BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF023N21

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004232400.1|  PREDICTED: succinate dehydrogenase [ubiquino...    257   4e-78   Solanum lycopersicum
ref|XP_009794665.1|  PREDICTED: succinate dehydrogenase [ubiquino...    257   4e-78   Nicotiana sylvestris
ref|XP_009794664.1|  PREDICTED: succinate dehydrogenase [ubiquino...    254   5e-77   Nicotiana sylvestris
ref|XP_009624858.1|  PREDICTED: succinate dehydrogenase [ubiquino...    253   1e-76   Nicotiana tomentosiformis
ref|XP_006340609.1|  PREDICTED: succinate dehydrogenase [ubiquino...    251   5e-76   Solanum tuberosum [potatoes]
emb|CDP02029.1|  unnamed protein product                                249   5e-75   Coffea canephora [robusta coffee]
ref|XP_011099603.1|  PREDICTED: succinate dehydrogenase [ubiquino...    241   5e-72   Sesamum indicum [beniseed]
ref|XP_009371587.1|  PREDICTED: succinate dehydrogenase [ubiquino...    239   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_008338100.1|  PREDICTED: succinate dehydrogenase [ubiquino...    239   2e-71   Malus domestica [apple tree]
ref|XP_008338495.1|  PREDICTED: succinate dehydrogenase [ubiquino...    236   2e-70   Malus domestica [apple tree]
ref|XP_008241667.1|  PREDICTED: succinate dehydrogenase [ubiquino...    236   3e-70   Prunus mume [ume]
ref|XP_008344291.1|  PREDICTED: succinate dehydrogenase [ubiquino...    236   3e-70   
ref|XP_004170583.1|  PREDICTED: succinate dehydrogenase [ubiquino...    223   5e-70   
ref|XP_009350004.1|  PREDICTED: succinate dehydrogenase [ubiquino...    234   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_011025771.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   4e-69   Populus euphratica
ref|XP_002310225.1|  Succinate dehydrogenase flavoprotein subunit       233   8e-69   
ref|XP_010547500.1|  PREDICTED: succinate dehydrogenase [ubiquino...    232   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_010679713.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   2e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004287904.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   3e-68   Fragaria vesca subsp. vesca
ref|XP_006425687.1|  hypothetical protein CICLE_v10025149mg             230   4e-68   Citrus clementina [clementine]
gb|KDO79531.1|  hypothetical protein CISIN_1g046556mg                   230   5e-68   Citrus sinensis [apfelsine]
gb|KHG24771.1|  SDH1-1: Succinate dehydrogenase [ubiquinone] flav...    229   7e-68   Gossypium arboreum [tree cotton]
ref|XP_006383209.1|  hypothetical protein POPTR_0005s12530g             230   9e-68   
gb|KHG24770.1|  SDH1-1: Succinate dehydrogenase [ubiquinone] flav...    229   1e-67   Gossypium arboreum [tree cotton]
ref|XP_008453738.1|  PREDICTED: succinate dehydrogenase [ubiquino...    229   2e-67   Cucumis melo [Oriental melon]
ref|XP_004512040.1|  PREDICTED: succinate dehydrogenase [ubiquino...    228   3e-67   Cicer arietinum [garbanzo]
gb|ADZ75464.1|  succinate dehydrogenase                                 228   4e-67   Litchi chinensis [litchi]
ref|XP_010550391.1|  PREDICTED: succinate dehydrogenase [ubiquino...    228   5e-67   Tarenaya hassleriana [spider flower]
ref|XP_010484716.1|  PREDICTED: succinate dehydrogenase [ubiquino...    225   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_007202009.1|  hypothetical protein PRUPE_ppa002787mg             228   6e-67   
ref|XP_003517234.1|  PREDICTED: succinate dehydrogenase [ubiquino...    227   7e-67   Glycine max [soybeans]
gb|KHN36125.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    227   7e-67   Glycine soja [wild soybean]
gb|KJB17788.1|  hypothetical protein B456_003G015500                    227   8e-67   Gossypium raimondii
ref|XP_007046958.1|  Succinate dehydrogenase 1-1 isoform 2              223   1e-66   
gb|KHN41982.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    226   1e-66   Glycine soja [wild soybean]
ref|XP_003537582.1|  PREDICTED: succinate dehydrogenase [ubiquino...    226   1e-66   Glycine max [soybeans]
ref|XP_006280112.1|  hypothetical protein CARUB_v10026004mg             226   5e-66   
ref|XP_004149154.1|  PREDICTED: succinate dehydrogenase [ubiquino...    225   6e-66   
gb|KGN53253.1|  hypothetical protein Csa_4G038700                       225   6e-66   Cucumis sativus [cucumbers]
ref|XP_009103488.1|  PREDICTED: succinate dehydrogenase [ubiquino...    224   6e-66   
ref|XP_010444735.1|  PREDICTED: succinate dehydrogenase [ubiquino...    224   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002866741.1|  succinate dehydrogenase 1-1                        224   9e-66   
gb|KJB48416.1|  hypothetical protein B456_008G068200                    224   1e-65   Gossypium raimondii
gb|KJB48417.1|  hypothetical protein B456_008G068200                    224   1e-65   Gossypium raimondii
ref|XP_011003741.1|  PREDICTED: succinate dehydrogenase [ubiquino...    224   1e-65   Populus euphratica
gb|KHF98130.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    224   1e-65   Gossypium arboreum [tree cotton]
ref|XP_007046957.1|  Succinate dehydrogenase 1-1 isoform 1              223   2e-65   Theobroma cacao [chocolate]
ref|NP_201477.1|  succinate dehydrogenase [ubiquinone] flavoprote...    223   3e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30754.1|  BnaC07g16540D                                          223   3e-65   Brassica napus [oilseed rape]
gb|EPS73058.1|  hypothetical protein M569_01696                         214   5e-65   Genlisea aurea
gb|KDP30152.1|  hypothetical protein JCGZ_18113                         223   5e-65   Jatropha curcas
ref|XP_010464904.1|  PREDICTED: succinate dehydrogenase [ubiquino...    222   6e-65   Camelina sativa [gold-of-pleasure]
gb|KEH27558.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    221   8e-65   Medicago truncatula
ref|XP_009103489.1|  PREDICTED: succinate dehydrogenase [ubiquino...    222   8e-65   Brassica rapa
ref|XP_003611986.1|  Succinate dehydrogenase                            221   2e-64   Medicago truncatula
ref|XP_006393871.1|  hypothetical protein EUTSA_v10003821mg             220   3e-64   Eutrema salsugineum [saltwater cress]
ref|XP_003518027.1|  PREDICTED: succinate dehydrogenase [ubiquino...    219   7e-64   Glycine max [soybeans]
ref|XP_010113491.1|  Succinate dehydrogenase [ubiquinone] flavopr...    219   8e-64   
ref|XP_007156937.1|  hypothetical protein PHAVU_002G029800g             219   1e-63   Phaseolus vulgaris [French bean]
ref|XP_006409150.1|  hypothetical protein EUTSA_v10022591mg             219   1e-63   
ref|XP_010263680.1|  PREDICTED: succinate dehydrogenase [ubiquino...    218   2e-63   Nelumbo nucifera [Indian lotus]
ref|XP_010489548.1|  PREDICTED: succinate dehydrogenase [ubiquino...    218   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010467662.1|  PREDICTED: succinate dehydrogenase [ubiquino...    218   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010942023.1|  PREDICTED: succinate dehydrogenase [ubiquino...    217   6e-63   Elaeis guineensis
ref|XP_010414323.1|  PREDICTED: succinate dehydrogenase [ubiquino...    217   7e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002463806.1|  hypothetical protein SORBIDRAFT_01g006490          216   8e-63   Sorghum bicolor [broomcorn]
ref|XP_008787307.1|  PREDICTED: succinate dehydrogenase [ubiquino...    216   9e-63   Phoenix dactylifera
ref|XP_009406751.1|  PREDICTED: succinate dehydrogenase [ubiquino...    216   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002530482.1|  succinate dehydrogenase, putative                  216   1e-62   
ref|XP_004981574.1|  PREDICTED: succinate dehydrogenase [ubiquino...    216   1e-62   Setaria italica
emb|CDY49839.1|  BnaC02g43980D                                          216   1e-62   Brassica napus [oilseed rape]
ref|XP_006299856.1|  hypothetical protein CARUB_v10016059mg             212   4e-62   
ref|XP_010254866.1|  PREDICTED: succinate dehydrogenase [ubiquino...    214   7e-62   Nelumbo nucifera [Indian lotus]
ref|XP_004509253.1|  PREDICTED: succinate dehydrogenase [ubiquino...    213   1e-61   
ref|XP_008783479.1|  PREDICTED: succinate dehydrogenase [ubiquino...    211   1e-61   Phoenix dactylifera
ref|XP_002269407.1|  PREDICTED: succinate dehydrogenase [ubiquino...    214   1e-61   Vitis vinifera
ref|XP_010942844.1|  PREDICTED: succinate dehydrogenase [ubiquino...    213   2e-61   Elaeis guineensis
gb|KFK28359.1|  succinate dehydrogenase                                 213   2e-61   Arabis alpina [alpine rockcress]
ref|XP_010029813.1|  PREDICTED: succinate dehydrogenase [ubiquino...    213   2e-61   Eucalyptus grandis [rose gum]
ref|XP_010942839.1|  PREDICTED: succinate dehydrogenase [ubiquino...    213   2e-61   Elaeis guineensis
ref|XP_009408578.1|  PREDICTED: succinate dehydrogenase [ubiquino...    213   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004509252.1|  PREDICTED: succinate dehydrogenase [ubiquino...    212   3e-61   Cicer arietinum [garbanzo]
ref|NP_001058845.1|  Os07g0134800                                       212   3e-61   
dbj|BAK02783.1|  predicted protein                                      212   3e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004972473.1|  PREDICTED: succinate dehydrogenase [ubiquino...    212   3e-61   Setaria italica
dbj|BAK08049.1|  predicted protein                                      212   3e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002886171.1|  succinate dehydrogenase 1-2                        212   4e-61   
emb|CDY57124.1|  BnaA09g52600D                                          212   4e-61   Brassica napus [oilseed rape]
ref|XP_009112333.1|  PREDICTED: succinate dehydrogenase [ubiquino...    212   4e-61   Brassica rapa
gb|EEE66523.1|  hypothetical protein OsJ_23002                          212   4e-61   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA59498.1|  TPA: hypothetical protein ZEAMMB73_792658              211   6e-61   
ref|XP_009112332.1|  PREDICTED: succinate dehydrogenase [ubiquino...    211   8e-61   Brassica rapa
ref|XP_007156038.1|  hypothetical protein PHAVU_003G253200g             211   9e-61   Phaseolus vulgaris [French bean]
ref|NP_001146722.1|  uncharacterized protein LOC100280324               211   9e-61   Zea mays [maize]
ref|NP_001146352.1|  uncharacterized protein LOC100279930               211   1e-60   Zea mays [maize]
ref|XP_008783478.1|  PREDICTED: succinate dehydrogenase [ubiquino...    211   1e-60   Phoenix dactylifera
gb|ACG43057.1|  succinate dehydrogenase flavoprotein subunit,mito...    210   1e-60   Zea mays [maize]
ref|NP_179435.1|  succinate dehydrogenase [ubiquinone] flavoprote...    210   2e-60   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA42707.1|  TPA: hypothetical protein ZEAMMB73_508415              211   2e-60   
gb|EMS46614.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    208   6e-60   Triticum urartu
ref|XP_006856022.1|  hypothetical protein AMTR_s00059p00054360          209   6e-60   
gb|AIZ74343.1|  succinate dehydrogenase                                 207   2e-59   Pinus massoniana [Chinese red pine]
emb|CDX81369.1|  BnaC09g07800D                                          207   3e-59   
ref|XP_003558573.1|  PREDICTED: succinate dehydrogenase [ubiquino...    206   7e-59   Brachypodium distachyon [annual false brome]
gb|KFK40220.1|  hypothetical protein AALP_AA3G346200                    206   9e-59   Arabis alpina [alpine rockcress]
emb|CDY29234.1|  BnaA06g25230D                                          203   7e-58   Brassica napus [oilseed rape]
ref|XP_009150830.1|  PREDICTED: succinate dehydrogenase [ubiquino...    203   7e-58   Brassica rapa
ref|XP_002970038.1|  hypothetical protein SELMODRAFT_440964             203   9e-58   Selaginella moellendorffii
ref|XP_006658260.1|  PREDICTED: succinate dehydrogenase [ubiquino...    203   1e-57   Oryza brachyantha
ref|XP_002985229.1|  hypothetical protein SELMODRAFT_446158             202   3e-57   Selaginella moellendorffii
ref|XP_004981575.1|  PREDICTED: succinate dehydrogenase [ubiquino...    200   6e-57   
emb|CDY36482.1|  BnaC03g48410D                                          200   8e-57   Brassica napus [oilseed rape]
gb|EMT18500.1|  Succinate dehydrogenase (ubiquinone) flavoprotein...    200   9e-57   
gb|EMS68611.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    199   1e-56   Triticum urartu
gb|KDD75364.1|  FAD binding domain-containing protein                   196   4e-56   Helicosporidium sp. ATCC 50920
gb|EMT27843.1|  Succinate dehydrogenase (ubiquinone) flavoprotein...    199   4e-56   
gb|KCW56781.1|  hypothetical protein EUGRSUZ_I024522                    196   2e-55   Eucalyptus grandis [rose gum]
ref|XP_003557614.1|  PREDICTED: succinate dehydrogenase [ubiquino...    196   3e-55   Brachypodium distachyon [annual false brome]
ref|XP_001762172.1|  predicted protein                                  196   3e-55   
ref|XP_001780340.1|  predicted protein                                  195   8e-55   
ref|XP_011396968.1|  Succinate dehydrogenase [ubiquinone] flavopr...    193   3e-54   Auxenochlorella protothecoides
ref|XP_001689842.1|  succinate dehydrogenase subunit A                  193   4e-54   Chlamydomonas reinhardtii
ref|XP_011097110.1|  PREDICTED: LOW QUALITY PROTEIN: succinate de...    192   1e-53   Sesamum indicum [beniseed]
ref|XP_002505866.1|  succinate dehydrogenase                            190   6e-53   Micromonas commoda
ref|XP_003063914.1|  predicted protein                                  189   9e-53   Micromonas pusilla CCMP1545
emb|CAN74538.1|  hypothetical protein VITISV_023718                     187   2e-52   Vitis vinifera
gb|KIY92921.1|  succinate dehydrogenase (ubiquinone)flavoprotein ...    179   4e-52   Monoraphidium neglectum
gb|EXX63396.1|  succinate dehydrogenase flavoprotein subunit SDH1       187   1e-51   Rhizophagus irregularis DAOM 197198w
ref|XP_005644633.1|  succinate dehydrogenase                            186   1e-51   Coccomyxa subellipsoidea C-169
ref|XP_008036136.1|  succinate dehydrogenase                            186   1e-51   Trametes versicolor FP-101664 SS1
ref|XP_003082803.1|  succinate dehydrogenase flavoprotein alpha s...    186   2e-51   Ostreococcus tauri
ref|XP_002949632.1|  succinate dehydrogenase subunit A, mitochond...    186   2e-51   Volvox carteri f. nagariensis
ref|XP_007364698.1|  succinate dehydrogenase                            186   2e-51   Dichomitus squalens LYAD-421 SS1
ref|XP_002186498.1|  succinate dehydrogenase flavoprotein               185   4e-51   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_001422453.1|  predicted protein                                  184   7e-51   Ostreococcus lucimarinus CCE9901
tpg|DAA34477.1|  TPA: succinate dehydrogenase flavoprotein subunit      175   7e-51   Amblyomma variegatum
emb|CDH53199.1|  succinate dehydrogenase                                184   1e-50   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH57827.1|  succinate dehydrogenase                                184   1e-50   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001610645.1|  succinate dehydrogenase alpha subunit              184   1e-50   Babesia bovis T2Bo
gb|KIW07596.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    184   1e-50   Verruconis gallopava
emb|CDS14117.1|  Putative Similar to succinate dehydrogenaseFT fl...    183   1e-50   Lichtheimia ramosa
ref|XP_007513731.1|  succinate dehydrogenase flavoprotein subunit       184   1e-50   Bathycoccus prasinos
emb|CDS14431.1|  Putative Genomic scaffold, msy_sf_7                    183   1e-50   Lichtheimia ramosa
ref|XP_007411829.1|  hypothetical protein MELLADRAFT_44058              184   1e-50   Melampsora larici-populina 98AG31
ref|XP_001438844.1|  hypothetical protein                               175   2e-50   Paramecium tetraurelia strain d4-2
ref|XP_008725706.1|  succinate dehydrogenase [ubiquinone] flavopr...    184   2e-50   Cladophialophora carrionii CBS 160.54
gb|KIK16393.1|  hypothetical protein PISMIDRAFT_686379                  183   2e-50   Pisolithus microcarpus 441
gb|KIK21346.1|  hypothetical protein PISMIDRAFT_681255                  183   2e-50   Pisolithus microcarpus 441
gb|KIW65101.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    183   2e-50   Phialophora americana
ref|XP_007871954.1|  hypothetical protein PNEG_00097                    183   2e-50   Pneumocystis murina B123
ref|XP_007759146.1|  succinate dehydrogenase [ubiquinone] flavopr...    182   3e-50   Cladophialophora yegresii CBS 114405
gb|KIM55848.1|  hypothetical protein SCLCIDRAFT_133784                  182   3e-50   Scleroderma citrinum Foug A
ref|XP_006680864.1|  hypothetical protein BATDEDRAFT_90431              182   3e-50   Batrachochytrium dendrobatidis JAM81
gb|EME43895.1|  hypothetical protein DOTSEDRAFT_53161                   182   3e-50   Dothistroma septosporum NZE10
ref|XP_001438472.1|  hypothetical protein                               177   3e-50   Paramecium tetraurelia strain d4-2
ref|XP_007930389.1|  hypothetical protein MYCFIDRAFT_87948              182   3e-50   Pseudocercospora fijiensis CIRAD86
ref|XP_002293997.1|  succinate dehydrogenase flavoprotein subunit       182   3e-50   Thalassiosira pseudonana CCMP1335
emb|CEG67799.1|  Putative Succinate dehydrogenase flavoprotein su...    182   4e-50   Rhizopus microsporus
gb|KIP04793.1|  hypothetical protein PHLGIDRAFT_109109                  182   4e-50   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_005707863.1|  succinate dehydrogenase (ubiquinone) flavopr...    182   4e-50   Galdieria sulphuraria
emb|CDS03760.1|  hypothetical protein LRAMOSA01161                      181   5e-50   Lichtheimia ramosa
ref|XP_001839894.1|  succinate dehydrogenase flavoprotein subunit       182   5e-50   Coprinopsis cinerea okayama7#130
ref|XP_004207738.1|  PREDICTED: probable succinate dehydrogenase ...    174   5e-50   
ref|XP_007396243.1|  hypothetical protein PHACADRAFT_256884             182   5e-50   Phanerochaete carnosa HHB-10118-sp
gb|KEQ61905.1|  succinate dehydrogenase                                 182   6e-50   Aureobasidium melanogenum CBS 110374
ref|XP_003738076.1|  PREDICTED: succinate dehydrogenase [ubiquino...    181   7e-50   Galendromus occidentalis
gb|KFY12526.1|  hypothetical protein V491_06755                         176   8e-50   Pseudogymnoascus sp. VKM F-3775
ref|XP_007692911.1|  hypothetical protein COCMIDRAFT_108460             181   9e-50   Bipolaris oryzae ATCC 44560
ref|XP_007708277.1|  hypothetical protein COCCADRAFT_85691              181   1e-49   Bipolaris zeicola 26-R-13
emb|CEP10579.1|  hypothetical protein                                   181   1e-49   Parasitella parasitica
ref|XP_006956287.1|  succinate dehydrogenase                            181   1e-49   Wallemia mellicola CBS 633.66
gb|EIE88610.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    181   1e-49   Rhizopus delemar RA 99-880
gb|KFG36146.1|  flavoprotein subunit of succinate dehydrogenase         181   1e-49   Toxoplasma gondii GAB2-2007-GAL-DOM2
gb|EIE82583.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    181   1e-49   Rhizopus delemar RA 99-880
gb|EWM29067.1|  succinate dehydrogenase flavoprotein subunit            181   1e-49   Nannochloropsis gaditana
gb|KFH16527.1|  flavoprotein subunit of succinate dehydrogenase         181   1e-49   Toxoplasma gondii MAS
dbj|GAN03015.1|  succinate dehydrogenase                                181   1e-49   Mucor ambiguus
gb|KFG52820.1|  flavoprotein subunit of succinate dehydrogenase         181   1e-49   Toxoplasma gondii FOU
gb|EPB90491.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    181   1e-49   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_007701408.1|  hypothetical protein COCSADRAFT_120336             181   1e-49   Bipolaris sorokiniana ND90Pr
gb|KIM80776.1|  hypothetical protein PILCRDRAFT_516876                  181   1e-49   Piloderma croceum F 1598
ref|XP_005539527.1|  succinate dehydrogenase flavoprotein subunit...    181   2e-49   Cyanidioschyzon merolae strain 10D
ref|XP_001938444.1|  succinate dehydrogenase flavoprotein subunit...    181   2e-49   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_003329108.2|  succinate dehydrogenase [ubiquinone] flavopr...    181   2e-49   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_007879755.1|  hypothetical protein PFL1_04040                    180   2e-49   Anthracocystis flocculosa PF-1
dbj|GAC72599.1|  succinate dehydrogenase, flavoprotein subunit          180   2e-49   Moesziomyces antarcticus T-34
emb|CBQ70579.1|  probable SDH1-succinate dehydrogenase (ubiquinon...    180   2e-49   Sporisorium reilianum SRZ2
ref|XP_002370878.1|  succinate dehydrogenase (ubiquinone) flavopr...    181   2e-49   Toxoplasma gondii ME49
gb|EPR60068.1|  flavoprotein subunit of succinate dehydrogenase         181   2e-49   Toxoplasma gondii GT1
dbj|GAC97081.1|  hypothetical protein PHSY_004665                       180   2e-49   Pseudozyma hubeiensis SY62
emb|CCF54561.1|  probable SDH1-succinate dehydrogenase (ubiquinon...    180   2e-49   Ustilago hordei
emb|CDI52111.1|  probable SDH1-succinate dehydrogenase (ubiquinon...    180   2e-49   Melanopsichium pennsylvanicum 4
gb|KEQ94689.1|  hypothetical protein AUEXF2481DRAFT_30062               180   2e-49   Aureobasidium subglaciale EXF-2481
ref|XP_003036033.1|  hypothetical protein SCHCODRAFT_74617              180   2e-49   Schizophyllum commune H4-8
gb|KIO27457.1|  hypothetical protein M407DRAFT_243325                   180   2e-49   Tulasnella calospora MUT 4182
gb|KDQ59570.1|  hypothetical protein JAAARDRAFT_174980                  180   2e-49   Jaapia argillacea MUCL 33604
gb|KEQ68526.1|  succinate dehydrogenase                                 180   2e-49   Aureobasidium namibiae CBS 147.97
gb|KIV95505.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    180   3e-49   Exophiala mesophila
gb|KIO06451.1|  hypothetical protein M404DRAFT_999109                   180   3e-49   Pisolithus tinctorius Marx 270
emb|CCJ28744.1|  unnamed protein product                                183   3e-49   Pneumocystis jirovecii
gb|KEQ80815.1|  succinate dehydrogenase                                 180   3e-49   Aureobasidium pullulans EXF-150
ref|XP_011387114.1|  putative succinate dehydrogenase flavoprotei...    180   3e-49   Ustilago maydis 521
ref|XP_009822820.1|  succinate dehydrogenase [ubiquinone] flavopr...    180   3e-49   Aphanomyces astaci
emb|CCM05041.1|  predicted protein                                      180   3e-49   Fibroporia radiculosa
ref|XP_007764259.1|  succinate dehydrogenase                            180   3e-49   Coniophora puteana RWD-64-598 SS2
emb|CCU98950.1|  unnamed protein product                                180   3e-49   Malassezia sympodialis ATCC 42132
emb|CDO68875.1|  hypothetical protein BN946_scf185000.g18               179   3e-49   Trametes cinnabarina
gb|EST06229.1|  succinate dehydrogenase, flavoprotein subunit           180   3e-49   Kalmanozyma brasiliensis GHG001
ref|XP_009038442.1|  hypothetical protein AURANDRAFT_37947              179   4e-49   Aureococcus anophagefferens
gb|KIJ54874.1|  hypothetical protein M422DRAFT_24770                    179   4e-49   Sphaerobolus stellatus SS14
ref|XP_009532904.1|  hypothetical protein PHYSODRAFT_248886             179   4e-49   Phytophthora sojae
ref|XP_009226311.1|  hypothetical protein GGTG_10181                    179   5e-49   Gaeumannomyces tritici R3-111a-1
gb|KIV77229.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    179   5e-49   Exophiala sideris
gb|KDR81560.1|  hypothetical protein GALMADRAFT_134991                  179   5e-49   Galerina marginata CBS 339.88
ref|XP_007264237.1|  succinate dehydrogenase                            179   5e-49   Fomitiporia mediterranea MF3/22
gb|KIW22833.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    179   5e-49   Cladophialophora immunda
ref|XP_742730.1|  hypothetical protein                                  170   5e-49   
ref|XP_008720747.1|  succinate dehydrogenase [ubiquinone] flavopr...    179   5e-49   Cyphellophora europaea CBS 101466
gb|KDQ06748.1|  hypothetical protein BOTBODRAFT_121111                  179   6e-49   Botryobasidium botryosum FD-172 SS1
gb|KIK59746.1|  hypothetical protein GYMLUDRAFT_261747                  179   6e-49   Gymnopus luxurians FD-317 M1
ref|XP_007863722.1|  succinate dehydrogenase                            179   6e-49   Gloeophyllum trabeum ATCC 11539
ref|XP_005841533.1|  hypothetical protein GUITHDRAFT_159138             179   6e-49   Guillardia theta CCMP2712
ref|XP_007847694.1|  succinate dehydrogenase flavoprotein subunit       179   7e-49   
gb|EPZ33613.1|  putative succinate dehydrogenase [ubiquinone] fla...    178   7e-49   Rozella allomycis CSF55
ref|XP_008886639.1|  flavoprotein subunit of succinate dehydrogenase    179   8e-49   
gb|KFZ08763.1|  hypothetical protein V502_09175                         179   8e-49   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|XP_001014703.2|  succinate dehydrogenase, flavoprotein subuni...    178   8e-49   Tetrahymena thermophila SB210
