            C +CGL+ +     + FIM +A K
Sbjct  771  CISCGLINYTSKVQQSFIMFSAQK  794



>ref|XP_007514982.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15222.1| predicted protein [Bathycoccus prasinos]
Length=383

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (47%), Gaps = 9/115 (8%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV--------DGIYS  156
            LPFA+ S+  V A AA+HCWP   +A AEI RVL+PG +F  TT+          D    
Sbjct  270  LPFANDSIGGVSASAAIHCWPDVQSACAEIFRVLKPGRIFTGTTFATPNVPFLDDDQNRL  329

Query  157  FTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
             +   R L  +    +G   F +  +L D   + G      +R + ++   A KP
Sbjct  330  LSTLSRDLSASRPGTNGLR-FWNSADLRDQLQSIGFSDVTILREKDYLFWKARKP  383



>ref|XP_002992310.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
 gb|EFJ06586.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
Length=212

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 9/73 (12%)
 Frame = +1

Query  100  LRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  279
            L+PGGVFVATT++ + I+SF P  R         S S  +  EKELE+LC  CGLV ++ 
Sbjct  148  LKPGGVFVATTFLSNSIFSFLPKRR---------SSSLRYWTEKELEELCKLCGLVDYQK  198

Query  280  IRNRRFIMLTAMK  318
                 +IML+A K
Sbjct  199  KMKGNYIMLSARK  211



>ref|XP_005713645.1| unnamed protein product [Chondrus crispus]
 emb|CDF33826.1| unnamed protein product [Chondrus crispus]
Length=298

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY  135
            LPF   +  AVH+GAALHCWP+    +AEI RVL+PGG F ATT+
Sbjct  181  LPFVEGAFGAVHSGAALHCWPNVQDGLAEIQRVLQPGGRFFATTF  225



>gb|EWM24600.1| phosphatidylethanolamine n [Nannochloropsis gaditana]
Length=387

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  4    PFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  144
            PF +SSVDA+HAGAALHCWP    ++ E  RVL+PGG   A+T+ V+
Sbjct  289  PFQTSSVDAIHAGAALHCWPRLEESLRECLRVLKPGGRMYASTFEVN  335



>ref|XP_005855405.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
 ref|XP_005855816.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20544.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20954.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
Length=387

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  4    PFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  144
            PF +SSVDA+HAGAALHCWP    ++ E  RVL+PGG   A+T+ V+
Sbjct  289  PFQTSSVDAIHAGAALHCWPRLEESLRECLRVLKPGGRMYASTFEVN  335



>gb|EJK66010.1| hypothetical protein THAOC_13088 [Thalassiosira oceanica]
Length=446

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  138
            +P  S SVDA HAGAA+HCWP    ++ EI RVL PGG + ATT++
Sbjct  335  IPMKSDSVDAFHAGAAMHCWPEIEKSLQEIHRVLVPGGRYFATTFL  380



>ref|XP_002503324.1| chloroplast envelope protein translocase family [Micromonas sp. 
RCC299]
 gb|ACO64582.1| chloroplast envelope protein translocase family [Micromonas sp. 
RCC299]
Length=903

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  141
            LPF   +  AVH+ A +HCWP P+  + E+SRVL+PGG FVA+T ++
Sbjct  248  LPFDDDAFAAVHSAAGIHCWPEPARGLEEVSRVLKPGGTFVASTVVL  294



>ref|XP_005781281.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
 gb|EOD28852.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
Length=459

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP-GGVFVATTYIVDGIYSFTPFVRP  177
            LP    +VDA+HAGAALH WP+    ++EI RVLRP GG F ATT++  G Y  T    P
Sbjct  219  LPMRDGAVDAMHAGAALHSWPNLEKGLSEIRRVLRPDGGRFFATTFL-RGAYPGTTSATP  277

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGL  264
             +      S    F  E+EL  L    G 
Sbjct  278  GQSGGGGGS-FRFFESEEELRQLLIAAGF  305



>emb|CBJ26935.1| S-adenosyl-L-methionine-dependent methyltransferases-like [Ectocarpus 
siliculosus]
Length=471