ref|XP_008023526.1|  hypothetical protein SETTUDRAFT_128655             178   9e-49   Exserohilum turcica Et28A
gb|KFY53709.1|  hypothetical protein V496_07397                         178   9e-49   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|ELR10143.1|  succinate dehydrogenase flavoprotein subunit, mit...    178   9e-49   Pseudogymnoascus destructans 20631-21
gb|KIW83248.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    178   9e-49   Fonsecaea pedrosoi CBS 271.37
ref|XP_007827022.1|  succinate dehydrogenase                            178   9e-49   Pestalotiopsis fici W106-1
gb|KFY69831.1|  hypothetical protein V499_09711                         178   9e-49   Pseudogymnoascus sp. VKM F-103
gb|KFH69943.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    178   9e-49   Mortierella verticillata NRRL 6337
ref|XP_009266237.1|  hypothetical protein J056_002098                   178   1e-48   Wallemia ichthyophaga EXF-994
ref|XP_006114284.1|  PREDICTED: succinate dehydrogenase [ubiquino...    172   1e-48   
emb|CDW52121.1|  flavoprotein subunit of succinate dehydrogenase        178   1e-48   Trichuris trichiura
ref|XP_008889762.1|  succinate dehydrogenase [ubiquinone] flavopr...    178   1e-48   Phytophthora parasitica INRA-310
gb|EKG22188.1|  Fumarate reductase/succinate dehydrogenase FAD-bi...    178   1e-48   Macrophomina phaseolina MS6
gb|KIY70536.1|  succinate dehydrogenase                                 178   1e-48   Cylindrobasidium torrendii FP15055 ss-10
gb|ETM03646.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    178   1e-48   Phytophthora parasitica
ref|XP_008077212.1|  FAD/NAD(P)-binding protein                         178   1e-48   Glarea lozoyensis ATCC 20868
ref|XP_007321927.1|  minor succinate dehydrogenase isozyme, Sdh1p       178   1e-48   Serpula lacrymans var. lacrymans S7.9
gb|ETP55265.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    178   1e-48   Phytophthora parasitica P10297
dbj|BAE87311.1|  unnamed protein product                                170   1e-48   Macaca fascicularis [crab eating macaque]
gb|KIK49372.1|  hypothetical protein CY34DRAFT_797317                   178   1e-48   Suillus luteus UH-Slu-Lm8-n1
ref|XP_007340905.1|  succinate dehydrogenase                            178   1e-48   
ref|XP_001439561.1|  hypothetical protein                               178   1e-48   Paramecium tetraurelia strain d4-2
gb|KIJ16848.1|  succinate dehydrogenase                                 178   1e-48   Paxillus involutus ATCC 200175
ref|XP_007724687.1|  succinate dehydrogenase [ubiquinone] flavopr...    178   1e-48   Capronia coronata CBS 617.96
gb|KIK91037.1|  hypothetical protein PAXRUDRAFT_831179                  178   1e-48   Paxillus rubicundulus Ve08.2h10
ref|XP_001729428.1|  hypothetical protein MGL_3463                      178   1e-48   Malassezia globosa CBS 7966
ref|XP_007326665.1|  SDH1 minor succinate dehydrogenase isozyme         177   1e-48   Agaricus bisporus var. burnettii JB137-S8
ref|XP_001630650.1|  predicted protein                                  178   1e-48   Nematostella vectensis
ref|XP_006458173.1|  succinate dehydrogenase flavo protein subuni...    177   1e-48   Agaricus bisporus var. bisporus H97
gb|ESZ94343.1|  succinate dehydrogenase flavoprotein subunit            178   1e-48   Sclerotinia borealis F-4128
gb|KIJ68962.1|  hypothetical protein HYDPIDRAFT_105505                  178   2e-48   Hydnomerulius pinastri MD-312
ref|XP_001434264.1|  hypothetical protein                               177   2e-48   Paramecium tetraurelia strain d4-2
gb|KFX97497.1|  hypothetical protein O988_04844                         177   2e-48   Pseudogymnoascus sp. VKM F-3808
emb|CEJ95053.1|  Putative Succinate dehydrogenase Sdh1                  177   2e-48   Torrubiella hemipterigena
gb|KIX99088.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    177   2e-48   Fonsecaea multimorphosa CBS 102226
ref|XP_001458195.1|  hypothetical protein                               177   2e-48   Paramecium tetraurelia strain d4-2
gb|EPB90074.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    177   2e-48   Mucor circinelloides f. circinelloides 1006PhL
emb|CCX08923.1|  Similar to Probable succinate dehydrogenase [ubi...    177   2e-48   Pyronema omphalodes CBS 100304
ref|XP_001347005.1|  Succinate dehydrogenase                            177   2e-48   Paramecium tetraurelia strain d4-2
ref|XP_672154.1|  hypothetical protein                                  168   2e-48   
emb|CDR97604.1|  succinate dehydrogenase alpha subunit, putative        177   2e-48   Babesia bigemina
gb|EMD34419.1|  hypothetical protein CERSUDRAFT_117293                  177   2e-48   Gelatoporia subvermispora B
gb|EPQ67148.1|  Flavoprotein subunit of succinate dehydrogenase         177   2e-48   Blumeria graminis f. sp. tritici 96224
dbj|GAM90966.1|  hypothetical protein ANO11243_090130                   177   2e-48   fungal sp. No.11243
ref|XP_006752267.1|  PREDICTED: succinate dehydrogenase [ubiquino...    169   2e-48   Leptonychotes weddellii
dbj|GAN07792.1|  succinate dehydrogenase                                177   2e-48   Mucor ambiguus
gb|KIW38441.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    177   2e-48   Exophiala oligosperma
gb|EPS98573.1|  hypothetical protein FOMPIDRAFT_1024584                 177   2e-48   Fomitopsis pinicola FP-58527 SS1
gb|KFY12701.1|  hypothetical protein V492_03719                         180   3e-48   Pseudogymnoascus sp. VKM F-4246
dbj|BAJ07109.1|  succinate dehydrogenase subunit A                      177   3e-48   Corynespora cassiicola
dbj|GAA95803.1|  hypothetical protein E5Q_02460                         177   3e-48   Mixia osmundae IAM 14324
gb|KDN66981.1|  putative succinate dehydrogenase                        177   3e-48   Colletotrichum sublineola
emb|CCD47494.1|  hypothetical protein BofuT4_P006530.1                  175   3e-48   Botrytis cinerea T4
ref|XP_008870100.1|  succinate dehydrogenase [ubiquinone] flavopr...    177   3e-48   
gb|EFQ26492.1|  succinate dehydrogenase                                 177   3e-48   
emb|CCF47738.1|  succinate dehydrogenase flavoprotein subunit           177   3e-48   
ref|XP_007596575.1|  succinate dehydrogenase                            177   3e-48   
ref|NP_594319.1|  succinate dehydrogenase Sdh1 (predicted)              177   3e-48   
emb|CDS32637.1|  succinate dehydrogenase (ubiquinone)                   177   3e-48   
gb|KIL91039.1|  succinate dehydrogenase                                 177   3e-48   
ref|XP_007803309.1|  hypothetical protein EPUS_03295                    177   3e-48   
gb|KFY21799.1|  hypothetical protein V493_07105                         179   3e-48   
gb|KFY85893.1|  hypothetical protein V500_08041                         179   3e-48   
gb|EMT65082.1|  Putative succinate dehydrogenase [ubiquinone] fla...    177   3e-48   
gb|EYB27594.1|  hypothetical protein FG05_13136                         177   3e-48   
gb|KFY41308.1|  hypothetical protein V494_03077                         179   3e-48   
ref|XP_002602350.1|  hypothetical protein BRAFLDRAFT_128477             177   3e-48   
ref|XP_009255565.1|  hypothetical protein FPSE_04172                    177   4e-48   
ref|XP_011327122.1|  succinate dehydrogenase flavoprotein subunit       177   4e-48   
ref|XP_009856021.1|  succinate dehydrogenase flavoprotein subunit...    177   4e-48   
emb|CCU81334.1|  succinate dehydrogenase subunit A                      177   4e-48   
ref|XP_003658647.1|  hypothetical protein MYCTH_2294679                 177   4e-48   
ref|XP_007289350.1|  succinate dehydrogenase subunit A                  177   4e-48   
gb|EWG47921.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    176   5e-48   
ref|XP_007779503.1|  succinate dehydrogenase [ubiquinone] flavopr...    176   5e-48   
ref|XP_002997801.1|  succinate dehydrogenase flavoprotein subunit...    176   5e-48   
gb|KIR29305.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    176   5e-48   
ref|XP_003718957.1|  hypothetical protein MGG_00168                     176   5e-48   
gb|KIR47531.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    176   5e-48   
ref|XP_003195850.1|  succinate dehydrogenase flavoprotein subunit...    176   5e-48   
ref|XP_003853276.1|  hypothetical protein MYCGRDRAFT_71498              176   5e-48   
gb|KGB77017.1|  succinate dehydrogenase flavoprotein subunit            176   5e-48   
gb|KIR88429.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    176   5e-48   
ref|XP_009648949.1|  succinate dehydrogenase flavoprotein subunit       176   5e-48   
gb|AFR96921.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    176   6e-48   
emb|CAA70285.1|  succinate dehydrogenase flavoprotein subunit           174   6e-48   
ref|XP_004992765.1|  succinate dehydrogenase flavoprotein subunit       176   6e-48   
ref|XP_572631.1|  succinate dehydrogenase flavoprotein subunit pr...    176   6e-48   
ref|XP_007580355.1|  putative succinate dehydrogenase flavoprotei...    176   6e-48   
ref|XP_001958889.1|  GF12611                                            176   6e-48   
gb|EQB59172.1|  hypothetical protein CGLO_00469                         176   7e-48   
ref|XP_007913169.1|  putative succinate dehydrogenase flavoprotei...    176   7e-48   
gb|KFH48000.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    176   7e-48   
ref|XP_003839233.1|  similar to succinate dehydrogenase flavoprot...    176   7e-48   
gb|EMF13851.1|  succinate dehydrogenase                                 176   7e-48   
gb|KEF54922.1|  succinate dehydrogenase (ubiquinone) flavoprotein...    176   8e-48   
ref|XP_009160044.1|  succinate dehydrogenase [ubiquinone] flavopr...    176   8e-48   
gb|KIM97751.1|  hypothetical protein OIDMADRAFT_202859                  176   8e-48   
gb|KIW51393.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    176   8e-48   
ref|XP_002172921.1|  succinate dehydrogenase Sdh1                       176   8e-48   
ref|XP_008082759.1|  FAD/NAD(P)-binding protein                         176   8e-48   
ref|XP_001908590.1|  hypothetical protein                               176   8e-48   
gb|EGU79334.1|  hypothetical protein FOXB_10163                         177   8e-48   
gb|ENH88419.1|  succinate dehydrogenase                                 176   9e-48   
ref|XP_007737450.1|  succinate dehydrogenase [ubiquinone] flavopr...    176   9e-48   
gb|ACL50597.1|  succinate dehydrogenase subunit A                       176   9e-48   
ref|XP_001248568.1|  succinate dehydrogenase [ubiquinone] flavopr...    176   1e-47   
ref|XP_009859687.1|  PREDICTED: succinate dehydrogenase [ubiquino...    176   1e-47   
gb|ACL50596.1|  succinate dehydrogenase subunit A                       176   1e-47   
ref|XP_003070866.1|  succinate dehydrogenase flavoprotein subunit...    176   1e-47   
gb|EMR89101.1|  putative succinate dehydrogenase flavoprotein sub...    176   1e-47   
ref|XP_001553708.1|  conserved hypothetical protein                     176   1e-47   
ref|XP_001591238.1|  conserved hypothetical protein                     176   1e-47   
ref|XP_007679718.1|  hypothetical protein BAUCODRAFT_114209             175   1e-47   
gb|EGC40755.1|  succinate dehydrogenase                                 175   1e-47   
gb|EFZ18150.1|  hypothetical protein SINV_15344                         164   1e-47   
ref|XP_675621.1|  hypothetical protein                                  167   1e-47   
ref|XP_005776983.1|  succinate dehydrogenase flavo protein subuni...    175   1e-47   
gb|KFY41539.1|  hypothetical protein V495_04895                         178   1e-47   
gb|ERT03174.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    175   1e-47   
gb|KFX90124.1|  hypothetical protein V490_06643                         177   1e-47   
gb|EER37062.1|  succinate dehydrogenase                                 175   1e-47   
gb|KIM49173.1|  hypothetical protein M413DRAFT_99051                    175   1e-47   
emb|CCT65624.1|  probable succinate dehydrogenase (ubiquinone) fl...    175   1e-47   
gb|KDQ33237.1|  minor succinate dehydrogenase subunit, SDH1             175   1e-47   
ref|XP_007679136.1|  hypothetical protein BAUCODRAFT_26548              175   1e-47   
ref|XP_006696117.1|  hypothetical protein CTHT_0057970                  175   1e-47   
ref|XP_007741483.1|  succinate dehydrogenase [ubiquinone] flavopr...    175   2e-47   
gb|EEH33185.2|  succinate dehydrogenase flavoprotein subunit            175   2e-47   
ref|XP_002496111.1|  ZYRO0C10736p                                       175   2e-47   
gb|EJU05343.1|  succinate dehydrogenase                                 175   2e-47   
gb|EEH39263.2|  succinate dehydrogenase flavoprotein subunit            175   2e-47   
ref|XP_002034581.1|  GM19835                                            175   2e-47   
ref|XP_001220862.1|  conserved hypothetical protein                     175   2e-47   
ref|XP_002091790.1|  GE13850                                            175   2e-47   
ref|XP_001974804.1|  GG20911                                            175   2e-47   
ref|NP_477210.1|  succinate dehydrogenase A, isoform A                  175   2e-47   
gb|KJA20202.1|  hypothetical protein HYPSUDRAFT_56126                   175   2e-47   
ref|XP_005176415.1|  PREDICTED: succinate dehydrogenase [ubiquino...    175   2e-47   
gb|ETN68137.1|  succinate dehydrogenase                                 175   2e-47   
gb|KIY50914.1|  succinate dehydrogenase                                 175   2e-47   
ref|XP_003069885.1|  succinate dehydrogenase flavoprotein subunit...    175   2e-47   
emb|CCE28004.1|  probable succinate dehydrogenase (ubiquinone) fl...    175   2e-47   
gb|KID91213.1|  succinate dehydrogenase flavoprotein subunit prec...    175   2e-47   
ref|XP_010755671.1|  succinate dehydrogenase [ubiquinone] flavopr...    175   2e-47   
ref|XP_447749.1|  hypothetical protein                                  175   2e-47   
gb|EEH21556.2|  succinate dehydrogenase [ubiquinone] flavoprotein...    175   2e-47   
ref|XP_007443042.1|  PREDICTED: succinate dehydrogenase [ubiquino...    166   2e-47   
gb|KID80181.1|  succinate dehydrogenase flavoprotein subunit prec...    174   2e-47   
gb|EWC45945.1|  mitochondrial putative succinate dehydrogenase ub...    174   2e-47   
gb|KGG50912.1|  putative mitochondrial SDH1-succinate dehydrogena...    174   2e-47   
gb|KHN96326.1|  succinate dehydrogenase flavoprotein subunit            174   2e-47   
gb|EXV04327.1|  fumarate reductase flavoprotein and FAD binding d...    174   2e-47   
ref|XP_002082225.1|  GD25325                                            174   2e-47   
ref|XP_007807401.1|  succinate dehydrogenase flavoprotein subunit...    174   2e-47   
gb|KIH86612.1|  succinate dehydrogenase (ubiquinone) flavoprotein...    174   2e-47   
ref|XP_004897666.1|  PREDICTED: succinate dehydrogenase [ubiquino...    174   2e-47   
ref|XP_009177174.1|  LOW QUALITY PROTEIN: hypothetical protein T2...    174   2e-47   
gb|KFA66479.1|  hypothetical protein S40285_00756                       174   2e-47   
gb|EAS31135.3|  succinate dehydrogenase, flavoprotein subunit           174   2e-47   
ref|WP_019460855.1|  MULTISPECIES: succinate dehydrogenase              174   2e-47   
ref|XP_003051708.1|  predicted protein                                  178   2e-47   
ref|XP_009542285.1|  hypothetical protein HETIRDRAFT_379356             174   2e-47   
gb|EPY51569.1|  succinate dehydrogenase Sdh1                            174   2e-47   
ref|XP_007301280.1|  succinate dehydrogenase                            174   3e-47   
gb|KGG53021.1|  succinate dehydrogenase Sdh1                            174   3e-47   
ref|XP_008594321.1|  succinate dehydrogenase flavoprotein subunit       174   3e-47   
gb|KFA71919.1|  hypothetical protein S40288_08745                       174   3e-47   
gb|KEY70670.1|  hypothetical protein S7711_02270                        174   3e-47   
gb|KDO21309.1|  succinate dehydrogenase flavoprotein subunit            174   3e-47   
ref|XP_008617967.1|  succinate dehydrogenase [ubiquinone] flavopr...    174   3e-47   
ref|XP_007821862.1|  Succinate dehydrogenase, flavoprotein subunit      174   3e-47   
gb|EHK40943.1|  putative succinate dehydrogenase flavo protein          174   3e-47   
gb|EMF16625.1|  succinate dehydrogenase                                 174   3e-47   
ref|XP_002628850.1|  succinate dehydrogenase flavoprotein subunit       174   3e-47   
gb|AAW25949.1|  SJCHGC09326 protein                                     174   3e-47   
emb|CBK21813.2|  Succinate dehydrogenase flavoprotein subunit (SDHA)    174   3e-47   
emb|CBK22804.2|  Succinate dehydrogenase flavoprotein subunit (SDHA)    174   3e-47   
ref|XP_004897665.1|  PREDICTED: succinate dehydrogenase [ubiquino...    174   4e-47   
ref|XP_003656612.1|  hypothetical protein THITE_61645                   174   4e-47   
ref|XP_001875882.1|  predicted protein                                  174   4e-47   
ref|WP_027280639.1|  fumarate reductase                                 174   4e-47   
gb|EEH04722.1|  succinate dehydrogenase                                 174   4e-47   
gb|EHK15383.1|  hypothetical protein TRIVIDRAFT_111252                  174   4e-47   
ref|XP_006963729.1|  succinate dehydrogenase                            174   4e-47   
gb|KIJ94378.1|  hypothetical protein K443DRAFT_110475                   174   4e-47   
ref|WP_043837081.1|  fumarate reductase                                 173   4e-47   
gb|EME49868.1|  hypothetical protein DOTSEDRAFT_68607                   174   4e-47   
ref|XP_007385161.1|  succinate dehydrogenase                            174   4e-47   
ref|XP_001879081.1|  predicted protein                                  174   5e-47   
gb|KFB41348.1|  AGAP010429-PA-like protein                              174   5e-47   
ref|XP_009064001.1|  hypothetical protein LOTGIDRAFT_221335             174   5e-47   
gb|ENN77889.1|  hypothetical protein YQE_05566                          174   5e-47   
gb|EFX02539.1|  succinate flavoprotein subunit                          177   5e-47   
ref|XP_008713118.1|  succinate dehydrogenase, flavoprotein subunit      174   5e-47   
ref|XP_001748251.1|  hypothetical protein                               174   5e-47   
gb|EMS18784.1|  succinate dehydrogenase (ubiquinone) flavoprotein...    173   5e-47   
ref|XP_003352771.1|  hypothetical protein SMAC_01605                    174   5e-47   
ref|XP_006000045.1|  PREDICTED: succinate dehydrogenase [ubiquino...    173   5e-47   
gb|EUB62925.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    173   5e-47   
ref|XP_003303519.1|  hypothetical protein PTT_15756                     174   5e-47   
emb|CCI44157.1|  unnamed protein product                                173   5e-47   
ref|XP_006000044.1|  PREDICTED: succinate dehydrogenase [ubiquino...    173   5e-47   
gb|ERL88465.1|  hypothetical protein D910_05851                         174   5e-47   
ref|XP_007486821.1|  PREDICTED: succinate dehydrogenase [ubiquino...    174   6e-47   
gb|ENN77888.1|  hypothetical protein YQE_05566                          174   6e-47   
ref|XP_001360343.1|  GA14410                                            173   6e-47   
gb|KII88982.1|  hypothetical protein PLICRDRAFT_109759                  173   6e-47   
ref|WP_017970952.1|  succinate dehydrogenase                            173   6e-47   
ref|WP_023647874.1|  succinate dehydrogenase                            173   6e-47   
ref|XP_001660946.1|  AAEL010608-PA                                      173   6e-47   
ref|XP_004035042.1|  succinate dehydrogenase, putative                  173   6e-47   
ref|XP_010778035.1|  PREDICTED: succinate dehydrogenase [ubiquino...    173   6e-47   
gb|EJY79900.1|  hypothetical protein OXYTRI_22821                       173   6e-47   
ref|WP_017943581.1|  succinate dehydrogenase                            173   6e-47   
ref|WP_028036000.1|  fumarate reductase                                 173   6e-47   
ref|XP_004768496.1|  PREDICTED: succinate dehydrogenase [ubiquino...    173   6e-47   
gb|KFV53858.1|  hypothetical protein N328_10936                         170   6e-47   
emb|CDS18948.1|  succinate dehydrogenase ubiquinone                     173   6e-47   
ref|XP_801853.2|  PREDICTED: succinate dehydrogenase [ubiquinone]...    173   7e-47   
ref|WP_042701288.1|  fumarate reductase                                 167   7e-47   
emb|CDI99717.1|  succinate dehydrogenase (ubiquinone)                   173   7e-47   
gb|EWM29069.1|  succinate dehydrogenase flavoprotein subunit            171   7e-47   
gb|EZF34018.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    172   7e-47   
ref|XP_007896310.1|  PREDICTED: succinate dehydrogenase [ubiquino...    173   7e-47   
ref|XP_011121810.1|  hypothetical protein AOL_s00078g245                173   7e-47   
ref|XP_001847611.1|  succinate dehydrogenase flavoprotein subunit...    173   8e-47   
ref|WP_014952619.1|  succinate dehydrogenase                            172   8e-47   
ref|XP_002388934.1|  hypothetical protein MPER_11995                    167   8e-47   
ref|XP_311518.4|  AGAP010429-PA                                         173   8e-47   
gb|KFM79777.1|  putative succinate dehydrogenase [ubiquinone] fla...    164   9e-47   
ref|XP_003380827.1|  succinate dehydrogenase, flavoprotein subunit      173   9e-47   
gb|EQL33336.1|  succinate dehydrogenase (ubiquinone) flavoprotein...    173   9e-47   
ref|WP_029016453.1|  MULTISPECIES: fumarate reductase                   172   9e-47   
gb|EEQ89198.1|  succinate dehydrogenase flavoprotein subunit            173   9e-47   
ref|XP_007253128.1|  PREDICTED: succinate dehydrogenase [ubiquino...    173   9e-47   
ref|XP_004566884.1|  PREDICTED: succinate dehydrogenase [ubiquino...    173   9e-47   
ref|XP_006794953.1|  PREDICTED: succinate dehydrogenase [ubiquino...    173   1e-46   
ref|XP_002487966.1|  succinate dehydrogenase subunit Sdh1, putative     173   1e-46   
ref|XP_002006670.1|  GI18459                                            173   1e-46   
ref|XP_005296564.1|  PREDICTED: succinate dehydrogenase [ubiquino...    173   1e-46   
ref|XP_003443735.1|  PREDICTED: succinate dehydrogenase [ubiquino...    173   1e-46   
ref|XP_007002512.1|  hypothetical protein TREMEDRAFT_38067              172   1e-46   
emb|CCA69818.1|  probable SDH1-succinate dehydrogenase (ubiquinon...    171   1e-46   
ref|XP_005943868.1|  PREDICTED: succinate dehydrogenase [ubiquino...    172   1e-46   
ref|XP_005743318.1|  PREDICTED: succinate dehydrogenase [ubiquino...    172   1e-46   
gb|EMP36598.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    176   1e-46   
ref|XP_007556052.1|  PREDICTED: succinate dehydrogenase [ubiquino...    172   1e-46   
gb|KIX01510.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    172   1e-46   
gb|EPE08929.1|  succinate dehydrogenase flavoprotein subunit            172   1e-46   
ref|NP_001083473.1|  succinate dehydrogenase [ubiquinone] flavopr...    172   1e-46   
ref|XP_004349768.1|  succinate dehydrogenase flavoprotein subunit       172   1e-46   
ref|XP_006667581.1|  succinate dehydrogenase flavoprotein subunit       173   1e-46   
gb|EGD96147.1|  succinate dehydrogenase flavoprotein subunit            172   1e-46   
ref|XP_003237352.1|  succinate dehydrogenase flavoprotein subunit       172   1e-46   
ref|XP_006019061.1|  PREDICTED: LOW QUALITY PROTEIN: succinate de...    172   1e-46   
emb|CDW91390.1|  succinate dehydrogenase                                172   1e-46   
ref|XP_003172591.1|  succinate dehydrogenase flavoprotein subunit       172   1e-46   
ref|XP_006277023.1|  PREDICTED: succinate dehydrogenase [ubiquino...    172   1e-46   
dbj|GAA55197.1|  succinate dehydrogenase (ubiquinone) flavoprotei...    172   1e-46   
ref|XP_003443736.1|  PREDICTED: succinate dehydrogenase [ubiquino...    172   1e-46   
gb|KIV86068.1|  succinate dehydrogenase, flavoprotein subunit           172   1e-46   
ref|XP_002843776.1|  succinate dehydrogenase                            172   1e-46   
gb|KIK37247.1|  hypothetical protein CY34DRAFT_93071                    172   1e-46   
ref|XP_008285126.1|  PREDICTED: succinate dehydrogenase [ubiquino...    172   1e-46   
dbj|GAD97210.1|  succinate dehydrogenase subunit Sdh1, putative         172   2e-46   
gb|EUC67307.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    172   2e-46   
gb|KGL79173.1|  hypothetical protein N309_10897                         172   2e-46   
ref|NP_569112.1|  succinate dehydrogenase [ubiquinone] flavoprote...    172   2e-46   
ref|XP_001950339.2|  PREDICTED: succinate dehydrogenase [ubiquino...    172   2e-46   
ref|XP_004832491.1|  flavoprotein subunit of succinate dehydrogen...    172   2e-46   
ref|XP_005248388.1|  PREDICTED: succinate dehydrogenase [ubiquino...    171   2e-46   
ref|XP_008322167.1|  PREDICTED: succinate dehydrogenase [ubiquino...    172   2e-46   
ref|NP_001080770.1|  succinate dehydrogenase [ubiquinone] flavopr...    172   2e-46   



>ref|XP_004232400.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Solanum lycopersicum]
Length=629

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSRGLR  S RSISG  H +RLFS+Q NVGGSSYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRASSNRSISGGGHFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA  60

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
Sbjct  61   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  120

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  AIQYMCREAPKAVIELENYGLPFSRTE  147



>ref|XP_009794665.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X2 [Nicotiana sylvestris]
Length=629

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSRGLR  S RSISG  H +RLFS+Q NVGGSSYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRASSNRSISGGGHFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA  60

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
Sbjct  61   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  120

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  AIQYMCREAPKAVIELENYGLPFSRTE  147



>ref|XP_009794664.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X1 [Nicotiana sylvestris]
Length=630

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 141/148 (95%), Gaps = 1/148 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQ-ANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWRCVSRGLR  S RSISG  H +RLFS+Q ANVGGSSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRCVSRGLRASSNRSISGGGHFRRLFSSQTANVGGSSYTVVDHTYDAVVVGAGGAGLRA  60

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
Sbjct  61   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  120

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  DAIQYMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_009624858.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Nicotiana tomentosiformis]
Length=629

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSRGLR  S RSISG  H +RLFS+Q NVGGSSYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRASSNRSISGGGHFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA  60

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTAC+TKLFPTRSHTVAAQGGINAALGNM+ED+WRWHMYDTVKGSDWLGDQD
Sbjct  61   IGLSEHGFNTACLTKLFPTRSHTVAAQGGINAALGNMSEDNWRWHMYDTVKGSDWLGDQD  120

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  AIQYMCREAPKAVIELENYGLPFSRTE  147



>ref|XP_006340609.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Solanum tuberosum]
Length=630

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 140/148 (95%), Gaps = 1/148 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDS-HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWRCVSRGLR  S RSISG   H +RLFS+Q NVGGSSYT+VDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRCVSRGLRASSNRSISGGGGHFRRLFSSQTNVGGSSYTIVDHTYDAVVVGAGGAGLRA  60

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
Sbjct  61   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  120

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  DAIQYMCREAPKAVIELENYGLPFSRTE  148



>emb|CDP02029.1| unnamed protein product [Coffea canephora]
Length=632

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 139/150 (93%), Gaps = 3/150 (2%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSH---LQRLFSTQANVGGSSYTVVDHTYDavvvgaggagl  328
            MWRCVSRGL I  KRSI+GDS    + RLFS QANV GS YTVVDHTYDAVVVGAGGAGL
Sbjct  1    MWRCVSRGLGISPKRSIAGDSFRPLINRLFSAQANVAGSDYTVVDHTYDAVVVGAGGAGL  60

Query  329  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  508
            RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
Sbjct  61   RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  120

Query  509  DQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  DQDAIQYMCREAPKAVIELENYGLPFSRTE  150



>ref|XP_011099603.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Sesamum indicum]
Length=628

 Score =   241 bits (614),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 136/147 (93%), Gaps = 1/147 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSRGLRI SK S S    ++RLFS Q+N G  SYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRIPSKNSTSAFP-VRRLFSNQSNAGAPSYTVVDHTYDAVVVGAGGAGLRAA  59

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
Sbjct  60   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  119

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  120  AIQYMCREAPKAVIELENYGLPFSRTE  146



>ref|XP_009371587.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Pyrus x bretschneideri]
Length=633

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 138/151 (91%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGS-KRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSRGL + S KRS SGDS   H  RLFS+++  G S YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLGVSSSKRSASGDSLRSHFSRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_008338100.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Malus domestica]
Length=633

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 138/151 (91%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGS-KRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSRGL + S KRS SGDS   H  RLFS+++  G S YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLGVSSSKRSASGDSLRSHFPRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_008338495.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Malus domestica]
Length=633

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 137/151 (91%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGS-KRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSRGL + S KRS S DS   H  RLFS+++  G S YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLGVSSSKRSASTDSLRSHFSRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_008241667.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Prunus mume]
Length=633

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 138/151 (91%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIG-SKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSR L +  S+RS+S DS   H  RLFST++  G SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRRLGVPYSQRSVSSDSLRSHFSRLFSTESATGRSSYTVVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_008344291.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial, partial [Malus domestica]
Length=626

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 137/151 (91%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGS-KRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSRGL + S KRS S DS   H  RLFS+++  G S YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLGVSSSKRSASTDSLRSHFSRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_004170583.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like, partial [Cucumis sativus]
Length=186

 Score =   223 bits (568),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 130/153 (85%), Gaps = 6/153 (4%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGD------SHLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSRGLR  S  S          S   R FS  +  G SSYTVVDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGLRASSSFSRKSSPNDHLRSQFSRFFSADSTAGRSSYTVVDHTYDAVVVGAGG  60

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  120

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  153



>ref|XP_009350004.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Pyrus x bretschneideri]
Length=633

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 137/151 (91%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGS-KRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSRGL + S KRS S DS   +  RLFS+++  G S YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLGVSSSKRSASTDSLRSYFSRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_011025771.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Populus euphratica]
Length=633

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 137/151 (91%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWRCVSRGLRI--GSKRSI--SGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCV+RGLR+   +KRS   S  SH+ R FST +  G SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVARGLRLPCSTKRSSNDSFRSHISRFFSTDSTGGRSSYTVVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_002310225.1| Succinate dehydrogenase flavoprotein subunit [Populus trichocarpa]
 gb|EEE90675.1| Succinate dehydrogenase flavoprotein subunit [Populus trichocarpa]
Length=633

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWRCVSRGLRI--GSKRSI--SGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCV+RGLR+   +KRS   S  SH+ R FST    G SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVARGLRLPCSTKRSSNDSFRSHISRFFSTDTTGGRSSYTVVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_010547500.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Tarenaya hassleriana]
Length=633

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 134/151 (89%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSH----LQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSRGLR+ S R+   + H      R FST +  G SSYT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLRVPSSRTSFFNDHSGSRFSRFFSTGSTEGRSSYTIVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_010679713.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=635

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 137/153 (90%), Gaps = 6/153 (4%)
 Frame = +2

Query  158  MWRCVSRGLR-----IGSKRSISGDSHLQRLFSTQAN-VGGSSYTVVDHTYDavvvgagg  319
            MWRCV+RG R       +  SIS  S   RLFS++++ VGG+SYTVVDHTYDAVVVGAGG
Sbjct  1    MWRCVTRGFRSHSWKTSNNPSISSQSPFSRLFSSESSAVGGASYTVVDHTYDAVVVGAGG  60

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  120

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  153



>ref|XP_004287904.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Fragaria vesca subsp. vesca]
Length=634

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 136/152 (89%), Gaps = 5/152 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGSK-RSISGD----SHLQRLFSTQANVGGSSYTVVDHTYDavvvgagga  322
            MWRCVSR L + S  RS++ +    SH  RLFS+ +  G SSYTVVDHTYDAVVVGAGGA
Sbjct  1    MWRCVSRRLGVSSPSRSVAANDSLRSHFSRLFSSDSATGRSSYTVVDHTYDAVVVGAGGA  60

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  61   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  120

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>ref|XP_006425687.1| hypothetical protein CICLE_v10025149mg [Citrus clementina]
 ref|XP_006466784.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Citrus sinensis]
 gb|ESR38927.1| hypothetical protein CICLE_v10025149mg [Citrus clementina]
Length=632

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 136/153 (89%), Gaps = 9/153 (6%)
 Frame = +2

Query  158  MWRCVSRGLRIGS---KRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSRGL + S   KRS+S DS   H  RLFST +  G   YT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGLGLSSYRSKRSVSNDSLRSHFSRLFSTNSTGG---YTIVDHTYDAVVVGAGG  57

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
Sbjct  58   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  117

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  150



>gb|KDO79531.1| hypothetical protein CISIN_1g046556mg [Citrus sinensis]
Length=633

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 136/153 (89%), Gaps = 9/153 (6%)
 Frame = +2

Query  158  MWRCVSRGLRIGS---KRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSRGL + S   KRS+S DS   H  RLFST +  G   YT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGLGLSSYRSKRSVSNDSLRSHFSRLFSTNSTGG---YTIVDHTYDAVVVGAGG  57

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
Sbjct  58   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  117

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  150



>gb|KHG24771.1| SDH1-1: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 
1, mitochondrial [Gossypium arboreum]
Length=616

 Score =   229 bits (585),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 134/151 (89%), Gaps = 7/151 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIG-SKRSISGD---SHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSR LRI  SKRS+S D   SH  R FST +   G  YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRIPYSKRSVSNDTVRSHFSRFFSTGS---GREYTIVDHTYDAVVVGAGGAG  57

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGF TACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  58   LRAAIGLSEHGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  117

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_006383209.1| hypothetical protein POPTR_0005s12530g [Populus trichocarpa]
 gb|ERP61006.1| hypothetical protein POPTR_0005s12530g [Populus trichocarpa]
Length=638

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 136/154 (88%), Gaps = 7/154 (5%)
 Frame = +2

Query  158  MWRCVSRGLRI----GSKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgag  316
            MWRCV+RGLR+     S + +S DS   H  R FS  +  GGSSYTVVDHTYDAVVVGAG
Sbjct  1    MWRCVARGLRLPSSSSSTKILSNDSFRFHSTRFFSADSTGGGSSYTVVDHTYDAVVVGAG  60

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
Sbjct  61   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  120

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  154



>gb|KHG24770.1| SDH1-1: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 
1, mitochondrial [Gossypium arboreum]
Length=636

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 134/151 (89%), Gaps = 7/151 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIG-SKRSISGD---SHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSR LRI  SKRS+S D   SH  R FST +   G  YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRIPYSKRSVSNDTVRSHFSRFFSTGS---GREYTIVDHTYDAVVVGAGGAG  57

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGF TACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  58   LRAAIGLSEHGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  117

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_008453738.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Cucumis melo]
Length=635

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 130/153 (85%), Gaps = 6/153 (4%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGD------SHLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSRGLR  S  S          S   R FS  +  G SSYTVVDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGLRASSSFSTKSPPNDHLRSQFSRFFSADSTAGRSSYTVVDHTYDAVVVGAGG  60

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  120

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  153



>ref|XP_004512040.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Cicer arietinum]
Length=623

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 132/147 (90%), Gaps = 6/147 (4%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCV+RGLR  S  +    SH+ R FS+  N   SSYTVVDHTYDA+VVGAGGAGLRAA
Sbjct  1    MWRCVARGLRASSSNT---RSHVSRFFSSGVN---SSYTVVDHTYDAIVVGAGGAGLRAA  54

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
Sbjct  55   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  114

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  115  AIQYMCREAPKAVIELENYGLPFSRTE  141



>gb|ADZ75464.1| succinate dehydrogenase [Litchi chinensis]
Length=628

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 135/150 (90%), Gaps = 7/150 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggagl  328
            MWRCVSRGL   SKRSIS DS   H+ RLFST +  G   YTVVDHTYDAVVVGAGGAGL
Sbjct  1    MWRCVSRGLGF-SKRSISNDSIRSHIPRLFSTDSTGG---YTVVDHTYDAVVVGAGGAGL  56

Query  329  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  508
            RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDD RWHMYDTVKGSDWLG
Sbjct  57   RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDRRWHMYDTVKGSDWLG  116

Query  509  DQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  117  DQDAIQYMCREAPKAVIELENYGLPFSRTE  146



>ref|XP_010550391.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Tarenaya hassleriana]
Length=634

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 131/152 (86%), Gaps = 5/152 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSIS-----GDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgagga  322
            MWRCVSRGLR+ S    S       S   R FST +  G SSYT+VDHTYDAVVVGAGGA
Sbjct  1    MWRCVSRGLRVASSSRTSLFDGHSGSRFSRFFSTGSTGGRSSYTIVDHTYDAVVVGAGGA  60

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMTEDDWRWHMYDTVKGSDW
Sbjct  61   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALANMTEDDWRWHMYDTVKGSDW  120

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>ref|XP_010484716.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Camelina sativa]
Length=529

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 133/153 (87%), Gaps = 7/153 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRS------ISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSRG R  S ++      +SG S   R FST +    SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGFRAPSSKTSSLFDGVSG-SRFPRFFSTGSTDTKSSYTIVDHTYDAVVVGAGG  59

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSD
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSD  119

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  120  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>ref|XP_007202009.1| hypothetical protein PRUPE_ppa002787mg [Prunus persica]
 gb|EMJ03208.1| hypothetical protein PRUPE_ppa002787mg [Prunus persica]
Length=633

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 133/151 (88%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGD----SHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSR L + S +         SH  RLFST++  G SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRRLGVPSSQRSVSSDSLRSHFSRLFSTESATGRSSYTVVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_003517234.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform 1 [Glycine max]
Length=630

 Score =   227 bits (579),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 134/151 (89%), Gaps = 7/151 (5%)
 Frame = +2

Query  158  MWRCVSRGLR-IGSKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRC++RGLR   S RS S  S   H  R FS+ AN   SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCIARGLRGPASTRSTSNHSLGSHFYRFFSSGAN---SSYTVVDHTYDAVVVGAGGAG  57

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  117

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>gb|KHN36125.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Glycine soja]
Length=627

 Score =   227 bits (579),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 134/151 (89%), Gaps = 7/151 (5%)
 Frame = +2

Query  158  MWRCVSRGLR-IGSKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRC++RGLR   S RS S  S   H  R FS+ AN   SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCIARGLRGPASTRSTSNHSLGSHFYRFFSSGAN---SSYTVVDHTYDAVVVGAGGAG  57

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  117

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>gb|KJB17788.1| hypothetical protein B456_003G015500 [Gossypium raimondii]
Length=630

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 133/151 (88%), Gaps = 7/151 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIG-SKRSISGD---SHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSR LR   SKRS+S D   SH  R FST +   G  YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRTPFSKRSVSNDTVRSHFSRFFSTGS---GREYTIVDHTYDAVVVGAGGAG  57

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGF TACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  58   LRAAIGLSEHGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  117

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_007046958.1| Succinate dehydrogenase 1-1 isoform 2 [Theobroma cacao]
 gb|EOX91115.1| Succinate dehydrogenase 1-1 isoform 2 [Theobroma cacao]
Length=473

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 134/151 (89%), Gaps = 6/151 (4%)
 Frame = +2

Query  158  MWRCVSRGLRIG-SKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSR LR+  SKRS+S DS   H+ +    ++    S YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRVPYSKRSVSYDSLRSHISKFLDNESVR--SPYTIVDHTYDAVVVGAGGAG  58

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  59   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  118

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  149



>gb|KHN41982.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Glycine soja]
Length=627

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 134/151 (89%), Gaps = 7/151 (5%)
 Frame = +2

Query  158  MWRCVSRGLR-IGSKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRC++RGLR   S RS S  S    L R FS+ AN   SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCIARGLRGPASTRSTSNHSLGSQLSRFFSSGAN---SSYTVVDHTYDAVVVGAGGAG  57

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  117

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_003537582.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform 1 [Glycine max]
Length=630

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 134/151 (89%), Gaps = 7/151 (5%)
 Frame = +2

Query  158  MWRCVSRGLR-IGSKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRC++RGLR   S RS S  S    L R FS+ AN   SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCIARGLRGPASTRSTSNHSLGSQLSRFFSSGAN---SSYTVVDHTYDAVVVGAGGAG  57