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 11/102 (11%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----F  168
            LP  + S+D VHAGAALHCW     +++E+ RVL+PG  F ATT++   +   T      
Sbjct  365  LPLKTESLDGVHAGAALHCWSKLEESLSEVHRVLKPGRGFFATTFLNSAVLGNTAGNTVG  424

Query  169  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR  294
                R+ F        F +  ELE L    G    K ++  R
Sbjct  425  NSRRRDGFK-------FFELAELEQLMRNAGFEDVKVVKEGR  459



>ref|WP_037584032.1| hypothetical protein, partial [Stigmatella aurantiaca]
Length=252

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 56/110 (51%), Gaps = 9/110 (8%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY--IVDGIYSFTPFVR  174
            LP + +S+ AV    +L   P+PS A+ E+SR L+PGGVF   TY    + +Y +     
Sbjct  149  LPLSDASLGAVSCWNSLQLLPNPSEAIREVSRCLKPGGVFTCFTYRRAREPLYGY-----  203

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
              +  FA+  G   F DE+EL    T  GLV          ++LTA KP+
Sbjct  204  -FQSTFARNGGVRPF-DEEELRQWLTQAGLVVEDLGGPNLALLLTARKPT  251



>gb|ADO73882.1| Methyltransferase type 11 [Stigmatella aurantiaca DW4/3-1]
Length=265

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 56/110 (51%), Gaps = 9/110 (8%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY--IVDGIYSFTPFVR  174
            LP + +S+ AV    +L   P+PS A+ E+SR L+PGGVF   TY    + +Y +     
Sbjct  162  LPLSDASLGAVSCWNSLQLLPNPSEAIREVSRCLKPGGVFTCFTYRRAREPLYGY-----  216

Query  175  PLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  324
              +  FA+  G   F DE+EL    T  GLV          ++LTA KP+
Sbjct  217  -FQSTFARNGGVRPF-DEEELRQWLTQAGLVVEDLGGPNLALLLTARKPT  264



>gb|KIE07218.1| hypothetical protein DA73_0239355 [Tolypothrix bouteillei VB521301]
Length=263

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  138
            LP A +S+DA++AGAA+HCW   +  +  I + LRPGG  +ATT++
Sbjct  173  LPLAPNSIDAIYAGAAMHCWNDATEGIRNIYQALRPGGKLLATTFL  218



>ref|XP_005705444.1| phosphatidylethanolamine n-methyltransferase, putative [Galdieria 
sulphuraria]
 gb|EME28924.1| phosphatidylethanolamine n-methyltransferase, putative [Galdieria 
sulphuraria]
Length=331

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 46/88 (52%), Gaps = 12/88 (14%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LP   + VD ++ GAALHCWP     +AE+ R+L+P  +  ATT+I +    ++P +   
Sbjct  230  LPLRDNVVDLIYCGAALHCWPKVQDGLAEMYRILKPDALVFATTFISN----YSPLISRW  285

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGL  264
                     ++ F  +KELE L  + G 
Sbjct  286  --------NAYRFFTKKELEWLLKSRGF  305



>ref|XP_010040339.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=269

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAV  81
            LPF+SSSVDAVHAGAALHCWPSPS AV
Sbjct  234  LPFSSSSVDAVHAGAALHCWPSPSNAV  260



>gb|KJB59930.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=258

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAV  81
            LPF SSS+DAVHAGAALHCWPSPS A+
Sbjct  231  LPFESSSIDAVHAGAALHCWPSPSTAL  257



>ref|WP_044509270.1| SAM-dependent methyltransferase [Mycobacterium simiae]
Length=245

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 51/96 (53%), Gaps = 15/96 (16%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG---VFVATTYIVDGIYSFTPFV  171
            LPF  ++VDAV + A L   P+PSAA+AE++RVLRPGG   V V T      ++   P  
Sbjct  148  LPFRDNTVDAVISLAVLQLIPNPSAALAEMARVLRPGGRLAVMVPTVGRAARLWQLLP--  205

Query  172  RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  279
                 NF    G+H+F  E E+ D+    G V  + 
Sbjct  206  -----NF----GAHVF-GEDEIGDVLEEHGFVSVRV  231