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  117

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_006280112.1| hypothetical protein CARUB_v10026004mg, partial [Capsella rubella]
 gb|EOA13010.1| hypothetical protein CARUB_v10026004mg, partial [Capsella rubella]
Length=689

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 134/154 (87%), Gaps = 7/154 (5%)
 Frame = +2

Query  155  EMWRCVSRGLRIGSKRS------ISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgag  316
            +MWRCVSRG R  S ++      +SG S   R FST +    SSYT+VDHTYDAVVVGAG
Sbjct  55   KMWRCVSRGFRAPSSKTSSLFDGVSG-SRFSRFFSTGSTDTKSSYTIVDHTYDAVVVGAG  113

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGS
Sbjct  114  GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGS  173

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  174  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  207



>ref|XP_004149154.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Cucumis sativus]
Length=635

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 130/153 (85%), Gaps = 6/153 (4%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGD------SHLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSRGLR  S  S          S   R FS  +  G SSYTVVDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGLRASSSFSRKSSPNDHLRSQFSRFFSADSTAGRSSYTVVDHTYDAVVVGAGG  60

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  120

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  153



>gb|KGN53253.1| hypothetical protein Csa_4G038700 [Cucumis sativus]
Length=635

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 130/153 (85%), Gaps = 6/153 (4%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGD------SHLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSRGLR  S  S          S   R FS  +  G SSYTVVDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGLRASSSFSRKSSPNDHLRSQFSRFFSADSTAGRSSYTVVDHTYDAVVVGAGG  60

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  120

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  153



>ref|XP_009103488.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X1 [Brassica rapa]
 emb|CDY53847.1| BnaA07g37420D [Brassica napus]
Length=627

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSR LR+ S R+    S   R  ST +  G   YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRVPSSRTSLSGSRFSRFLSTGSQTG--DYTIVDHTYDAVVVGAGGAGLRAA  58

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQD
Sbjct  59   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQD  118

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  AIQYMCREAPKAVIELENYGLPFSRTE  145



>ref|XP_010444735.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X1 [Camelina sativa]
 ref|XP_010444737.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X3 [Camelina sativa]
Length=634

 Score =   224 bits (572),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 133/153 (87%), Gaps = 7/153 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRS------ISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSRG R  S ++      +SG S   R FST +    SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGFRAPSSKTSSLFDGVSG-SRFPRFFSTGSTDTKSSYTIVDHTYDAVVVGAGG  59

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSD
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSD  119

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  120  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>ref|XP_002866741.1| succinate dehydrogenase 1-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43000.1| succinate dehydrogenase 1-1 [Arabidopsis lyrata subsp. lyrata]
Length=634

 Score =   224 bits (572),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 133/153 (87%), Gaps = 7/153 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRS------ISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSRG R  S ++      +SG S   R FST +    SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGFRAPSSKTSSLFDGVSG-SRFSRFFSTGSTDTRSSYTIVDHTYDAVVVGAGG  59

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSD
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSD  119

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  120  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>gb|KJB48416.1| hypothetical protein B456_008G068200 [Gossypium raimondii]
Length=628

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 134/151 (89%), Gaps = 7/151 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIG-SKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSR LR   S RS++ +S   ++   FST A   GS YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRAPYSNRSVAANSLRSNISSFFSTHA---GSPYTIVDHTYDAVVVGAGGAG  57

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  117

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>gb|KJB48417.1| hypothetical protein B456_008G068200 [Gossypium raimondii]
Length=630

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 134/151 (89%), Gaps = 7/151 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIG-SKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSR LR   S RS++ +S   ++   FST A   GS YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRAPYSNRSVAANSLRSNISSFFSTHA---GSPYTIVDHTYDAVVVGAGGAG  57

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  117

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_011003741.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Populus euphratica]
Length=636

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 134/154 (87%), Gaps = 7/154 (5%)
 Frame = +2

Query  158  MWRCVSRGLRI----GSKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgag  316
            MWRCV+RGLR+     S + +S DS   H  R FS  +    SSYTVVDHTYDAVVVGAG
Sbjct  1    MWRCVARGLRLPSSSSSTKILSNDSFRSHSTRFFSADSTGERSSYTVVDHTYDAVVVGAG  60

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
Sbjct  61   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  120

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  154



>gb|KHF98130.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial -like protein [Gossypium arboreum]
Length=621

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 131/148 (89%), Gaps = 1/148 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIG-SKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWRCVSR LR   S RS++ +S    + S  +   GS YT+VDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRCVSRSLRAPYSNRSVAANSLRSNISSFFSTYAGSPYTIVDHTYDAVVVGAGGAGLRA  60

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
Sbjct  61   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  120

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  DAIQYMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_007046957.1| Succinate dehydrogenase 1-1 isoform 1 [Theobroma cacao]
 gb|EOX91114.1| Succinate dehydrogenase 1-1 isoform 1 [Theobroma cacao]
Length=631

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 134/151 (89%), Gaps = 6/151 (4%)
 Frame = +2

Query  158  MWRCVSRGLRIG-SKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRCVSR LR+  SKRS+S DS   H+ +    ++    S YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRVPYSKRSVSYDSLRSHISKFLDNESVR--SPYTIVDHTYDAVVVGAGGAG  58

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  59   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  118

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  149



>ref|NP_201477.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Arabidopsis 
thaliana]
 sp|O82663.1|SDHA1_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial; AltName: Full=Flavoprotein subunit 
1 of complex II; Short=FP; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK32928.1|AF367341_1 AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gb|AAL32015.1|AF436833_1 AT5g66760/MSN2_16 [Arabidopsis thaliana]
 emb|CAA05025.1| succinate dehydrogenase flavoprotein alpha subunit [Arabidopsis 
thaliana]
 dbj|BAA97282.1| succinate dehydrogenase flavoprotein alpha subunit [Arabidopsis 
thaliana]
 gb|AAK74032.1| AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gb|AAM70521.1| AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gb|AED98260.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Arabidopsis 
thaliana]
Length=634

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 133/153 (87%), Gaps = 7/153 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRS------ISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSRG R  + ++      +SG S   R FST +    SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGFRAPASKTSSLFDGVSG-SRFSRFFSTGSTDTRSSYTIVDHTYDAVVVGAGG  59

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSD
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSD  119

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  120  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>emb|CDY30754.1| BnaC07g16540D [Brassica napus]
Length=627

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSR LR  S R+    S   R  ST +  G   YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPSSRTSLSGSRFSRFLSTGSQTG--DYTIVDHTYDAVVVGAGGAGLRAA  58

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQD
Sbjct  59   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQD  118

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  AIQYMCREAPKAVIELENYGLPFSRTE  145



>gb|EPS73058.1| hypothetical protein M569_01696, partial [Genlisea aurea]
Length=324

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 122/125 (98%), Gaps = 1/125 (1%)
 Frame = +2

Query  224  LQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSH  403
             +RLFS+Q+N GG+ YTVVDHTYDA+VVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSH
Sbjct  7    FRRLFSSQSN-GGAEYTVVDHTYDAIVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSH  65

Query  404  TVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLP  583
            TVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLP
Sbjct  66   TVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLP  125

Query  584  FSRTE  598
            FSRTE
Sbjct  126  FSRTE  130



>gb|KDP30152.1| hypothetical protein JCGZ_18113 [Jatropha curcas]
Length=639

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 136/159 (86%), Gaps = 14/159 (9%)
 Frame = +2

Query  158  MWRCVSRGLRI---------GSKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDav  301
            MWRCV+R +R+          S +SIS DS   H+ R FSTQ+  G   YT+VDHTYDAV
Sbjct  1    MWRCVARAVRVPSCSSSSFSASNKSISNDSLRSHIPRFFSTQSTAG--QYTIVDHTYDAV  58

Query  302  vvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYD  481
            VVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYD
Sbjct  59   VVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYD  118

Query  482  TVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  TVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  157



>ref|XP_010464904.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X1 [Camelina sativa]
 ref|XP_010464913.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X2 [Camelina sativa]
 ref|XP_010464922.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X3 [Camelina sativa]
Length=634

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 132/153 (86%), Gaps = 7/153 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRS------ISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgagg  319
            MWRCVSR  R  S ++      +SG S   R FST +    SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRSFRAPSSKTSSLFDGVSG-SRFSRFFSTGSTDTKSSYTIVDHTYDAVVVGAGG  59

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSD
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSD  119

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  120  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>gb|KEH27558.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit [Medicago 
truncatula]
Length=593

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 131/150 (87%), Gaps = 9/150 (6%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggagl  328
            MWRCV+RGLR+    + S +S    L R FS++      SYTVVDH YDAVVVGAGGAGL
Sbjct  1    MWRCVARGLRVPRSSNRSNNSLGSRLSRFFSSE------SYTVVDHKYDAVVVGAGGAGL  54

Query  329  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  508
            RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
Sbjct  55   RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  114

Query  509  DQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  115  DQDAIQYMCREAPKAVIELENYGLPFSRTE  144



>ref|XP_009103489.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X2 [Brassica rapa]
Length=626

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 128/147 (87%), Gaps = 3/147 (2%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSR LR+ S R+    S   R  ST +      YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRVPSSRTSLSGSRFSRFLSTGST---GDYTIVDHTYDAVVVGAGGAGLRAA  57

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQD
Sbjct  58   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQD  117

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  AIQYMCREAPKAVIELENYGLPFSRTE  144



>ref|XP_003611986.1| Succinate dehydrogenase [Medicago truncatula]
 gb|AES94944.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit [Medicago 
truncatula]
Length=626

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 131/150 (87%), Gaps = 9/150 (6%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDS---HLQRLFSTQANVGGSSYTVVDHTYDavvvgaggagl  328
            MWRCV+RGLR+    + S +S    L R FS++      SYTVVDH YDAVVVGAGGAGL
Sbjct  1    MWRCVARGLRVPRSSNRSNNSLGSRLSRFFSSE------SYTVVDHKYDAVVVGAGGAGL  54

Query  329  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  508
            RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
Sbjct  55   RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  114

Query  509  DQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  115  DQDAIQYMCREAPKAVIELENYGLPFSRTE  144



>ref|XP_006393871.1| hypothetical protein EUTSA_v10003821mg [Eutrema salsugineum]
 dbj|BAJ33900.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31157.1| hypothetical protein EUTSA_v10003821mg [Eutrema salsugineum]
Length=626

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 128/147 (87%), Gaps = 3/147 (2%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSR LR    R+    S + RLFST +      Y +VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPYSRTSLSGSRISRLFSTGST---DDYKIVDHTYDAVVVGAGGAGLRAA  57

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQD
Sbjct  58   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQD  117

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  AIQYMCREAPKAVIELENYGLPFSRTE  144



>ref|XP_003518027.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Glycine max]
Length=634

 Score =   219 bits (559),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 132/152 (87%), Gaps = 5/152 (3%)
 Frame = +2

Query  158  MWRCVSRGLRI-GSKRSISGD----SHLQRLFSTQANVGGSSYTVVDHTYDavvvgagga  322
            MWRCV+R +R+  S+RSI       SH+ R FS     G SSY VVDH YDAVVVGAGGA
Sbjct  1    MWRCVARAIRVPASERSIPNHQPLRSHISRFFSGGGGGGSSSYNVVDHKYDAVVVGAGGA  60

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  61   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  120

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>ref|XP_010113491.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Morus 
notabilis]
 gb|EXC35518.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Morus 
notabilis]
Length=627

 Score =   219 bits (558),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 137/158 (87%), Gaps = 11/158 (7%)
 Frame = +2

Query  158  MWRCVSRGLRI--------GSKRSI---SGDSHLQRLFSTQANVGGSSYTVVDHTYDavv  304
            MWRCVSRGLRI         S RS+   S  S + R FS+ +  GGSSYTVVDHTYDAVV
Sbjct  1    MWRCVSRGLRIPSSSSSSSSSNRSLLNGSLRSRISRFFSSGSAPGGSSYTVVDHTYDAVV  60

Query  305  vgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDT  484
            VGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDT
Sbjct  61   VGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDT  120

Query  485  VKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            VKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  VKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  158



>ref|XP_007156937.1| hypothetical protein PHAVU_002G029800g [Phaseolus vulgaris]
 gb|ESW28931.1| hypothetical protein PHAVU_002G029800g [Phaseolus vulgaris]
Length=631

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 131/152 (86%), Gaps = 8/152 (5%)
 Frame = +2

Query  158  MWRCVSRGLR--IGSKRSISGDSH---LQRLFSTQANVGGSSYTVVDHTYDavvvgagga  322
            MWRC++RGLR    + RS S   H     R FS+  N   +SYTVVDHTYDAVVVGAGGA
Sbjct  1    MWRCIARGLRGAASTTRSTSNHPHGSYPSRFFSSGVN---NSYTVVDHTYDAVVVGAGGA  57

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGF TACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  58   GLRAAIGLSEHGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  117

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  149



>ref|XP_006409150.1| hypothetical protein EUTSA_v10022591mg [Eutrema salsugineum]
 gb|ESQ50603.1| hypothetical protein EUTSA_v10022591mg [Eutrema salsugineum]
Length=634

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 132/154 (86%), Gaps = 9/154 (6%)
 Frame = +2

Query  158  MWRCVSRGLRIGS---KRSISG----DSHLQRLFSTQANVGGSSYTVVDHTYDavvvgag  316
            MWRCV R LR+ S   +RS S      S + R FS ++  G   YT+VDHTYDAVVVGAG
Sbjct  1    MWRCVPRRLRVPSSSTRRSESNGGFVSSQVSRFFSARSKTG--VYTIVDHTYDAVVVGAG  58

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
Sbjct  59   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  118

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>ref|XP_010263680.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X1 [Nelumbo nucifera]
Length=637

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 134/155 (86%), Gaps = 8/155 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSH----LQRL----FSTQANVGGSSYTVVDHTYDavvvga  313
            MWRCVSRGL +    S S  S     L+RL     ST++  G SSYT+VDHTYDAVVVGA
Sbjct  1    MWRCVSRGLGLSPSSSSSKRSISSEPLKRLTTRFLSTESTGGRSSYTIVDHTYDAVVVGA  60

Query  314  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  493
            GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG
Sbjct  61   GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  120

Query  494  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  155



>ref|XP_010489548.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial [Camelina sativa]
Length=630

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 129/152 (85%), Gaps = 9/152 (6%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGD-----SHLQRLFSTQANVGGSSYTVVDHTYDavvvgagga  322
            MWRC    LR+ S R    +     S L R FST +    SSYT+VDHTYDAVVVGAGGA
Sbjct  1    MWRC----LRVASSRRSESNGAFVTSQLSRFFSTPSTGDRSSYTIVDHTYDAVVVGAGGA  56

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  57   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  116

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  117  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_010467662.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial-like [Camelina sativa]
Length=630

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 129/152 (85%), Gaps = 9/152 (6%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGD-----SHLQRLFSTQANVGGSSYTVVDHTYDavvvgagga  322
            MWRC    LR+ S R    +     S L R FST +    SSYT+VDHTYDAVVVGAGGA
Sbjct  1    MWRC----LRVASSRRSESNGAFVTSQLSRFFSTPSTGDRSSYTIVDHTYDAVVVGAGGA  56

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  57   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  116

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  117  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_010942023.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Elaeis guineensis]
Length=633

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 132/151 (87%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSS---YTVVDHTYDavvvgaggag  325
            MWR CVSR LR+ S+++  G   ++R  ST   +   S   YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRSCVSRALRLSSRKASIGGQPIRRSRSTPRFLSTDSFGQYTVVDHTYDAVVVGAGGAG  60

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  120

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_010414323.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial-like [Camelina sativa]
Length=630

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 129/152 (85%), Gaps = 9/152 (6%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGD-----SHLQRLFSTQANVGGSSYTVVDHTYDavvvgagga  322
            MWRC    LR+ S R    +     S L R FST +    SSYT+VDHTYDAVVVGAGGA
Sbjct  1    MWRC----LRVASSRRSESNGAFVTSQLSRFFSTPSTGDRSSYTIVDHTYDAVVVGAGGA  56

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  57   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  116

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAIQ+MCREAPKAVIELENYGLPFSRTE
Sbjct  117  LGDQDAIQFMCREAPKAVIELENYGLPFSRTE  148



>ref|XP_002463806.1| hypothetical protein SORBIDRAFT_01g006490 [Sorghum bicolor]
 gb|EER90804.1| hypothetical protein SORBIDRAFT_01g006490 [Sorghum bicolor]
Length=620

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 129/148 (87%), Gaps = 11/148 (7%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGLR      +   +   RLFST      SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRGCVSRGLR-----KVKAAASASRLFSTS-----SSYTVVDHTYDAVVVGAGGAGLRA  50

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  51   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  110

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  111  DSIQYMCREAPKAVIELENYGLPFSRTE  138



>ref|XP_008787307.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Phoenix dactylifera]
Length=633

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 132/154 (86%), Gaps = 10/154 (6%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQR------LFSTQANVGGSSYTVVDHTYDavvvgag  316
            MWR CVSR LR+ SK++  G   ++R       FST +      YTVVDHTYDAVVVGAG
Sbjct  1    MWRSCVSRSLRLSSKKASIGGQPIRRYPSRPRFFSTNSF---GQYTVVDHTYDAVVVGAG  57

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
Sbjct  58   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  117

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_009406751.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=635

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 132/153 (86%), Gaps = 6/153 (4%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANV-----GGSSYTVVDHTYDavvvgagg  319
            MWR CVSR LR  S ++  G + ++   S   N+     G +SYT+VDHTYDAVVVGAGG
Sbjct  1    MWRSCVSRALRFPSNKASIGGASIRSSQSASRNLSTGSDGRNSYTIVDHTYDAVVVGAGG  60

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  120

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  153



>ref|XP_002530482.1| succinate dehydrogenase, putative [Ricinus communis]
 gb|EEF31905.1| succinate dehydrogenase, putative [Ricinus communis]
Length=622

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 128/147 (87%), Gaps = 7/147 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCV+RGLR+ S  S              ++ G SSYT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVARGLRVPSSSSKK-------SIYYDSSAGQSSYTIVDHTYDAVVVGAGGAGLRAA  53

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
Sbjct  54   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  113

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  114  AIQYMCREAPKAVIELENYGLPFSRTE  140



>ref|XP_004981574.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like isoform X1 [Setaria italica]
Length=620

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 128/148 (86%), Gaps = 11/148 (7%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGLR          +   RLFST      SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLR-----KAQAAASASRLFSTS-----SSYTVVDHTYDAVVVGAGGAGLRA  50

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
Sbjct  51   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  110

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  111  DSIQYMCREAPKAVIELENYGLPFSRTE  138



>emb|CDY49839.1| BnaC02g43980D [Brassica napus]
Length=628

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 130/148 (88%), Gaps = 3/148 (2%)
 Frame = +2

Query  158  MWRCVSRGLRI-GSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWRCVSR LR+  S+ S    S   R FS+ +  G   YT+VDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRCVSRSLRVPSSRNSSLSGSRFPRFFSSASQTG--DYTIVDHTYDAVVVGAGGAGLRA  58

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  59   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  118

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  DAIQYMCREAPKAVIELENYGLPFSRTE  146



>ref|XP_006299856.1| hypothetical protein CARUB_v10016059mg [Capsella rubella]
 gb|EOA32754.1| hypothetical protein CARUB_v10016059mg [Capsella rubella]
Length=509

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 119/151 (79%), Gaps = 19/151 (13%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISG----DSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRC    LR+ ++RS S     +S L R FS  +   G+SY +VDHTYDAVVVGA    
Sbjct  1    MWRC----LRVAARRSESKGGFINSQLSRFFSAPSTGDGTSYRIVDHTYDAVVVGA----  52

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
                    EHGFNTACITKLFPTRSHTVAAQGG+NAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct  53   -------GEHGFNTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYDTVKGSDWL  105

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  106  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  136



>ref|XP_010254866.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Nelumbo nucifera]
Length=634

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 130/154 (84%), Gaps = 9/154 (6%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSH-------LQRLFSTQANVGGSSYTVVDHTYDavvvgag  316
            MWRCVSRG R+ S  S             + R FSTQ+     SYT+VDHTYDAVVVGAG
Sbjct  1    MWRCVSRGFRLSSSASSKRSISSEPLKPLISRFFSTQSPR--LSYTIVDHTYDAVVVGAG  58

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGS
Sbjct  59   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGS  118

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQD+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  DWLGDQDSIQYMCREAPKAVIELENYGLPFSRTE  152



>ref|XP_004509253.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X2 [Cicer arietinum]
Length=582

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 127/148 (86%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISG-DSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR VSR +   S  ++    SH  R FS+  N   SSY VVDH YDAVVVGAGGAGLRA
Sbjct  1    MWRFVSRTISERSNPNLQPLRSHFSRFFSSGGN---SSYNVVDHKYDAVVVGAGGAGLRA  57

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTAC+TKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
Sbjct  58   AIGLSEHGFNTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  117

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  DAIQYMCREAPKAVIELENYGLPFSRTE  145



>ref|XP_008783479.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X2 [Phoenix dactylifera]
Length=528

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 133/152 (88%), Gaps = 5/152 (3%)
 Frame = +2

Query  158  MWR-CVSRGLRI-GSKRSISGDSHLQRLFSTQANVGGSS---YTVVDHTYDavvvgagga  322
            MW+ CVSRGLR+  SK++  G   ++   ST   +  +S   YTVVDHTYDAVVVGAGGA
Sbjct  1    MWQSCVSRGLRLLSSKKASIGRQPIRHSPSTPRFLVTNSVGQYTVVDHTYDAVVVGAGGA  60

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  61   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  120

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>ref|XP_002269407.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Vitis vinifera]
 emb|CBI17530.3| unnamed protein product [Vitis vinifera]
Length=670

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 137/188 (73%), Gaps = 41/188 (22%)
 Frame = +2

Query  158  MWRCVSRGLRI---GSKRSISGD---SHLQRLF---------------STQANVG-----  259
            MWRCVSRGLR     SKRS++ +    H+ R F                 +A +G     
Sbjct  1    MWRCVSRGLRFRSSDSKRSLTSEYLKPHISRFFSTESTGGGSSGTSEAEIKAAIGELSKH  60

Query  260  ---------------GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPT  394
                            SSYT+VDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPT
Sbjct  61   GVDTAGITELYRSSYTSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPT  120

Query  395  RSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENY  574
            RSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENY
Sbjct  121  RSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENY  180

Query  575  GLPFSRTE  598
            GLPFSRTE
Sbjct  181  GLPFSRTE  188



>ref|XP_010942844.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X2 [Elaeis guineensis]
Length=618

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 131/155 (85%), Gaps = 11/155 (7%)
 Frame = +2