>ref|XP_008389527.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=304

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRV  99
            LPF S SVDAVHAGAALHCWPSPS AV+ +S V
Sbjct  242  LPFPSGSVDAVHAGAALHCWPSPSNAVSCVSCV  274



>ref|XP_003079346.1| non-transporter ABC protein (ISS) [Ostreococcus tauri]
Length=1835

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/108 (30%), Positives = 49/108 (45%), Gaps = 9/108 (8%)
 Frame = +1

Query  1     LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG-VFVATTYIVDGIYSFTPFVRP  177
             LPFA    DAVH+ A  HCW  P     E+ R LRPGG   V+T  ++    S   + R 
Sbjct  1735  LPFADEVFDAVHSSAGAHCWDDPVKGFVELHRTLRPGGKALVSTVVLLKTTGSEEDYTRK  1794

Query  178   LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR-FIMLTAMK  318
              + N         F +E+ +  +  + G    + +R  + F+ + A K
Sbjct  1795  RKSNTP-------FWNERAVCRMMESVGFRNVEVVRKDKCFVAIKATK  1835



>emb|CEF97980.1| Methyltransferase type 11 [Ostreococcus tauri]
Length=273

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 49/108 (45%), Gaps = 9/108 (8%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG-VFVATTYIVDGIYSFTPFVRP  177
            LPFA    DAVH+ A  HCW  P     E+ R LRPGG   V+T  ++    S   + R 
Sbjct  173  LPFADEVFDAVHSSAGAHCWDDPVKGFVELHRTLRPGGKALVSTVVLLKTTGSEEDYTRK  232

Query  178  LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR-FIMLTAMK  318
             + N         F +E+ +  +  + G    + +R  + F+ + A K
Sbjct  233  RKSNTP-------FWNERAVCRMMESVGFRNVEVVRKDKCFVAIKATK  273



>ref|WP_014739643.1| ubiquinone biosynthesis methyltransferase UbiE [Modestobacter 
marinus]
 emb|CCH87041.1| Phosphatidylethanolamine N-methyltransferase [Modestobacter marinus]
Length=204

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 58/113 (51%), Gaps = 13/113 (12%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRP-  177
            LPFA ++ D V A   L   P    AVAE++RVLRPGG  V    ++D + S +P VR  
Sbjct  99   LPFADATFDTVLATLTLCSIPDDVTAVAEMARVLRPGGRLV----LLDHVASPSPVVRGV  154

Query  178  ---LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR--FIMLTAMKP  321
               L   F +++  H+    +E ED     GLV  +  R+R    + LTA +P
Sbjct  155  QRLLEPLFLRLAADHLL---REPEDAVRRAGLVIEELSRSRAGLVLRLTARRP  204



>ref|WP_022122196.1| hypothetical protein [Clostridium sp. CAG:510]
 emb|CDA68638.1| putative uncharacterized protein [Clostridium sp. CAG:510]
Length=225

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            L +A +S D V AG  +H  P P AA+ E++RV +PGG  +  TYI D   +    VR L
Sbjct  116  LKYADNSFDKVVAGNVIHLLPEPKAALQELTRVCKPGGRLIIPTYINDTKSTNKAAVRFL  175

Query  181  RE---NFAQ  198
             +   NF Q
Sbjct  176  EKLGANFKQ  184



>ref|WP_042432128.1| methyltransferase [Clostridium sp. JCD]
Length=174

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  138
            LP+ + S DAV    ALH  PSP  A+ EI RVLRPGG+ +A T++
Sbjct  98   LPYPAESFDAVLIANALHIMPSPDKALEEIHRVLRPGGMLLAPTFL  143



>ref|WP_043403276.1| hypothetical protein [Cystobacter violaceus]
Length=248

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 50/107 (47%), Gaps = 10/107 (9%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF   S+ AV    +LH        + E++RVLRPGG FVA+T++  G  S        
Sbjct  150  LPFQDDSLGAVLLSHSLHFISDVGRLLLEVARVLRPGGRFVASTWLPPGRAS--------  201

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
               F Q        +E EL D  +  GL GF  +R    +++ A KP
Sbjct  202  --TFVQRRAGLHPREEDELRDALSAVGLAGFARLRLPPLLVVKAEKP  246