Query  158  MWR-CVSRGLRIGS-------KRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvga  313
            MWR CVSRGLR+ S       ++ I       R  ST + VG   YTVVDHTYDAVVVGA
Sbjct  1    MWRSCVSRGLRLLSCKKASIGRQPIRHSPSTPRFLSTNS-VG--QYTVVDHTYDAVVVGA  57

Query  314  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  493
            GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG
Sbjct  58   GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  117

Query  494  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>gb|KFK28359.1| succinate dehydrogenase [Arabis alpina]
Length=629

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSR LR  S R+    S   R FS+ ++ G SSYT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPSSRTSLSGSRFSRFFSSGSSDGRSSYTIVDHTYDAVVVGAGGAGLRAA  60

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQD
Sbjct  61   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQD  120

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  AIQYMCREAPKAVIELENYGLPFSRTE  147



>ref|XP_010029813.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Eucalyptus grandis]
Length=627

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 129/151 (85%), Gaps = 10/151 (7%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGD----SHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggag  325
            MWRC++RGLR  +     G     S + R FS++      SYT+VDH YDAVVVGAGGAG
Sbjct  1    MWRCIARGLRSPASSGGGGGGSLRSRVSRFFSSE------SYTIVDHKYDAVVVGAGGAG  54

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWL
Sbjct  55   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWL  114

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  115  GDQDAIQYMCREAPKAVIELENYGLPFSRTE  145



>ref|XP_010942839.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X1 [Elaeis guineensis]
Length=634

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 131/155 (85%), Gaps = 11/155 (7%)
 Frame = +2

Query  158  MWR-CVSRGLRIGS-------KRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvga  313
            MWR CVSRGLR+ S       ++ I       R  ST + VG   YTVVDHTYDAVVVGA
Sbjct  1    MWRSCVSRGLRLLSCKKASIGRQPIRHSPSTPRFLSTNS-VG--QYTVVDHTYDAVVVGA  57

Query  314  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  493
            GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG
Sbjct  58   GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  117

Query  494  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>ref|XP_009408578.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Musa acuminata subsp. malaccensis]
Length=636

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 131/155 (85%), Gaps = 9/155 (6%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQ-------RLFSTQANVGGSSYTVVDHTYDavvvga  313
            MWR C+ R  R   K S  G   ++       R FST + VG SSYT+VDHTYDAVVVGA
Sbjct  1    MWRRCLPRNFRFSRKASPIGSEPIRQSPWTAPRSFSTDS-VGRSSYTIVDHTYDAVVVGA  59

Query  314  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  493
            GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKG
Sbjct  60   GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKG  119

Query  494  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            SDWLGDQD+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  120  SDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTE  154



>ref|XP_004509252.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X1 [Cicer arietinum]
Length=627

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 127/148 (86%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISG-DSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR VSR +   S  ++    SH  R FS+  N   SSY VVDH YDAVVVGAGGAGLRA
Sbjct  1    MWRFVSRTISERSNPNLQPLRSHFSRFFSSGGN---SSYNVVDHKYDAVVVGAGGAGLRA  57

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTAC+TKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
Sbjct  58   AIGLSEHGFNTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  117

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  DAIQYMCREAPKAVIELENYGLPFSRTE  145



>ref|NP_001058845.1| Os07g0134800 [Oryza sativa Japonica Group]
 sp|Q6ZDY8.1|SDHA_ORYSJ RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial; AltName: Full=Flavoprotein subunit 
of complex II; Short=FP; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAC83515.1| putative succinate dehydrogenase flavoprotein alpha subunit [Oryza 
sativa Japonica Group]
 dbj|BAF20759.1| Os07g0134800 [Oryza sativa Japonica Group]
 dbj|BAG89728.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81474.1| hypothetical protein OsI_24801 [Oryza sativa Indica Group]
Length=630

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 132/152 (87%), Gaps = 9/152 (6%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQ----RLFSTQANVGGSSYTVVDHTYDavvvgagga  322
            MWR CVSRGLR  SK   S  S       RLFST +    SSYTVVDH+YDAVVVGAGGA
Sbjct  1    MWRGCVSRGLRSLSKGKGSSSSAPVSAAARLFSTAS----SSYTVVDHSYDAVVVGAGGA  56

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  57   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  116

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQD+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  117  LGDQDSIQYMCREAPKAVIELENYGLPFSRTE  148



>dbj|BAK02783.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 129/148 (87%), Gaps = 10/148 (7%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGLR     + +  +   R FST      SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLR----EAKAAAAAASRRFSTT-----SSYTVVDHTYDAVVVGAGGAGLRA  51

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  52   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  111

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  112  DAIQYMCREAPKAVIELENYGLPFSRTE  139



>ref|XP_004972473.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Setaria italica]
Length=619

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 130/148 (88%), Gaps = 12/148 (8%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGL   +K S S      RL ST +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLS-RAKASAS------RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  49

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  109

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  110  DSIQYMCREAPKAVIELENYGLPFSRTE  137



>dbj|BAK08049.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 130/148 (88%), Gaps = 12/148 (8%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGL   SK   S      RLFST +    SSYTVVDH+YDAVVVGAGGAGLRA
Sbjct  1    MWRGCVSRGL---SKAKASA----SRLFSTTS----SSYTVVDHSYDAVVVGAGGAGLRA  49

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  109

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  110  DSIQYMCREAPKAVIELENYGLPFSRTE  137



>ref|XP_002886171.1| succinate dehydrogenase 1-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62430.1| succinate dehydrogenase 1-2 [Arabidopsis lyrata subsp. lyrata]
Length=631

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 132/153 (86%), Gaps = 10/153 (7%)
 Frame = +2

Query  158  MWRCVSRGLRIGS-KRSISG----DSHLQRLFSTQANVGG-SSYTVVDHTYDavvvgagg  319
            MWRC    LR+ S +RS S      + L R FS  ++ G  SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRC----LRVASWRRSESNGAFITTRLSRFFSAPSSTGDRSSYTIVDHTYDAVVVGAGG  56

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSD
Sbjct  57   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSD  116

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  117  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  149



>emb|CDY57124.1| BnaA09g52600D [Brassica napus]
Length=627

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSR LR  S R+    S   R FS+ ++ G   YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPSSRTSLSGSRFSRFFSSSSSTG--DYTIVDHTYDAVVVGAGGAGLRAA  58

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQD
Sbjct  59   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQD  118

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  AIQYMCREAPKAVIELENYGLPFSRTE  145



>ref|XP_009112333.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X2 [Brassica rapa]
Length=627

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSR LR  S R+    S   R FS+ ++ G   YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPSSRTSLSGSRFSRFFSSSSSTG--DYTIVDHTYDAVVVGAGGAGLRAA  58

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQD
Sbjct  59   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQD  118

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  AIQYMCREAPKAVIELENYGLPFSRTE  145



>gb|EEE66523.1| hypothetical protein OsJ_23002 [Oryza sativa Japonica Group]
Length=661

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 132/152 (87%), Gaps = 9/152 (6%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQ----RLFSTQANVGGSSYTVVDHTYDavvvgagga  322
            MWR CVSRGLR  SK   S  S       RLFST +    SSYTVVDH+YDAVVVGAGGA
Sbjct  1    MWRGCVSRGLRSLSKGKGSSSSAPVSAAARLFSTAS----SSYTVVDHSYDAVVVGAGGA  56

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  57   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  116

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQD+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  117  LGDQDSIQYMCREAPKAVIELENYGLPFSRTE  148



>tpg|DAA59498.1| TPA: hypothetical protein ZEAMMB73_792658 [Zea mays]
Length=586

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 130/148 (88%), Gaps = 12/148 (8%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGL   +K S S      RL ST +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLS-RAKASAS------RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  49

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  109

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  110  DSIQYMCREAPKAVIELENYGLPFSRTE  137



>ref|XP_009112332.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X1 [Brassica rapa]
Length=628

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 130/148 (88%), Gaps = 3/148 (2%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKR-SISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWRCVSR LR  S R S+SG    +   S+ +  G   YT+VDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRCVSRSLRAPSSRTSLSGSRFSRFFSSSSSQTG--DYTIVDHTYDAVVVGAGGAGLRA  58

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  59   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  118

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  119  DAIQYMCREAPKAVIELENYGLPFSRTE  146



>ref|XP_007156038.1| hypothetical protein PHAVU_003G253200g [Phaseolus vulgaris]
 gb|ESW28032.1| hypothetical protein PHAVU_003G253200g [Phaseolus vulgaris]
Length=620

 Score =   211 bits (536),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 128/147 (87%), Gaps = 9/147 (6%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCV+R     + +S+   S + R FS+  N   SSY VVDH YDAVVVGAGGAGLRAA
Sbjct  1    MWRCVARA----NHQSLR--SRVSRFFSSGGN---SSYNVVDHKYDAVVVGAGGAGLRAA  51

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
Sbjct  52   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  111

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  112  AIQYMCREAPKAVIELENYGLPFSRTE  138



>ref|NP_001146722.1| uncharacterized protein LOC100280324 [Zea mays]
 gb|ACL54621.1| unknown [Zea mays]
Length=619

 Score =   211 bits (536),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 130/148 (88%), Gaps = 12/148 (8%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGL   +K S S      RL ST +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLS-RAKASAS------RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  49

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  109

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  110  DSIQYMCREAPKAVIELENYGLPFSRTE  137



>ref|NP_001146352.1| uncharacterized protein LOC100279930 [Zea mays]
 gb|ACL53755.1| unknown [Zea mays]
 gb|ACN36155.1| unknown [Zea mays]
 gb|ACN36156.1| unknown [Zea mays]
 tpg|DAA59497.1| TPA: succinate dehydrogenase flavoprotein subunit [Zea mays]
Length=619

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 130/148 (88%), Gaps = 12/148 (8%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGL   +K S S      RL ST +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLS-RAKASAS------RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  49

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  109

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  110  DSIQYMCREAPKAVIELENYGLPFSRTE  137



>ref|XP_008783478.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X1 [Phoenix dactylifera]
Length=634

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 133/152 (88%), Gaps = 5/152 (3%)
 Frame = +2

Query  158  MWR-CVSRGLRI-GSKRSISGDSHLQRLFSTQANVGGSS---YTVVDHTYDavvvgagga  322
            MW+ CVSRGLR+  SK++  G   ++   ST   +  +S   YTVVDHTYDAVVVGAGGA
Sbjct  1    MWQSCVSRGLRLLSSKKASIGRQPIRHSPSTPRFLVTNSVGQYTVVDHTYDAVVVGAGGA  60

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  61   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  120

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  152



>gb|ACG43057.1| succinate dehydrogenase flavoprotein subunit,mitochondrial precursor 
[Zea mays]
Length=619

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 130/148 (88%), Gaps = 12/148 (8%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGL   +K S S      RL ST +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLS-RAKASAS------RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  49

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  109

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  110  DSIQYMCREAPKAVIELENYGLPFSRTE  137



>ref|NP_179435.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2 [Arabidopsis 
thaliana]
 sp|Q9ZPX5.1|SDHA2_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial; AltName: Full=Flavoprotein subunit 
2 of complex II; Short=FP; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD15493.1| putative succinate dehydrogenase flavoprotein subunit [Arabidopsis 
thaliana]
 dbj|BAC43712.1| putative succinate dehydrogenase flavoprotein subunit [Arabidopsis 
thaliana]
 gb|AAO64873.1| At2g18450 [Arabidopsis thaliana]
 gb|AEC06769.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2 [Arabidopsis 
thaliana]
Length=632

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 130/154 (84%), Gaps = 11/154 (7%)
 Frame = +2

Query  158  MWRCVSRGLRIGS--KRSISG----DSHLQRLFSTQANVG-GSSYTVVDHTYDavvvgag  316
            MWRC    LR+ S  +RS S      S L R FS   + G  SSYT+VDHTYDAVVVGAG
Sbjct  1    MWRC----LRVASSSRRSESNGAFITSQLSRFFSAPPSAGDKSSYTIVDHTYDAVVVGAG  56

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+ DDWRWHMYDTVKGS
Sbjct  57   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSVDDWRWHMYDTVKGS  116

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  117  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  150



>tpg|DAA42707.1| TPA: hypothetical protein ZEAMMB73_508415 [Zea mays]
Length=700

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 130/148 (88%), Gaps = 12/148 (8%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGL   +K S S      RL ST +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  82   MWRSCVSRGLS-RAKASAS------RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  130

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  131  AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  190

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  191  DSIQYMCREAPKAVIELENYGLPFSRTE  218



>gb|EMS46614.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Triticum urartu]
Length=591

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 128/148 (86%), Gaps = 10/148 (7%)
 Frame = +2

Query  158  MWRC-VSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR  VSRGLR     + +  +   R FST      SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSRVSRGLR----EAKAAAAAASRRFSTT-----SSYTVVDHTYDAVVVGAGGAGLRA  51

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  52   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  111

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  112  DAIQYMCREAPKAVIELENYGLPFSRTE  139



>ref|XP_006856022.1| hypothetical protein AMTR_s00059p00054360 [Amborella trichopoda]
 gb|ERN17489.1| hypothetical protein AMTR_s00059p00054360 [Amborella trichopoda]
Length=631

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 129/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIG-SKRSIS-GDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglr  331
            MWRCVS  LR+  +K SIS G        S  ++    SYT+VDHTYDAVVVGAGGAGLR
Sbjct  1    MWRCVSGALRLAHAKGSISNGPIQTLLSRSLSSSSTTGSYTIVDHTYDAVVVGAGGAGLR  60

Query  332  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD  511
            AAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD
Sbjct  61   AAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD  120

Query  512  QDAIQYMCREAPKAVIELENYGLPFSRTE  598
            QDAIQYMCREAPKAVIELENYGLPFSRT+
Sbjct  121  QDAIQYMCREAPKAVIELENYGLPFSRTD  149



>gb|AIZ74343.1| succinate dehydrogenase [Pinus massoniana]
Length=635

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 129/153 (84%), Gaps = 6/153 (4%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQAN-----VGGS-SYTVVDHTYDavvvgagg  319
            MWR V+R +   S  +     H  R+    A+     VGGS SYT+VDHTYDAVVVGAGG
Sbjct  1    MWRRVARNICSSSTVNTIRSYHNGRILCRSASSGTSPVGGSGSYTIVDHTYDAVVVGAGG  60

Query  320  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  499
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD  120

Query  500  WLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            WLGDQD+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  WLGDQDSIQYMCREAPKAVIELENYGLPFSRTE  153



>emb|CDX81369.1| BnaC09g07800D [Brassica napus]
Length=628

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSR LR  S    S        F + ++  G  YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPSSSRTSLSGSRFSRFFSSSSQTGD-YTIVDHTYDAVVVGAGGAGLRAA  59

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQD
Sbjct  60   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQD  119

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  120  AIQYMCREAPKAVIELENYGLPFSRTE  146



>ref|XP_003558573.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Brachypodium distachyon]
Length=617

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 127/148 (86%), Gaps = 14/148 (9%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR CVSRGLR     +        R FS+      SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLREAKAAA--------RRFSSS-----SSYTVVDHTYDAVVVGAGGAGLRA  47

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
Sbjct  48   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  107

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  108  DSIQYMCREAPKAVIELENYGLPFSRTE  135



>gb|KFK40220.1| hypothetical protein AALP_AA3G346200 [Arabis alpina]
Length=637

 Score =   206 bits (523),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 130/155 (84%), Gaps = 8/155 (5%)
 Frame = +2

Query  158  MWRCV-SRGLRIGSKRSISGD-------SHLQRLFSTQANVGGSSYTVVDHTYDavvvga  313
            MW CV  R LR+ S  S   +       + + R FS+++    SSYT+VDHTYDAVVVGA
Sbjct  1    MWCCVVPRRLRVPSSPSRRSESNGHFIRTQVSRFFSSRSTGERSSYTIVDHTYDAVVVGA  60

Query  314  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  493
            GGAGLRAAIGLSEHGF TAC+TKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG
Sbjct  61   GGAGLRAAIGLSEHGFKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  120

Query  494  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  121  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  155



>emb|CDY29234.1| BnaA06g25230D [Brassica napus]
Length=633

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 116/123 (94%), Gaps = 2/123 (2%)
 Frame = +2

Query  230  RLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTV  409
            R FS ++  G   YT+VDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV
Sbjct  30   RFFSARSTTG--DYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV  87

Query  410  AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS  589
            AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS
Sbjct  88   AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS  147

Query  590  RTE  598
            RTE
Sbjct  148  RTE  150



>ref|XP_009150830.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial [Brassica rapa]
Length=632

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 116/123 (94%), Gaps = 2/123 (2%)
 Frame = +2

Query  230  RLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTV  409
            R FS ++  G   YT+VDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV
Sbjct  30   RFFSARSTTG--DYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV  87

Query  410  AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS  589
            AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS
Sbjct  88   AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS  147

Query  590  RTE  598
            RTE
Sbjct  148  RTE  150



>ref|XP_002970038.1| hypothetical protein SELMODRAFT_440964 [Selaginella moellendorffii]
 gb|EFJ29162.1| hypothetical protein SELMODRAFT_440964 [Selaginella moellendorffii]
Length=628

 Score =   203 bits (516),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 123/141 (87%), Gaps = 8/141 (6%)
 Frame = +2

Query  200  RSISGDSHLQRLFSTQANV--------GGSSYTVVDHTYDavvvgaggaglraaigLSEH  355
            R+   + H +RL+S+ + V         G++Y +VDHTYDAVVVGAGGAGLRAAIGLSEH
Sbjct  6    RAALREQHQRRLYSSASRVLSNGAPSATGAAYPIVDHTYDAVVVGAGGAGLRAAIGLSEH  65

Query  356  GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMC  535
            GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMC
Sbjct  66   GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMC  125

Query  536  REAPKAVIELENYGLPFSRTE  598
            REAP AVIELENYGLPFSRTE
Sbjct  126  REAPAAVIELENYGLPFSRTE  146



>ref|XP_006658260.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Oryza brachyantha]
Length=634

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 133/155 (86%), Gaps = 11/155 (7%)
 Frame = +2

Query  158  MWR-CVSRGLRIGSK-RSISGDSHLQ------RLFSTQANVGGSSYTVVDHTYDavvvga  313
            MWR CVSRGLR  SK R+ S D          RL ST  +   SSYTVVDH+YDAVVVGA
Sbjct  1    MWRGCVSRGLRSLSKGRATSSDPVSVSAAAAARLLSTTTS---SSYTVVDHSYDAVVVGA  57

Query  314  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  493
            GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG
Sbjct  58   GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  117

Query  494  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            SDWLGDQD+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  118  SDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTE  152



>ref|XP_002985229.1| hypothetical protein SELMODRAFT_446158 [Selaginella moellendorffii]
 gb|EFJ13723.1| hypothetical protein SELMODRAFT_446158 [Selaginella moellendorffii]
Length=628

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQA-NVGGSSYTVVDHTYDavvvgaggaglra  334
            M R     LR   +R +   S   R+ S  A +  G++Y +VDHTYDAVVVGAGGAGLRA
Sbjct  1    MLRLARAALREQRQRRLY--SSASRVLSNAAPSTTGAAYPIVDHTYDAVVVGAGGAGLRA  58

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
Sbjct  59   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  118

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAIQYMCREAP AVIELENYGLPFSRTE
Sbjct  119  DAIQYMCREAPAAVIELENYGLPFSRTE  146



>ref|XP_004981575.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like isoform X2 [Setaria italica]
Length=594

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/111 (99%), Positives = 111/111 (100%), Gaps = 0/111 (0%)
 Frame = +2

Query  266  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  445
            SYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN
Sbjct  2    SYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  61

Query  446  MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            MTEDDWRWHMYDTVKGSDWLGDQD+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  62   MTEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTE  112



>emb|CDY36482.1| BnaC03g48410D [Brassica napus]
Length=633

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 115/123 (93%), Gaps = 2/123 (2%)
 Frame = +2

Query  230  RLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTV  409
            RLFS ++      YT+VDH YDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV
Sbjct  30   RLFSARSTT--RDYTIVDHKYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV  87

Query  410  AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS  589
            AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS
Sbjct  88   AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS  147

Query  590  RTE  598
            RTE
Sbjct  148  RTE  150



>gb|EMT18500.1| Succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial 
[Aegilops tauschii]
Length=608

 Score =   200 bits (508),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 110/111 (99%), Positives = 111/111 (100%), Gaps = 0/111 (0%)
 Frame = +2

Query  266  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  445
            SYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN
Sbjct  11   SYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  70

Query  446  MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            M+EDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  71   MSEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  121



>gb|EMS68611.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Triticum urartu]
Length=606

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            SSYTVVDH+YDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALG
Sbjct  13   SSYTVVDHSYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  72

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NM+EDDWRWHMYDTVKGSDWLGDQD+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  73   NMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTE  124



>gb|KDD75364.1| FAD binding domain-containing protein, partial [Helicosporidium 
sp. ATCC 50920]
Length=481

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 114/129 (88%), Gaps = 4/129 (3%)
 Frame = +2

Query  212  GDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFP  391
            G +   R FST    G  SY ++DHTYDA+VVGAGGAGLRA +GLSE GFNTACITKLFP
Sbjct  18   GLASASRAFST----GRKSYPIIDHTYDAIVVGAGGAGLRATVGLSELGFNTACITKLFP  73

Query  392  TRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELEN  571
            TRSHTVAAQGGINAALGNMTEDDWRWH YDTVKGSDWLGDQDAI+YMCREAPKAVIELEN
Sbjct  74   TRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAIEYMCREAPKAVIELEN  133

Query  572  YGLPFSRTE  598
            YGLPFSRTE
Sbjct  134  YGLPFSRTE  142



>gb|EMT27843.1| Succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial 
[Aegilops tauschii]
Length=742

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/112 (97%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            SSYTVVDH+YDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALG
Sbjct  182  SSYTVVDHSYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  241

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NM+EDDWRWHMYDTVKGSDWLGDQD+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  242  NMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTE  293



>gb|KCW56781.1| hypothetical protein EUGRSUZ_I024522, partial [Eucalyptus grandis]
Length=592

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/110 (97%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            YT+VDH YDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  1    YTIVDHKYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  60

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            +EDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  61   SEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  110



>ref|XP_003557614.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Brachypodium distachyon]
Length=620

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 128/148 (86%), Gaps = 11/148 (7%)
 Frame = +2

Query  158  MWRC-VSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglra  334
            MWR  VSRGL         G +   RLFST  +   SSYT+VDH+YDAVVVGAGGAGLRA
Sbjct  1    MWRSFVSRGLS-------KGKASASRLFSTTTS---SSYTLVDHSYDAVVVGAGGAGLRA  50

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQ
Sbjct  51   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ  110

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            D+IQYMCREAPKAVIELENYGLPFSRTE
Sbjct  111  DSIQYMCREAPKAVIELENYGLPFSRTE  138