>ref|WP_011557522.1| MULTISPECIES: SAM-dependent methyltransferase [Mycobacterium]
 gb|ABG06216.1| Methyltransferase type 11 [Mycobacterium sp. MCS]
 gb|ABL89322.1| Methyltransferase type 11 [Mycobacterium sp. KMS]
 gb|ABN95897.1| Methyltransferase type 11 [Mycobacterium sp. JLS]
Length=235

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 47/96 (49%), Gaps = 15/96 (16%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPG---GVFVATTYIVDGIYSFTPFV  171
            LP    SVDAV + A L   P PSAA+AE+ RVLRPG    V V T   +  + +  P  
Sbjct  138  LPLRDESVDAVVSVAMLQLIPDPSAAMAEMVRVLRPGRRMAVMVPTAGQMARLINVLPN-  196

Query  172  RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  279
                      +G+ +F DE EL D     GLVG + 
Sbjct  197  ----------AGARVF-DEDELGDALEGLGLVGVRT  221



>gb|KFA90141.1| hypothetical protein Q664_29640 [Cystobacter violaceus Cb vi76]
Length=266

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 50/107 (47%), Gaps = 10/107 (9%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPF   S+ AV    +LH        + E++RVLRPGG FVA+T++  G  S        
Sbjct  168  LPFQDDSLGAVLLSHSLHFISDVGRLLLEVARVLRPGGRFVASTWLPPGRAS--------  219

Query  181  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  321
               F Q        +E EL D  +  GL GF  +R    +++ A KP
Sbjct  220  --TFVQRRAGLHPREEDELRDALSAVGLAGFARLRLPPLLVVKAEKP  264



>ref|WP_006242682.1| SAM-dependent methyltransferase [Mycobacterium tusciae]
Length=247

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 49/109 (45%), Gaps = 23/109 (21%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG---VFVATTYIVDGIYSFTPFV  171
            LP    +VDA  + A L   P+P+  +AEI+RVL+PGG   + V T   + G+    P  
Sbjct  150  LPLRDETVDAATSLAVLQLIPNPAQTLAEIARVLKPGGRVALMVPTAGNISGLAHLLP--  207

Query  172  RPLRENFAQISGSHIFLDEKELEDLCTTCGLVG--------FKCIRNRR  294
                       G   F  E EL D+    GLVG        F+ +R RR
Sbjct  208  ----------KGGANFFAEDELADILEDLGLVGVRTKTVGTFQWVRARR  246



>ref|WP_009647626.1| SAM-dependent methyltransferase [Actinomyces sp. ICM47]
 gb|EJG15792.1| methionine biosynthesis protein MetW-like protein [Actinomyces 
sp. ICM47]
Length=200

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR  174
            L +A  S DAV AG  +H  P P  A+ EI RV+RPGG  +  TY++    + T F+R
Sbjct  93   LHYADDSFDAVVAGNVIHLLPEPGDALKEIKRVVRPGGTIIVPTYVIPKKRAHTMFLR  150



>ref|WP_033335056.1| hypothetical protein, partial [Scytonema hofmanni]
Length=79

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV  123
            LP A  S+DA++AGAA+HCW   +  +  I + LRPGG  +
Sbjct  39   LPLAPDSIDAIYAGAAMHCWNDATEGIRNIYQALRPGGKLL  79



>ref|XP_003056909.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58554.1| predicted protein [Micromonas pusilla CCMP1545]
Length=378

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 56/113 (50%), Gaps = 6/113 (5%)
 Frame = +1

Query  1    LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL  180
            LPFA++SV   HA AA HCWP P     E++RVL PGGVFV +T ++ G        R L
Sbjct  264  LPFAANSVAGAHASAAAHCWPDPKLGFREVARVLAPGGVFVTSTVVLAGPIKTKFVERGL  323

Query  181  RENFAQISGSHI-----FLDEKELEDLCTTCGLVGFKCI-RNRRFIMLTAMKP  321
              + A            F D   +  +    GLV  + + +++ F+M+   KP
Sbjct  324  CADAASYDAKEWKPNTPFWDTPAVVKMLEDAGLVDVEVLAQDKCFVMVKGTKP  376



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950