>ref|XP_001762172.1| predicted protein [Physcomitrella patens]
 gb|EDQ72964.1| predicted protein [Physcomitrella patens]
Length=595

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/111 (96%), Positives = 109/111 (98%), Gaps = 0/111 (0%)
 Frame = +2

Query  266  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  445
            SY +VDHTYDA+VVGAGGAGLRAAIGLSE GFNTACITKLFPTRSHTVAAQGGINAALGN
Sbjct  3    SYPLVDHTYDAIVVGAGGAGLRAAIGLSESGFNTACITKLFPTRSHTVAAQGGINAALGN  62

Query  446  MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  63   MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  113



>ref|XP_001780340.1| predicted protein [Physcomitrella patens]
 gb|EDQ54899.1| predicted protein [Physcomitrella patens]
Length=631

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  254  VGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINA  433
            V   SY +VDHTYDA+VVGAGGAGLRAAIGLSE GF TACITKLFPTRSHTVAAQGGINA
Sbjct  35   VDAKSYPIVDHTYDAIVVGAGGAGLRAAIGLSETGFTTACITKLFPTRSHTVAAQGGINA  94

Query  434  ALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            ALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  95   ALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  149



>ref|XP_011396968.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Auxenochlorella protothecoides]
 gb|KFM24082.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Auxenochlorella protothecoides]
Length=621

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  251  NVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGIN  430
            +VG ++Y ++DHTYDA+VVGAGGAGLRA++GLSE GFNTACITKLFPTRSHTVAAQGGIN
Sbjct  22   SVGKTAYPIIDHTYDAIVVGAGGAGLRASVGLSELGFNTACITKLFPTRSHTVAAQGGIN  81

Query  431  AALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            AALGNMTEDDWRWH YDT+KGSDWLGDQDAI+YMCREAPKAVIELENYGLPFSRT+
Sbjct  82   AALGNMTEDDWRWHAYDTIKGSDWLGDQDAIEYMCREAPKAVIELENYGLPFSRTD  137



>ref|XP_001689842.1| succinate dehydrogenase subunit A [Chlamydomonas reinhardtii]
 gb|EDP09580.1| succinate dehydrogenase subunit A [Chlamydomonas reinhardtii]
Length=635

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  239  STQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQ  418
            + QA     SY V+DH YDA+VVGAGGAGLRAA+GLSE GFNTACITKLFPTRSHTVAAQ
Sbjct  32   TQQAGFASQSYPVIDHQYDAIVVGAGGAGLRAAVGLSELGFNTACITKLFPTRSHTVAAQ  91

Query  419  GGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GGINAALGNMTEDDWRWH YDT+KGSDWLGDQDAI YMCREAPKAVIELENYGLPFSRTE
Sbjct  92   GGINAALGNMTEDDWRWHAYDTIKGSDWLGDQDAIHYMCREAPKAVIELENYGLPFSRTE  151



>ref|XP_011097110.1| PREDICTED: LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] 
flavoprotein subunit 1, mitochondrial-like [Sesamum 
indicum]
Length=627

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSRGLRI SK+S S  + + R FS Q+N    SYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRIPSKKSTSA-APISRFFSAQSNGATPSYTVVDHTYDAVVVGAGGAGLRAA  59

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
Sbjct  60   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  119

Query  518  AIQYMCREA  544
            AIQYM  +A
Sbjct  120  AIQYMVVKA  128



>ref|XP_002505866.1| succinate dehydrogenase [Micromonas sp. RCC299]
 gb|ACO67124.1| succinate dehydrogenase [Micromonas sp. RCC299]
Length=640

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S+YT++DH YDAVVVGAGGAGLRAAIGLSEHG  TACITKLFPTRSHTVAAQGGINAALG
Sbjct  47   SAYTIIDHEYDAVVVGAGGAGLRAAIGLSEHGLKTACITKLFPTRSHTVAAQGGINAALG  106

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NMTEDDWRWH YDT+KGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT+
Sbjct  107  NMTEDDWRWHAYDTIKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTD  158



>ref|XP_003063914.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52287.1| predicted protein [Micromonas pusilla CCMP1545]
Length=640

 Score =   189 bits (481),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 2/123 (2%)
 Frame = +2

Query  236  FSTQANVGGS--SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTV  409
            F+T A+ G +  +Y ++DH YDAVVVGAGGAGLRAAIGLSEHG  TAC+TKLFPTRSHTV
Sbjct  35   FATSASAGANKPAYQIIDHEYDAVVVGAGGAGLRAAIGLSEHGLKTACVTKLFPTRSHTV  94

Query  410  AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS  589
            AAQGGINAALGNMTEDDWRWH YDT+KG+DWLGDQDAIQYMCREAPKAVIELENYGLPFS
Sbjct  95   AAQGGINAALGNMTEDDWRWHAYDTIKGADWLGDQDAIQYMCREAPKAVIELENYGLPFS  154

Query  590  RTE  598
            RT+
Sbjct  155  RTD  157



>emb|CAN74538.1| hypothetical protein VITISV_023718 [Vitis vinifera]
Length=587

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 102/147 (69%), Gaps = 33/147 (22%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraa  337
            MWRCVSRGLR  S    SG S        +A +  +   +  H                 
Sbjct  1    MWRCVSRGLRFRS----SGTS--------EAEIKAAIGELSKHG----------------  32

Query  338  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  517
                 HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
Sbjct  33   -----HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  87

Query  518  AIQYMCREAPKAVIELENYGLPFSRTE  598
            AIQYMCREAPKAVIELENYGLPFSRTE
Sbjct  88   AIQYMCREAPKAVIELENYGLPFSRTE  114



>gb|KIY92921.1| succinate dehydrogenase (ubiquinone)flavoprotein subunit [Monoraphidium 
neglectum]
Length=244

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
             SY ++DH YDA+VVGAGGAGLRAA+GLSE G  TACITKLFPTRSHTVAAQGGINAALG
Sbjct  65   KSYPMIDHQYDAIVVGAGGAGLRAAVGLSEAGLKTACITKLFPTRSHTVAAQGGINAALG  124

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NM+ DDWRWH YDT+KGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT+
Sbjct  125  NMSVDDWRWHAYDTIKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTD  176



>gb|EXX63396.1| succinate dehydrogenase flavoprotein subunit SDH1 [Rhizophagus 
irregularis DAOM 197198w]
 gb|EXX63397.1| succinate dehydrogenase flavoprotein subunit SDH1 [Rhizophagus 
irregularis DAOM 197198w]
Length=645

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y V+DHTYDA+VVGAGG+GLR+A GL+E GFNTACITK+FPTRSHTVAAQGGINAALG
Sbjct  50   SKYPVIDHTYDAIVVGAGGSGLRSAFGLAEAGFNTACITKIFPTRSHTVAAQGGINAALG  109

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAPK VIELE+YG+PFSRT+
Sbjct  110  NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKTVIELEHYGVPFSRTD  161



>ref|XP_005644633.1| succinate dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE20089.1| succinate dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=606

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            SSY ++DHTYDA+V+GAGGAGLRA +GL E GFN ACITKLFPTRSHTVAAQGGINAALG
Sbjct  8    SSYPIIDHTYDAIVIGAGGAGLRATVGLCEAGFNAACITKLFPTRSHTVAAQGGINAALG  67

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            NM+EDDWRWH YDT+KGSDWLGDQDAIQYMCREAPKAV ELENYGLPFSRT
Sbjct  68   NMSEDDWRWHAYDTIKGSDWLGDQDAIQYMCREAPKAVTELENYGLPFSRT  118



>ref|XP_008036136.1| succinate dehydrogenase [Trametes versicolor FP-101664 SS1]
 gb|EIW60778.1| succinate dehydrogenase [Trametes versicolor FP-101664 SS1]
Length=637

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 122/150 (81%), Gaps = 6/150 (4%)
 Frame = +2

Query  164  RCVSRGLRIGSKRSISGDSHLQRLFST-----QANVGGSSYTVVDHTYDavvvgaggagl  328
            + + R LR  ++RS S  +  +R+ +T     Q   G   Y +++H YDA+VVGAGGAGL
Sbjct  4    KSLPRALR-ATQRSFSSSAPARRVVATNPVKAQEVQGWGKYPLIEHEYDAIVVGAGGAGL  62

Query  329  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  508
            RAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
Sbjct  63   RAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  122

Query  509  DQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DQDAI YMCREAP+ VIELE++GLPFSRT+
Sbjct  123  DQDAIHYMCREAPRTVIELEHFGLPFSRTK  152



>ref|XP_003082803.1| succinate dehydrogenase flavoprotein alpha subunit (ISS) [Ostreococcus 
tauri]
 emb|CAL56758.1| Succinate dehydrogenase/fumarate reductase,flavoprotein subunit 
[Ostreococcus tauri]
Length=681

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S+Y ++DH YDA+VVGAGGAGLRAAIGL EHGF TAC+TKLFPTRSHTVAAQGGINAALG
Sbjct  89   SAYEIIDHEYDALVVGAGGAGLRAAIGLGEHGFKTACVTKLFPTRSHTVAAQGGINAALG  148

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NMTEDDWRWH YDTVKG+DWLGDQDAIQYMCREAPKAVIELE YG+PFSRT+
Sbjct  149  NMTEDDWRWHAYDTVKGADWLGDQDAIQYMCREAPKAVIELEKYGMPFSRTD  200



>ref|XP_002949632.1| succinate dehydrogenase subunit A, mitochondrial [Volvox carteri 
f. nagariensis]
 gb|EFJ49184.1| succinate dehydrogenase subunit A, mitochondrial [Volvox carteri 
f. nagariensis]
Length=641

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  266  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  445
            +Y V+DH YDAVVVGAGGAGLRAA+GLSE GF TAC+TKLFPTRSHTVAAQGGINAALGN
Sbjct  47   TYPVIDHQYDAVVVGAGGAGLRAAVGLSELGFKTACVTKLFPTRSHTVAAQGGINAALGN  106

Query  446  MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            MTEDDWRWH YDTVKGSDWLGDQDAI YMCREAPKAVIELENYGLPFSRTE
Sbjct  107  MTEDDWRWHAYDTVKGSDWLGDQDAIHYMCREAPKAVIELENYGLPFSRTE  157



>ref|XP_007364698.1| succinate dehydrogenase [Dichomitus squalens LYAD-421 SS1]
 gb|EJF62625.1| succinate dehydrogenase [Dichomitus squalens LYAD-421 SS1]
Length=638

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 5/152 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFST-----QANVGGSSYTVVDHTYDavvvgagga  322
            + + +++GLR  S RS    +  +R+ +T     Q       Y +++H YDA+VVGAGGA
Sbjct  2    LRKSLNKGLRASSARSFHSSAPARRVVATNPVKAQEVQSFGKYPLIEHEYDAIVVGAGGA  61

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  62   GLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  121

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAI YMCREAP  VIELE++G+PFSRT+
Sbjct  122  LGDQDAIHYMCREAPHTVIELEHFGVPFSRTK  153



>ref|XP_002186498.1| succinate dehydrogenase flavoprotein [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|ACI65968.1| succinate dehydrogenase flavoprotein [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=638

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 115/133 (86%), Gaps = 1/133 (1%)
 Frame = +2

Query  200  RSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACIT  379
            R ++  S   +  ST  ++ G  YTV+DHTYDAVVVGAGG+GLRAA+GLSE GF TAC+T
Sbjct  17   RRVAVTSVGSKSLSTSPHLIGD-YTVIDHTYDAVVVGAGGSGLRAAMGLSEAGFKTACVT  75

Query  380  KLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVI  559
            KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGDQDAI YMCREAPKAV+
Sbjct  76   KLFPTRSHTVAAQGGINAALGNMGEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKAVL  135

Query  560  ELENYGLPFSRTE  598
            ELE +G+PFSRTE
Sbjct  136  ELEEFGMPFSRTE  148



>ref|XP_001422453.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00770.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=633

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y ++DH YDA+VVGAGGAGLRAAIGL EHGF TAC+TKLFPTRSHTVAAQGGINAALGNM
Sbjct  43   YEIIDHEYDALVVGAGGAGLRAAIGLGEHGFKTACVTKLFPTRSHTVAAQGGINAALGNM  102

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWH YDTVKG+DWLGDQDAIQYMCREAPKAVIELE YG+PFSRT+
Sbjct  103  TEDDWRWHAYDTVKGADWLGDQDAIQYMCREAPKAVIELEKYGMPFSRTD  152



>tpg|DAA34477.1| TPA_exp: succinate dehydrogenase flavoprotein subunit [Amblyomma 
variegatum]
Length=217

 Score =   175 bits (443),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 116/150 (77%), Gaps = 10/150 (7%)
 Frame = +2

Query  164  RCVSRGLRIGSKRSISGDSHLQRLFST-----QANVGGSSYTVVDHTYDavvvgaggagl  328
            R   R L+ G  R +S    ++R F T     Q   GG  Y VVDHT+DAVVVGAGGAGL
Sbjct  10   RPAIRDLQFGKVRGVSS---VRRKFHTSQKNEQKVAGG--YEVVDHTFDAVVVGAGGAGL  64

Query  329  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  508
            RAA GL E GF TACITKLFPTRSHTVAAQGGINAALGNM  DDWRWHMYDTVKGSDWLG
Sbjct  65   RAASGLVEAGFKTACITKLFPTRSHTVAAQGGINAALGNMEPDDWRWHMYDTVKGSDWLG  124

Query  509  DQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DQDAI YM +EAP AV+ELENYG+PFSRT+
Sbjct  125  DQDAIHYMTKEAPFAVLELENYGMPFSRTQ  154



>emb|CDH53199.1| succinate dehydrogenase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=649

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y V+DH YDAVVVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALG
Sbjct  54   SKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALG  113

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  V+ELENYG+PFSRTE
Sbjct  114  NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVVELENYGVPFSRTE  165



>emb|CDH57827.1| succinate dehydrogenase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=649

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y V+DH YDAVVVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALG
Sbjct  54   SKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALG  113

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  V+ELENYG+PFSRTE
Sbjct  114  NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVVELENYGVPFSRTE  165



>ref|XP_001610645.1| succinate dehydrogenase alpha subunit [Babesia bovis T2Bo]
 gb|EDO07077.1| succinate dehydrogenase alpha subunit, putative [Babesia bovis]
Length=624

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 116/134 (87%), Gaps = 5/134 (4%)
 Frame = +2

Query  206  ISGDSHLQRLFSTQA---NVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACI  376
            I+  S   R FS++A   N+ G  +TVV+HTYDAV+VGAGGAGLRAA+ LS  G+ TAC+
Sbjct  8    INKLSKFGRKFSSEAVSRNISG--HTVVEHTYDAVIVGAGGAGLRAALELSSTGYKTACV  65

Query  377  TKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAV  556
            +KLFPTRSHTVAAQGGINAALGNMTEDDWRWH YDTVKGSDWLGDQDAI YMC+EAP+AV
Sbjct  66   SKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAIHYMCKEAPQAV  125

Query  557  IELENYGLPFSRTE  598
            IELENYGLPFSRTE
Sbjct  126  IELENYGLPFSRTE  139



>gb|KIW07596.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Verruconis gallopava]
Length=648

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 121/152 (80%), Gaps = 8/152 (5%)
 Frame = +2

Query  164  RCVSRGLRIGSKRSISGDSHLQRLFSTQ------ANVGGS-SYTVVDHTYDavvvgagga  322
            R +SR +R  S R  +    L ++ ++Q      A   GS SY V+DH YDA+VVGAGG+
Sbjct  14   RQLSRAVRTPS-RQFTQSHRLAKIITSQPLRAKEAQTSGSHSYPVIDHEYDAIVVGAGGS  72

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDW
Sbjct  73   GLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDW  132

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAI YM REAP++VIELENYG PFSRTE
Sbjct  133  LGDQDAIHYMTREAPRSVIELENYGCPFSRTE  164



>emb|CDS14117.1| Putative Similar to succinate dehydrogenaseFT flavoprotein subunit 
[Absidia idahoensis var. thermophila]
Length=615

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y V+DH YDAVVVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALG
Sbjct  20   SKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALG  79

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  V+ELENYG+PFSRTE
Sbjct  80   NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVVELENYGVPFSRTE  131



>ref|XP_007513731.1| succinate dehydrogenase flavoprotein subunit [Bathycoccus prasinos]
 emb|CCO16256.1| succinate dehydrogenase flavoprotein subunit [Bathycoccus prasinos]
Length=775

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 115/143 (80%), Gaps = 13/143 (9%)
 Frame = +2

Query  185  RIGSKRSISGDSHLQRLFSTQANVG-----GSSYTVVDHTYDavvvgaggaglraaigLS  349
            R GSKR+ S         S   N G     G  Y ++DH YDAVVVGAGGAGLRAAIGLS
Sbjct  149  RGGSKRAFSS--------SNAKNNGVNQPFGKEYEIIDHEYDAVVVGAGGAGLRAAIGLS  200

Query  350  EHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQY  529
            EHG+ TAC+TKLFPTRSHTVAAQGGINAALGNM+EDDWRWH YDTVKG+DWLGDQDAIQY
Sbjct  201  EHGYKTACVTKLFPTRSHTVAAQGGINAALGNMSEDDWRWHAYDTVKGADWLGDQDAIQY  260

Query  530  MCREAPKAVIELENYGLPFSRTE  598
            MCREAP+AV ELE YGLPFSRTE
Sbjct  261  MCREAPEAVRELERYGLPFSRTE  283



>emb|CDS14431.1| Putative Genomic scaffold, msy_sf_7 [Absidia idahoensis var. 
thermophila]
Length=627

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y V+DH YDAVVVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALG
Sbjct  32   SKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALG  91

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  V+ELENYG+PFSRTE
Sbjct  92   NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVVELENYGVPFSRTE  143



>ref|XP_007411829.1| hypothetical protein MELLADRAFT_44058 [Melampsora larici-populina 
98AG31]
 gb|EGG04738.1| hypothetical protein MELLADRAFT_44058 [Melampsora larici-populina 
98AG31]
Length=648

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 122/161 (76%), Gaps = 14/161 (9%)
 Frame = +2

Query  158  MWRCVSRGLR------IGSKRSISGDSHLQRLFSTQ--------ANVGGSSYTVVDHTYD  295
            M R +S  ++      I S+R  S      ++ STQ        + +    Y ++DH YD
Sbjct  1    MLRSISSSIKPPLSKLIKSQRGFSTTQSCSKIISTQPLKASQAPSIISSGKYPIIDHEYD  60

Query  296  avvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHM  475
            A+VVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGG+NAALGNMTEDDWRWHM
Sbjct  61   AIVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHM  120

Query  476  YDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            YDTVKGSDWLGDQDAI YMC+EAP+AVIELE++G+PFSRT+
Sbjct  121  YDTVKGSDWLGDQDAIHYMCKEAPQAVIELEHFGVPFSRTK  161



>ref|XP_001438844.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK71447.1| unnamed protein product [Paramecium tetraurelia]
Length=262

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  266  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  445
             YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAALGN
Sbjct  41   KYTVIDHTYDAVVVGAGGAGLRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGN  100

Query  446  MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            MTEDDWRWH YDT+KGSDWLGDQDAI YMC+EAPKAV ELE+YGLPFSRT
Sbjct  101  MTEDDWRWHAYDTIKGSDWLGDQDAITYMCKEAPKAVYELESYGLPFSRT  150



>ref|XP_008725706.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Cladophialophora carrionii CBS 160.54]
 gb|ETI26361.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Cladophialophora carrionii CBS 160.54]
Length=703

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 116/152 (76%), Gaps = 10/152 (7%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQA----------NVGGSSYTVVDHTYDavvvgagga  322
            +R LR  S+R  S      R+ ++Q              G SY ++DH YDAVVVGAGGA
Sbjct  68   TRPLRPTSRRQFSSTRPAARVVASQPLRAKEAQSPLTATGGSYAIIDHEYDAVVVGAGGA  127

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAA GL+E GFNTAC+TKLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDW
Sbjct  128  GLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDW  187

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAI YM REAP++VIELE YG PFSRTE
Sbjct  188  LGDQDAIHYMTREAPRSVIELEGYGCPFSRTE  219



>gb|KIK16393.1| hypothetical protein PISMIDRAFT_686379 [Pisolithus microcarpus 
441]
Length=642

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 119/152 (78%), Gaps = 5/152 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFST-----QANVGGSSYTVVDHTYDavvvgagga  322
            + R   R  R G +RS +     +++ ST     Q       Y +++H YDA+VVGAGGA
Sbjct  6    LARTAPRRARCGLQRSFATTLPARKIVSTSPVKAQQVKSSVKYPLIEHEYDAIVVGAGGA  65

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  66   GLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  125

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAI YMCREAP++VIELE+YG+PFSRT+
Sbjct  126  LGDQDAIHYMCREAPRSVIELEHYGVPFSRTK  157



>gb|KIK21346.1| hypothetical protein PISMIDRAFT_681255 [Pisolithus microcarpus 
441]
Length=642

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 119/152 (78%), Gaps = 5/152 (3%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFST-----QANVGGSSYTVVDHTYDavvvgagga  322
            + R   R  R G +RS +     +++ ST     Q       Y +++H YDA+VVGAGGA
Sbjct  6    LARTAPRRARCGLQRSFATTLPARKIVSTSPVKAQQVKSSVKYPLIEHEYDAIVVGAGGA  65

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  66   GLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  125

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAI YMCREAP++VIELE+YG+PFSRT+
Sbjct  126  LGDQDAIHYMCREAPRSVIELEHYGVPFSRTK  157



>gb|KIW65101.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Capronia semiimmersa]
Length=652

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 117/152 (77%), Gaps = 10/152 (7%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQA----------NVGGSSYTVVDHTYDavvvgagga  322
            +R LR  S+R  S      R+ ++Q           +  G SY ++DH YDAVVVGAGGA
Sbjct  17   TRPLRQTSRRHFSSTRPAARVVASQPLRAKEAQSPLSATGGSYAIIDHEYDAVVVGAGGA  76

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAA GL+E GFNTAC+TKLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDW
Sbjct  77   GLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDW  136

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAI YM REAP++VIELE YG PFSRTE
Sbjct  137  LGDQDAIHYMTREAPRSVIELEGYGCPFSRTE  168



>ref|XP_007871954.1| hypothetical protein PNEG_00097 [Pneumocystis murina B123]
 gb|EMR11659.1| hypothetical protein PNEG_00097 [Pneumocystis murina B123]
Length=646

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +2

Query  227  QRLFSTQAN-VGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSH  403
            Q + S QA    GS Y++VDH YD VVVG+GGAGLRAA GLSE G++TAC+TKLFPTRSH
Sbjct  38   QTIRSKQAKGFIGSKYSIVDHEYDVVVVGSGGAGLRAAFGLSEAGYSTACVTKLFPTRSH  97

Query  404  TVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLP  583
            TVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP++VIELE++G+P
Sbjct  98   TVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRSVIELEHFGVP  157

Query  584  FSRTE  598
            FSRT+
Sbjct  158  FSRTK  162



>ref|XP_007759146.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Cladophialophora yegresii CBS 114405]
 gb|EXJ56612.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Cladophialophora yegresii CBS 114405]
Length=640

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 116/152 (76%), Gaps = 10/152 (7%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQA----------NVGGSSYTVVDHTYDavvvgagga  322
            +R LR  S+R  S      R+ ++Q              G SY ++DH YDAVVVGAGGA
Sbjct  5    TRPLRHTSRRQFSSTRPAARVVASQPLRAKEAQSPLTATGGSYAIIDHEYDAVVVGAGGA  64

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAA GL+E GFNTAC+TKLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDW
Sbjct  65   GLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDW  124

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAI YM REAP++VIELE YG PFSRTE
Sbjct  125  LGDQDAIHYMTREAPRSVIELEGYGCPFSRTE  156



>gb|KIM55848.1| hypothetical protein SCLCIDRAFT_133784 [Scleroderma citrinum 
Foug A]
Length=644

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 120/154 (78%), Gaps = 7/154 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQA-------NVGGSSYTVVDHTYDavvvgag  316
            + R   +   +G +RS S    ++++ ST          +    Y +++H YDA+VVGAG
Sbjct  6    LLRAAPQRALLGYQRSFSTSLPVRKIVSTNPVKAQEVKPLSSGKYPLIEHEYDAIVVGAG  65

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
Sbjct  66   GAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  125

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAI YMCREAP++VIELE+YG+PFSRT+
Sbjct  126  DWLGDQDAIHYMCREAPRSVIELEHYGVPFSRTK  159



>ref|XP_006680864.1| hypothetical protein BATDEDRAFT_90431 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78497.1| hypothetical protein BATDEDRAFT_90431 [Batrachochytrium dendrobatidis 
JAM81]
Length=639

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 118/150 (79%), Gaps = 7/150 (5%)
 Frame = +2

Query  167  CVSRGLRIGSKRSISGDSHLQRLFSTQA-------NVGGSSYTVVDHTYDavvvgaggag  325
             + +  RI   RS    +  QR+ +TQ        +   ++Y ++DHTYDA+VVGAGGAG
Sbjct  6    ALRKSARIVQHRSFHASAFTQRISTTQTLRASAAQSTISAAYPIIDHTYDALVVGAGGAG  65

Query  326  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  505
            LRAA GL++ G  TACITKLFPTRSHTVAAQGGINAAL NMTEDDWRWHMYDTVKGSDWL
Sbjct  66   LRAAFGLAKEGLKTACITKLFPTRSHTVAAQGGINAALANMTEDDWRWHMYDTVKGSDWL  125

Query  506  GDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            GDQDAI YMCREAP++VIELE++G+PFSRT
Sbjct  126  GDQDAIHYMCREAPQSVIELEHFGVPFSRT  155



>gb|EME43895.1| hypothetical protein DOTSEDRAFT_53161 [Dothistroma septosporum 
NZE10]
Length=663

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  188  IGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNT  367
            +  KR+  G +  +R  +   +   S + V+DH YDA+VVGAGGAGLRAA+GL+E G  T
Sbjct  41   VSQKRTYLGHTQRRRATTQSGSPISSPHPVIDHHYDAIVVGAGGAGLRAAVGLAESGLET  100

Query  368  ACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAP  547
            ACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP
Sbjct  101  ACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAP  160

Query  548  KAVIELENYGLPFSRTE  598
            KAV ELENYG+ FSRTE
Sbjct  161  KAVYELENYGMAFSRTE  177



>ref|XP_001438472.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK71075.1| unnamed protein product [Paramecium tetraurelia]
Length=361

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  266  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  445
             YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAALGN
Sbjct  41   KYTVIDHTYDAVVVGAGGAGLRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGN  100

Query  446  MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            MTEDDWRWH YDT+KGSDWLGDQDAI YMC+EAPKAV ELE+YGLPFSRT
Sbjct  101  MTEDDWRWHAYDTIKGSDWLGDQDAITYMCKEAPKAVYELESYGLPFSRT  150



>ref|XP_007930389.1| hypothetical protein MYCFIDRAFT_87948 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME79749.1| hypothetical protein MYCFIDRAFT_87948 [Pseudocercospora fijiensis 
CIRAD86]
Length=665

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 1/134 (1%)
 Frame = +2

Query  197  KRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACI  376
            +R+  G +  +R  +T A    S Y ++DH YDA+VVGAGGAGLRAA+GL+E G  TACI
Sbjct  47   RRTYLGQTQRRRA-TTSAETTFSKYPIIDHHYDAIVVGAGGAGLRAAVGLAESGLETACI  105

Query  377  TKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAV  556
            TKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAPKAV
Sbjct  106  TKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKAV  165

Query  557  IELENYGLPFSRTE  598
             ELENYG+ FSRTE
Sbjct  166  YELENYGMAFSRTE  179



>ref|XP_002293997.1| succinate dehydrogenase flavoprotein subunit [Thalassiosira pseudonana 
CCMP1335]
 gb|EED89006.1| succinate dehydrogenase flavoprotein subunit [Thalassiosira pseudonana 
CCMP1335]
Length=637

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            YT+VDHTYDA+V+GAGG+GLRAA+GLSE GF TAC++KLFPTRSHTVAAQGGINAALGNM
Sbjct  38   YTIVDHTYDALVIGAGGSGLRAAMGLSEAGFKTACVSKLFPTRSHTVAAQGGINAALGNM  97

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
              DDWRWHMYDTVKGSDWLGDQDAI YMCREAPKAV+ELE +GLPFSRTE
Sbjct  98   GPDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKAVLELEEFGLPFSRTE  147



>emb|CEG67799.1| Putative Succinate dehydrogenase flavoprotein subunit [Rhizopus 
microsporus]
Length=647

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = +2

Query  164  RCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaig  343
            R  +RGL I         ++  R       +  S Y V+DH YDAVVVGAGGAGLRAA G
Sbjct  20   RMTTRGLHISKPAMQVMATNPLRAKEASGPIA-SKYPVIDHEYDAVVVGAGGAGLRAAFG  78

Query  344  LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI  523
            L+E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI
Sbjct  79   LAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI  138

Query  524  QYMCREAPKAVIELENYGLPFSRT  595
             YMCREAP  VIELE+YG+PFSRT
Sbjct  139  HYMCREAPNTVIELEHYGVPFSRT  162



>gb|KIP04793.1| hypothetical protein PHLGIDRAFT_109109 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=639

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 117/143 (82%), Gaps = 7/143 (5%)
 Frame = +2

Query  191  GSKRSISGDSHLQRLFSTQANVG-------GSSYTVVDHTYDavvvgaggaglraaigLS  349
            G++RS S  + ++R+ +T               Y +++H YDA+VVGAGGAGLRAA GL+
Sbjct  12   GAQRSFSSSAAVRRVVATNPVKAQEVPSWDSGKYPLIEHEYDAIVVGAGGAGLRAAFGLA  71

Query  350  EHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQY  529
            E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI Y
Sbjct  72   EAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHY  131

Query  530  MCREAPKAVIELENYGLPFSRTE  598
            MCREAP+ VIELE++G+PFSRT+
Sbjct  132  MCREAPQTVIELEHFGVPFSRTK  154



>ref|XP_005707863.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit isoform 
1 [Galdieria sulphuraria]
 gb|EME31343.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit isoform 
1 [Galdieria sulphuraria]
Length=661

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  239  STQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQ  418
            ++ ++  G SY++VDHTYDAVVVGAGGAGLRA IGL E G   ACITKLFPTRSHTVAAQ
Sbjct  48   ASPSSFSGKSYSIVDHTYDAVVVGAGGAGLRATIGLCEAGLKAACITKLFPTRSHTVAAQ  107

Query  419  GGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  VIELE+YGLPFSRT+
Sbjct  108  GGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPATVIELEHYGLPFSRTQ  167



>emb|CDS03760.1| hypothetical protein LRAMOSA01161 [Absidia idahoensis var. thermophila]
Length=603

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S YTV DHTYDAVVVGAGGAGLRA+ GL+E GF TACITKLFPTRSHTVAAQGGINAALG
Sbjct  7    SKYTVFDHTYDAVVVGAGGAGLRASFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALG  66

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NMT+DDWRWHMYDTVKGSDWLGDQDAI YMCREAP+AVIELE+YG+PFSR +
Sbjct  67   NMTKDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPQAVIELESYGMPFSRNQ  118



>ref|XP_001839894.1| succinate dehydrogenase flavoprotein subunit [Coprinopsis cinerea 
okayama7#130]
 gb|EAU81873.1| succinate dehydrogenase flavoprotein subunit [Coprinopsis cinerea 
okayama7#130]
Length=638

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 118/150 (79%), Gaps = 6/150 (4%)
 Frame = +2

Query  164  RCVSRGLRIGSKRSISGDSHLQRLFST-----QANVGGSSYTVVDHTYDavvvgaggagl  328
            R V R L +G  R+    S + R+ +T     Q   G   Y +++H YDAVVVGAGGAGL
Sbjct  5    RSVRRSL-LGHARAFHASSKVSRVVATNPVKAQEVKGWGKYPLIEHEYDAVVVGAGGAGL  63

Query  329  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  508
            RAA GL+E GF TACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
Sbjct  64   RAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  123

Query  509  DQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DQDAI YMCREAP  VIELE++G+PFSRT+
Sbjct  124  DQDAIHYMCREAPNTVIELEHFGVPFSRTK  153



>ref|XP_004207738.1| PREDICTED: probable succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Hydra vulgaris]
Length=274

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y VVDHTYD VVVGAGGAGLRAA GL+  GF TAC+TKLFPTRSHTVAAQGGINAALGNM
Sbjct  45   YPVVDHTYDCVVVGAGGAGLRAAFGLANAGFKTACVTKLFPTRSHTVAAQGGINAALGNM  104

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
             +DDWRWHMYDTVKGSDWLGDQDAI YM REAP AV ELENYG+PFSRTE
Sbjct  105  EKDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPAAVYELENYGMPFSRTE  154



>ref|XP_007396243.1| hypothetical protein PHACADRAFT_256884 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55936.1| hypothetical protein PHACADRAFT_256884 [Phanerochaete carnosa 
HHB-10118-sp]
Length=639

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 119/154 (77%), Gaps = 7/154 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVG-------GSSYTVVDHTYDavvvgag  316
            M R   R   +G++RS S  +  +++ +T               Y +++H YDA+VVGAG
Sbjct  1    MLRKQLRKAVVGAQRSFSSSAPARKVVATNPVKAQEVQSWDSGKYPLIEHEYDAIVVGAG  60

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
Sbjct  61   GAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  120

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAI YMCREAP  VIELE++G+PFSRT+
Sbjct  121  DWLGDQDAIHYMCREAPSTVIELEHFGVPFSRTK  154



>gb|KEQ61905.1| succinate dehydrogenase [Aureobasidium melanogenum CBS 110374]
Length=648

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 116/149 (78%), Gaps = 7/149 (5%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgaggaglr  331
            S+GLR    R+ S  +   R+ + Q       +    + Y V+DH YDA+VVGAGGAGLR
Sbjct  16   SQGLRRQQARAFSRSAPAARIITNQPLRAKEASPFLSNKYPVIDHEYDALVVGAGGAGLR  75

Query  332  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD  511
            AA GL+E GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGD
Sbjct  76   AAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGD  135

Query  512  QDAIQYMCREAPKAVIELENYGLPFSRTE  598
            QDAI YM REAP +VIELENYG PFSRTE
Sbjct  136  QDAIHYMTREAPASVIELENYGCPFSRTE  164



>ref|XP_003738076.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Metaseiulus occidentalis]
Length=647

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 115/144 (80%), Gaps = 8/144 (6%)
 Frame = +2

Query  176  RGLRIGSKRSISGDSHLQRLFSTQANVGGSS----YTVVDHTYDavvvgaggaglraaig  343
            R LR GS+R+      L R FS  + V G +    Y VVDH +DA+VVGAGGAGLRAA G
Sbjct  6    RALRFGSQRA----QLLSRNFSATSAVSGKADWKGYKVVDHEFDAIVVGAGGAGLRAAFG  61

Query  344  LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI  523
            L E GF TACITKLFPTRSHTVAAQGGINAALGNM  D+W+WHMYDTVKGSDWLGDQDAI
Sbjct  62   LVEEGFKTACITKLFPTRSHTVAAQGGINAALGNMEPDEWQWHMYDTVKGSDWLGDQDAI  121

Query  524  QYMCREAPKAVIELENYGLPFSRT  595
             YM +EAPKAVIELENYG+PFSRT
Sbjct  122  HYMTKEAPKAVIELENYGMPFSRT  145



>gb|KFY12526.1| hypothetical protein V491_06755, partial [Pseudogymnoascus pannorum 
VKM F-3775]
Length=370

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  439
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  440  GNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GNM +DDWRWHMYDTVKGSDWLGDQDAI YM REAP +VIELENYG PFSRTE
Sbjct  111  GNMHKDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTE  163



>ref|XP_007692911.1| hypothetical protein COCMIDRAFT_108460 [Bipolaris oryzae ATCC 
44560]
 gb|EUC40579.1| hypothetical protein COCMIDRAFT_108460 [Bipolaris oryzae ATCC 
44560]
Length=647

 Score =   181 bits (459),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 114/142 (80%), Gaps = 7/142 (5%)
 Frame = +2

Query  194  SKRSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgaggaglraaigLSE  352
            S R+ S     QR+ +T+       +    S Y V+DH YDA+VVGAGGAGLRAA GL+E
Sbjct  22   STRAFSSTRPFQRIIATENLRAKEASGFISSKYPVIDHQYDAIVVGAGGAGLRAAFGLAE  81

Query  353  HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYM  532
             GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGDQDAI YM
Sbjct  82   AGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYM  141

Query  533  CREAPKAVIELENYGLPFSRTE  598
             REAP++VIELENYG PFSRT+
Sbjct  142  TREAPQSVIELENYGCPFSRTD  163



>ref|XP_007708277.1| hypothetical protein COCCADRAFT_85691 [Bipolaris zeicola 26-R-13]
 gb|EMD94165.1| hypothetical protein COCHEDRAFT_1130495 [Bipolaris maydis C5]
 gb|ENI07535.1| hypothetical protein COCC4DRAFT_163571 [Bipolaris maydis ATCC 
48331]
 gb|EUC37384.1| hypothetical protein COCCADRAFT_85691 [Bipolaris zeicola 26-R-13]
 gb|EUN28914.1| hypothetical protein COCVIDRAFT_94516 [Bipolaris victoriae FI3]
Length=647

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 114/142 (80%), Gaps = 7/142 (5%)
 Frame = +2

Query  194  SKRSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgaggaglraaigLSE  352
            S R+ S     QR+ +T+       +    S Y V+DH YDA+VVGAGGAGLRAA GL+E
Sbjct  22   STRAFSSTRPFQRIIATENLRAKEASGFISSKYPVIDHQYDAIVVGAGGAGLRAAFGLAE  81

Query  353  HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYM  532
             GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGDQDAI YM
Sbjct  82   AGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYM  141

Query  533  CREAPKAVIELENYGLPFSRTE  598
             REAP++VIELENYG PFSRT+
Sbjct  142  TREAPQSVIELENYGCPFSRTD  163



>emb|CEP10579.1| hypothetical protein [Parasitella parasitica]
Length=649

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y ++DH YDAVVVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALG
Sbjct  54   SKYPIIDHEYDAVVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALG  113

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  VIELENYG+PFSRT
Sbjct  114  NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELENYGVPFSRT  164



>ref|XP_006956287.1| succinate dehydrogenase [Wallemia sebi CBS 633.66]
 gb|EIM23616.1| succinate dehydrogenase [Wallemia sebi CBS 633.66]
Length=642

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 116/149 (78%), Gaps = 9/149 (6%)
 Frame = +2

Query  176  RGLRIGSKRSISGDSHLQRLFSTQA---------NVGGSSYTVVDHTYDavvvgaggagl  328
            RG  +  +R+ S    L R+ + +              S+Y V+DH YDA+VVGAGG+GL
Sbjct  8    RGSALAGQRAFSTSKSLSRVVANEPLKAKQAENNAFASSNYPVIDHEYDALVVGAGGSGL  67

Query  329  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  508
            RAA GL+E GF TACITKLFPTRSHTVAAQGGINAALGNMT+DDWRWHMYDTVKGSDWLG
Sbjct  68   RAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGNMTQDDWRWHMYDTVKGSDWLG  127

Query  509  DQDAIQYMCREAPKAVIELENYGLPFSRT  595
            DQDAI YMCREAP+ V+ELE++G+PFSRT
Sbjct  128  DQDAIHYMCREAPRTVVELEHFGVPFSRT  156



>gb|EIE88610.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Rhizopus 
delemar RA 99-880]
Length=649

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y ++DH YDAVVVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALG
Sbjct  54   SKYPIIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALG  113

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  VIELE+YG+PFSRT
Sbjct  114  NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELEHYGVPFSRT  164



>gb|KFG36146.1| flavoprotein subunit of succinate dehydrogenase, partial [Toxoplasma 
gondii GAB2-2007-GAL-DOM2]
Length=618

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 118/145 (81%), Gaps = 6/145 (4%)
 Frame = +2

Query  170  VSRGLRIGSKRSISGDSHLQ--RLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaig  343
            V+RGL     ++ +G S +Q  R F+   NV   +Y V+DH YDA+VVGAGGAGLRAA G
Sbjct  36   VARGLNAAQPQA-TGPSFVQQKRFFT---NVKKPAYRVIDHEYDAIVVGAGGAGLRAAFG  91

Query  344  LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI  523
            L+  G  TAC++KLFPTRSHTVAAQGGINAALGNMTEDDWRWH YDTVKGSDWLGDQDAI
Sbjct  92   LASAGIKTACLSKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAI  151

Query  524  QYMCREAPKAVIELENYGLPFSRTE  598
            Q+MCREAPK V ELE+YGLPFSRTE
Sbjct  152  QHMCREAPKVVRELESYGLPFSRTE  176



>gb|EIE82583.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Rhizopus 
delemar RA 99-880]
Length=627

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y ++DH YDAVVVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALG
Sbjct  32   SKYPIIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALG  91

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  VIELE+YG+PFSRT
Sbjct  92   NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELEHYGVPFSRT  142



>gb|EWM29067.1| succinate dehydrogenase flavoprotein subunit [Nannochloropsis 
gaditana]
Length=647

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            + YTV+DH YD VVVGAGGAGLRAA+G +E GF TAC+TKLFPTRSHTVAAQGGINAALG
Sbjct  46   AKYTVIDHEYDVVVVGAGGAGLRAAMGAAEAGFKTACVTKLFPTRSHTVAAQGGINAALG  105

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+AV ELE+YGLPFSRTE
Sbjct  106  NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRAVYELESYGLPFSRTE  157



>gb|KFH16527.1| flavoprotein subunit of succinate dehydrogenase, partial [Toxoplasma 
gondii MAS]
Length=618

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 118/145 (81%), Gaps = 6/145 (4%)
 Frame = +2

Query  170  VSRGLRIGSKRSISGDSHLQ--RLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaig  343
            V+RGL     ++ +G S +Q  R F+   NV   +Y V+DH YDA+VVGAGGAGLRAA G
Sbjct  36   VARGLNAAQPQA-TGPSFVQQKRFFT---NVKKPAYRVIDHEYDAIVVGAGGAGLRAAFG  91

Query  344  LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI  523
            L+  G  TAC++KLFPTRSHTVAAQGGINAALGNMTEDDWRWH YDTVKGSDWLGDQDAI
Sbjct  92   LASAGIKTACLSKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAI  151

Query  524  QYMCREAPKAVIELENYGLPFSRTE  598
            Q+MCREAPK V ELE+YGLPFSRTE
Sbjct  152  QHMCREAPKVVRELESYGLPFSRTE  176



>dbj|GAN03015.1| succinate dehydrogenase [Mucor ambiguus]
Length=649

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y ++DH YDAVVVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALG
Sbjct  54   SKYPIIDHEYDAVVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALG  113

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  VIELENYG+PFSRT
Sbjct  114  NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELENYGVPFSRT  164



>gb|KFG52820.1| flavoprotein subunit of succinate dehydrogenase [Toxoplasma gondii 
FOU]
Length=621

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 118/145 (81%), Gaps = 6/145 (4%)
 Frame = +2

Query  170  VSRGLRIGSKRSISGDSHLQ--RLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaig  343
            V+RGL     ++ +G S +Q  R F+   NV   +Y V+DH YDA+VVGAGGAGLRAA G
Sbjct  36   VARGLNAAQPQA-TGPSFVQQKRFFT---NVKKPAYRVIDHEYDAIVVGAGGAGLRAAFG  91

Query  344  LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI  523
            L+  G  TAC++KLFPTRSHTVAAQGGINAALGNMTEDDWRWH YDTVKGSDWLGDQDAI
Sbjct  92   LASAGIKTACLSKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAI  151

Query  524  QYMCREAPKAVIELENYGLPFSRTE  598
            Q+MCREAPK V ELE+YGLPFSRTE
Sbjct  152  QHMCREAPKVVRELESYGLPFSRTE  176



>gb|EPB90491.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Mucor circinelloides f. circinelloides 1006PhL]
Length=649

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y ++DH YDAVVVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALG
Sbjct  54   SKYPIIDHEYDAVVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALG  113

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            NMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  VIELENYG+PFSRT
Sbjct  114  NMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELENYGVPFSRT  164



>ref|XP_007701408.1| hypothetical protein COCSADRAFT_120336 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD63185.1| hypothetical protein COCSADRAFT_120336 [Bipolaris sorokiniana 
ND90Pr]
Length=647

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 114/142 (80%), Gaps = 7/142 (5%)
 Frame = +2

Query  194  SKRSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgaggaglraaigLSE  352
            S R+ S     QR+ +T+       +    S Y V+DH YDA+VVGAGGAGLRAA GL+E
Sbjct  22   STRAFSSTRPFQRVIATENLRAKEASGFISSKYPVIDHQYDAIVVGAGGAGLRAAFGLAE  81

Query  353  HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYM  532
             GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGDQDAI YM
Sbjct  82   AGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYM  141

Query  533  CREAPKAVIELENYGLPFSRTE  598
             REAP++VIELENYG PFSRT+
Sbjct  142  TREAPQSVIELENYGCPFSRTD  163



>gb|KIM80776.1| hypothetical protein PILCRDRAFT_516876 [Piloderma croceum F 1598]
Length=643

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 7/148 (5%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFST------QANVGGSSYTVVDHTYDavvvgaggaglra  334
            SR L + S+RS    S ++++ +T      + +     Y ++DH YDA+VVGAGGAGLRA
Sbjct  12   SRAL-LPSRRSFQTSSSVRKVVATNPVKAEETSWASGKYPLIDHEYDAIVVGAGGAGLRA  70

Query  335  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  514
            A GL+E GF+TACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
Sbjct  71   AFGLAEAGFSTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ  130

Query  515  DAIQYMCREAPKAVIELENYGLPFSRTE  598
            DAI YMCREAP  VIELE++G+PFSRT+
Sbjct  131  DAIHYMCREAPNTVIELEHFGVPFSRTK  158



>ref|XP_005539527.1| succinate dehydrogenase flavoprotein subunit precursor [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM83491.1| succinate dehydrogenase flavoprotein subunit precursor [Cyanidioschyzon 
merolae strain 10D]
Length=691

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 108/124 (87%), Gaps = 3/124 (2%)
 Frame = +2

Query  227  QRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHT  406
            +R  +TQA     SY VV+H YDAVV+GAGGAGLRA IG +E G  TAC+TKLFPTRSHT
Sbjct  80   KRRVATQAT---PSYAVVEHEYDAVVLGAGGAGLRAVIGCAEAGLKTACVTKLFPTRSHT  136

Query  407  VAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPF  586
            VAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAPK VIELE+YG+PF
Sbjct  137  VAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKVVIELEHYGVPF  196

Query  587  SRTE  598
            SRTE
Sbjct  197  SRTE  200



>ref|XP_001938444.1| succinate dehydrogenase flavoprotein subunit, mitochondrial precursor 
[Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003295854.1| hypothetical protein PTT_03506 [Pyrenophora teres f. teres 0-1]
 gb|EDU51031.1| succinate dehydrogenase flavoprotein subunit, mitochondrial precursor 
[Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ96052.1| hypothetical protein PTT_03506 [Pyrenophora teres f. teres 0-1]
Length=647

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 116/142 (82%), Gaps = 7/142 (5%)
 Frame = +2

Query  194  SKRSISGDSHLQRLFSTQ----ANVGG---SSYTVVDHTYDavvvgaggaglraaigLSE  352
            + R+ S     +R+F+T+      V G   S Y V+DH YDA+VVGAGGAGLRAA GL+E
Sbjct  22   TARAFSSTRPARRIFATENLRAKEVSGFISSKYPVIDHEYDAIVVGAGGAGLRAAFGLAE  81

Query  353  HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYM  532
             GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGDQDAI YM
Sbjct  82   AGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYM  141

Query  533  CREAPKAVIELENYGLPFSRTE  598
             REAP++VIELENYG PFSRT+
Sbjct  142  TREAPQSVIELENYGCPFSRTD  163



>ref|XP_003329108.2| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP84689.2| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Puccinia graminis f. sp. tritici CRL 75-36-700-3]
Length=650

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +2

Query  242  TQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQG  421
            T A      Y ++DH YDA+VVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQG
Sbjct  45   TSAKFSNGKYPIIDHEYDAIVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQG  104

Query  422  GINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            G+NAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI YMC+EAP+AVIELE++G+PFSRT+
Sbjct  105  GVNAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCKEAPQAVIELEHFGVPFSRTK  163



>ref|XP_007879755.1| hypothetical protein PFL1_04040 [Pseudozyma flocculosa PF-1]
 gb|EPQ28213.1| hypothetical protein PFL1_04040 [Pseudozyma flocculosa PF-1]
Length=650

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y V+DH YDAVVVGAGG+GLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  57   YPVIDHEYDAVVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNM  116

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+ VIELE++GLPFSRT+
Sbjct  117  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTK  166



>dbj|GAC72599.1| succinate dehydrogenase, flavoprotein subunit [Pseudozyma antarctica 
T-34]
 gb|ETS60980.1| hypothetical protein PaG_04911 [Pseudozyma aphidis DSM 70725]
 dbj|GAK63080.1| succinate dehydrogenase [Pseudozyma antarctica]
Length=653

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y V+DH YDA+VVGAGG+GLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  59   YPVIDHEYDAIVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNM  118

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+ VIELE++GLPFSRT+
Sbjct  119  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTK  168



>emb|CBQ70579.1| probable SDH1-succinate dehydrogenase (ubiquinone) flavoprotein 
precursor, mitochondrial [Sporisorium reilianum SRZ2]
Length=653

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y V+DH YDA+VVGAGG+GLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  59   YPVIDHEYDAIVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNM  118

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+ VIELE++GLPFSRT+
Sbjct  119  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTK  168



>ref|XP_002370878.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial, 
putative [Toxoplasma gondii ME49]
 gb|ABB17193.1| mitochondrial succinate dehydrogenase flavoprotein subunit precursor 
[Toxoplasma gondii]
 gb|EPT26433.1| flavoprotein subunit of succinate dehydrogenase [Toxoplasma gondii 
ME49]
Length=669

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 118/145 (81%), Gaps = 6/145 (4%)
 Frame = +2

Query  170  VSRGLRIGSKRSISGDSHLQ--RLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaig  343
            V+RGL     ++ +G S +Q  R F+   NV   +Y V+DH YDA+VVGAGGAGLRAA G
Sbjct  36   VARGLNAAQPQA-TGPSFVQQKRFFT---NVKKPAYRVIDHEYDAIVVGAGGAGLRAAFG  91

Query  344  LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI  523
            L+  G  TAC++KLFPTRSHTVAAQGGINAALGNMTEDDWRWH YDTVKGSDWLGDQDAI
Sbjct  92   LASAGIKTACLSKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAI  151

Query  524  QYMCREAPKAVIELENYGLPFSRTE  598
            Q+MCREAPK V ELE+YGLPFSRTE
Sbjct  152  QHMCREAPKVVRELESYGLPFSRTE  176



>gb|EPR60068.1| flavoprotein subunit of succinate dehydrogenase [Toxoplasma gondii 
GT1]
 gb|ESS31201.1| flavoprotein subunit of succinate dehydrogenase [Toxoplasma gondii 
VEG]
 gb|KFG41340.1| flavoprotein subunit of succinate dehydrogenase [Toxoplasma gondii 
p89]
 gb|KFG62129.1| flavoprotein subunit of succinate dehydrogenase [Toxoplasma gondii 
RUB]
 gb|KFH07994.1| flavoprotein subunit of succinate dehydrogenase [Toxoplasma gondii 
VAND]
Length=669

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 118/145 (81%), Gaps = 6/145 (4%)
 Frame = +2

Query  170  VSRGLRIGSKRSISGDSHLQ--RLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaig  343
            V+RGL     ++ +G S +Q  R F+   NV   +Y V+DH YDA+VVGAGGAGLRAA G
Sbjct  36   VARGLNAAQPQA-TGPSFVQQKRFFT---NVKKPAYRVIDHEYDAIVVGAGGAGLRAAFG  91

Query  344  LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI  523
            L+  G  TAC++KLFPTRSHTVAAQGGINAALGNMTEDDWRWH YDTVKGSDWLGDQDAI
Sbjct  92   LASAGIKTACLSKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAI  151

Query  524  QYMCREAPKAVIELENYGLPFSRTE  598
            Q+MCREAPK V ELE+YGLPFSRTE
Sbjct  152  QHMCREAPKVVRELESYGLPFSRTE  176



>dbj|GAC97081.1| hypothetical protein PHSY_004665 [Pseudozyma hubeiensis SY62]
Length=654

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y V+DH YDA+VVGAGG+GLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  60   YPVIDHEYDAIVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNM  119

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+ VIELE++GLPFSRT+
Sbjct  120  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTK  169



>emb|CCF54561.1| probable SDH1-succinate dehydrogenase (ubiquinone) flavoprotein 
precursor, mitochondrial [Ustilago hordei]
Length=653

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y V+DH YDA+VVGAGG+GLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  59   YPVIDHEYDAIVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNM  118

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+ VIELE++GLPFSRT+
Sbjct  119  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTK  168



>emb|CDI52111.1| probable SDH1-succinate dehydrogenase (ubiquinone) flavoprotein 
precursor, mitochondrial [Melanopsichium pennsylvanicum 4]
Length=653

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y V+DH YDA+VVGAGG+GLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  59   YPVIDHEYDAIVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNM  118

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+ VIELE++GLPFSRT+
Sbjct  119  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTK  168



>gb|KEQ94689.1| hypothetical protein AUEXF2481DRAFT_30062 [Aureobasidium subglaciale 
EXF-2481]
Length=648

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 116/149 (78%), Gaps = 7/149 (5%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgaggaglr  331
            S+GLR    R+ S  +   R+ + Q       +    + Y V+DH YDA+VVGAGGAGLR
Sbjct  16   SQGLRRQQARAFSRSAPAARIITNQPLRAKEASPFLSNKYPVIDHEYDALVVGAGGAGLR  75

Query  332  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD  511
            AA GL+E GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGD
Sbjct  76   AAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGD  135

Query  512  QDAIQYMCREAPKAVIELENYGLPFSRTE  598
            QDAI YM REAP +VIELENYG PFSRT+
Sbjct  136  QDAIHYMTREAPASVIELENYGCPFSRTD  164



>ref|XP_003036033.1| hypothetical protein SCHCODRAFT_74617 [Schizophyllum commune 
H4-8]
 gb|EFJ01131.1| hypothetical protein SCHCODRAFT_74617 [Schizophyllum commune 
H4-8]
Length=639

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 119/154 (77%), Gaps = 7/154 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQA-------NVGGSSYTVVDHTYDavvvgag  316
            M+R   R   +   RS S  +  +++ +T         +     Y +++H YDAVVVGAG
Sbjct  1    MFRPTLRKCLLRPHRSFSTTAPARKVVATNPVKAQEVPSWASGKYPLIEHEYDAVVVGAG  60

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
Sbjct  61   GAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  120

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAI YMCREAPK VIELE++G+PFSRT+
Sbjct  121  DWLGDQDAIHYMCREAPKTVIELEHFGVPFSRTK  154



>gb|KIO27457.1| hypothetical protein M407DRAFT_243325 [Tulasnella calospora MUT 
4182]
Length=647

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 117/155 (75%), Gaps = 7/155 (5%)
 Frame = +2

Query  155  EMWRCVSRGLRIGSKRSISGDSHLQRLFSTQA-------NVGGSSYTVVDHTYDavvvga  313
            E  R +S+  +    RS+   S  + +  TQ        N   + Y + +H YDAVVVGA
Sbjct  8    ESTRSLSKAAQQAQSRSLHASSSAKMIVGTQPARAQEVKNWSTTEYPIFEHEYDAVVVGA  67

Query  314  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  493
            GGAGLRAA GL+E GF TACITKLFPTRSHTVAAQGG+NAALGNMTEDDWRWHMYDTVKG
Sbjct  68   GGAGLRAAFGLAESGFKTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYDTVKG  127

Query  494  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            SDWLGDQDAI YMCREAP  V+ELE++G+PFSRTE
Sbjct  128  SDWLGDQDAIHYMCREAPNTVLELEHFGVPFSRTE  162



>gb|KDQ59570.1| hypothetical protein JAAARDRAFT_174980 [Jaapia argillacea MUCL 
33604]
Length=638

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 119/150 (79%), Gaps = 6/150 (4%)
 Frame = +2

Query  164  RCVSRGLRIGSKRSISGDSHLQRLFST-----QANVGGSSYTVVDHTYDavvvgaggagl  328
            R V R L+  S+++    +  +++ +T     Q       Y +++H YDA+VVGAGGAGL
Sbjct  5    RTVPRALQ-RSQKAFHSSAVARKIVATNPVRAQEVKSAGKYPIIEHEYDAIVVGAGGAGL  63

Query  329  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  508
            RAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
Sbjct  64   RAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  123

Query  509  DQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DQDAI YMCREAP  VIELE+YG+PFSRT+
Sbjct  124  DQDAIHYMCREAPNTVIELEHYGVPFSRTK  153



>gb|KEQ68526.1| succinate dehydrogenase [Aureobasidium pullulans var. namibiae 
CBS 147.97]
Length=648

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 116/149 (78%), Gaps = 7/149 (5%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgaggaglr  331
            S+GLR    R+ S  +   R+ + Q       +    + Y V+DH YDA+VVGAGGAGLR
Sbjct  16   SQGLRRQQARAFSRSAPAARIITNQPLRAKEASPFLSNKYPVIDHEYDALVVGAGGAGLR  75

Query  332  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD  511
            AA GL+E GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGD
Sbjct  76   AAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGD  135

Query  512  QDAIQYMCREAPKAVIELENYGLPFSRTE  598
            QDAI YM REAP +VIELENYG PFSRT+
Sbjct  136  QDAIHYMTREAPASVIELENYGCPFSRTD  164



>gb|KIV95505.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Exophiala mesophila]
Length=648

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  439
            G SY V+DH YDAVVVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAAL
Sbjct  52   GKSYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAAL  111

Query  440  GNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GNM EDDWRWHMYDTVKGSDWLGDQDAI YM REAP++VIELE YG PFSRTE
Sbjct  112  GNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPRSVIELEGYGCPFSRTE  164



>gb|KIO06451.1| hypothetical protein M404DRAFT_999109 [Pisolithus tinctorius 
Marx 270]
Length=643

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 117/143 (82%), Gaps = 5/143 (3%)
 Frame = +2

Query  185  RIGSKRSISGDSHLQRLFST-----QANVGGSSYTVVDHTYDavvvgaggaglraaigLS  349
            R G +RS +     +++ ST     Q     + Y +++H YDA+VVGAGGAGLRAA GL+
Sbjct  16   RWGLQRSFATTLPARKVVSTNPVKAQQVKSSAKYPLIEHEYDAIVVGAGGAGLRAAFGLA  75

Query  350  EHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQY  529
            E G NTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI Y
Sbjct  76   EAGLNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHY  135

Query  530  MCREAPKAVIELENYGLPFSRTE  598
            MCREAP++VIELE+YG+PFSRT+
Sbjct  136  MCREAPRSVIELEHYGVPFSRTK  158



>emb|CCJ28744.1| unnamed protein product [Pneumocystis jirovecii]
Length=1155

 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            YTVVDH YD VVVG+GGAGLRAA GL+E G+NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  249  YTVVDHEYDVVVVGSGGAGLRAAFGLAEAGYNTACITKLFPTRSHTVAAQGGINAALGNM  308

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP++VIELE++G+PFSRT+
Sbjct  309  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRSVIELEHFGVPFSRTK  358



>gb|KEQ80815.1| succinate dehydrogenase [Aureobasidium pullulans EXF-150]
Length=648

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 116/149 (78%), Gaps = 7/149 (5%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgaggaglr  331
            S+GLR    R+ S  +   R+ + Q       +    + Y V+DH YDA+VVGAGGAGLR
Sbjct  16   SQGLRRQQARAFSRSAPAARIITNQPLRAKEASPFLSNKYPVIDHEYDALVVGAGGAGLR  75

Query  332  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD  511
            AA GL+E GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGD
Sbjct  76   AAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGD  135

Query  512  QDAIQYMCREAPKAVIELENYGLPFSRTE  598
            QDAI YM REAP +VIELENYG PFSRT+
Sbjct  136  QDAIHYMTREAPASVIELENYGCPFSRTD  164



>ref|XP_011387114.1| putative succinate dehydrogenase flavoprotein subunit SDH1 [Ustilago 
maydis 521]
 gb|KIS71272.1| putative succinate dehydrogenase flavoprotein subunit SDH1 [Ustilago 
maydis 521]
Length=654

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y V+DH YDA+VVGAGG+GLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  60   YPVIDHEYDAIVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNM  119

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+ VIELE++GLPFSRT+
Sbjct  120  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTK  169



>ref|XP_009822820.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Aphanomyces astaci]
 gb|ETV87957.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Aphanomyces astaci]
Length=628

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 115/139 (83%), Gaps = 5/139 (4%)
 Frame = +2

Query  182  LRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGF  361
            L+  S+ S +  S   R FS     G  +YT+VDH +DAVVVGAGGAGLRAA+G +E GF
Sbjct  2    LQAASRVSRAVSSTGARAFS-----GKGAYTIVDHEFDAVVVGAGGAGLRAAMGCAEAGF  56

Query  362  NTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCRE  541
             TACITKLFPTRSHTVAAQGGINAAL NMTEDDWRWHMYDTVKGSDWLGDQDAI YMC+E
Sbjct  57   KTACITKLFPTRSHTVAAQGGINAALANMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCKE  116

Query  542  APKAVIELENYGLPFSRTE  598
            AP+AV+ELE YGLPFSRT+
Sbjct  117  APRAVLELEAYGLPFSRTD  135



>emb|CCM05041.1| predicted protein [Fibroporia radiculosa]
Length=639

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 120/150 (80%), Gaps = 8/150 (5%)
 Frame = +2

Query  170  VSRGLRIGSKRSISGDSHLQRLFSTQA-------NVGGSSYTVVDHTYDavvvgaggagl  328
            + + LR  S+RS    +  +R+ +T         +    +Y +++H YDA+VVGAGGAGL
Sbjct  6    LPKALR-ASQRSFHSSAPARRVVATNPVKAQEVPSWASGNYPLIEHEYDAIVVGAGGAGL  64

Query  329  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  508
            RAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
Sbjct  65   RAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG  124

Query  509  DQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DQDAI YMCREAP+ VIELE++G+PFSRT+
Sbjct  125  DQDAIHYMCREAPRTVIELEHFGVPFSRTK  154



>ref|XP_007764259.1| succinate dehydrogenase [Coniophora puteana RWD-64-598 SS2]
 gb|EIW85004.1| succinate dehydrogenase [Coniophora puteana RWD-64-598 SS2]
Length=643

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 121/152 (80%), Gaps = 8/152 (5%)
 Frame = +2

Query  164  RCVSRGLRIGSKRSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgagga  322
            +  SR L + S R+ S  +  +R+ +T        ++     Y +++H YDA+V+GAGGA
Sbjct  8    QAASRNL-LRSTRAFSSTAPARRVVATNPVKAQEVSSWSNGKYPLIEHEYDAIVIGAGGA  66

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
Sbjct  67   GLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  126

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGDQDAI YMCREAP +VIELE+YG+PFSRT+
Sbjct  127  LGDQDAIHYMCREAPHSVIELEHYGVPFSRTK  158



>emb|CCU98950.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=648

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y VV+H YDA+VVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  61   YPVVEHEYDAIVVGAGGAGLRAAFGLAEGGLNTACITKLFPTRSHTVAAQGGINAALGNM  120

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP AV+ELE+YGLPFSRT+
Sbjct  121  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHAVLELEHYGLPFSRTK  170



>emb|CDO68875.1| hypothetical protein BN946_scf185000.g18 [Trametes cinnabarina]
Length=567

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  257  GGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAA  436
            G   Y +++H YDA+VVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAA
Sbjct  39   GWGKYPLIEHEYDAIVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAA  98

Query  437  LGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            LGNMTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+ VIELE++G+PFSRT+
Sbjct  99   LGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGVPFSRTK  152



>gb|EST06229.1| succinate dehydrogenase, flavoprotein subunit [Pseudozyma brasiliensis 
GHG001]
Length=685

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y V+DH YDA+VVGAGG+GLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  59   YPVIDHEYDAIVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNM  118

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+ VIELE++GLPFSRT+
Sbjct  119  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTK  168



>ref|XP_009038442.1| hypothetical protein AURANDRAFT_37947 [Aureococcus anophagefferens]
 gb|EGB06691.1| hypothetical protein AURANDRAFT_37947 [Aureococcus anophagefferens]
Length=629

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = +2

Query  230  RLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTV  409
            R  ST + + G  YTVVDH+YD  VVGAGGAGLRAA+G +E GF TAC+TKLFPTRSHTV
Sbjct  17   RALSTVSGLKGD-YTVVDHSYDVCVVGAGGAGLRAAMGAAEAGFKTACVTKLFPTRSHTV  75

Query  410  AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS  589
            AAQGGINAALGNM+EDDW+WHMYDTVKGSDWLGDQDAI YMCREAP+AV+ELE++GLPFS
Sbjct  76   AAQGGINAALGNMSEDDWKWHMYDTVKGSDWLGDQDAIHYMCREAPQAVLELESFGLPFS  135

Query  590  RTE  598
            RT+
Sbjct  136  RTD  138



>gb|KIJ54874.1| hypothetical protein M422DRAFT_24770 [Sphaerobolus stellatus 
SS14]
Length=641

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 117/155 (75%), Gaps = 8/155 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVG--------GSSYTVVDHTYDavvvga  313
            + +  +R LR    RS    +   R+ +T                Y +++H YDA+VVGA
Sbjct  2    LRKTFARQLRARPYRSFHASAVASRVVATHPVKAEEVTNWATSGKYPLIEHEYDAIVVGA  61

Query  314  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  493
            GGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG
Sbjct  62   GGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  121

Query  494  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            SDWLGDQDAI YMCREAP+ VIELE++G+PFSRT+
Sbjct  122  SDWLGDQDAIHYMCREAPRTVIELEHFGVPFSRTK  156



>ref|XP_009532904.1| hypothetical protein PHYSODRAFT_248886 [Phytophthora sojae]
 gb|EGZ12571.1| hypothetical protein PHYSODRAFT_248886 [Phytophthora sojae]
Length=630

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 115/143 (80%), Gaps = 9/143 (6%)
 Frame = +2

Query  170  VSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLS  349
             SRG  + S + ++G          + +   S YTVVDH YDAVVVGAGGAGLRAA+G +
Sbjct  20   ASRGFAVRSSQPLAG---------VETSALTSKYTVVDHEYDAVVVGAGGAGLRAAMGCA  70

Query  350  EHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQY  529
            E G  TACI+KLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQDAI Y
Sbjct  71   EAGLKTACISKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIHY  130

Query  530  MCREAPKAVIELENYGLPFSRTE  598
            MCREAP+AV ELE++GLPFSRTE
Sbjct  131  MCREAPEAVRELEDFGLPFSRTE  153



>ref|XP_009226311.1| hypothetical protein GGTG_10181 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT73337.1| hypothetical protein GGTG_10181 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=650

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 112/145 (77%), Gaps = 11/145 (8%)
 Frame = +2

Query  164  RCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaig  343
            R  +R L  G  R+     H+           GS Y V+DH YDA+VVGAGGAGLRAA G
Sbjct  33   RSAARILGTGPLRAKEASKHV-----------GSKYPVIDHEYDAIVVGAGGAGLRAAFG  81

Query  344  LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI  523
            L+E GFNTACI+KLFPTRSHTVAAQGGINAALGNM +DDWRWHMYDTVKGSDWLGDQDAI
Sbjct  82   LAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHKDDWRWHMYDTVKGSDWLGDQDAI  141

Query  524  QYMCREAPKAVIELENYGLPFSRTE  598
             YM REAP ++IELENYG PFSRTE
Sbjct  142  HYMTREAPASIIELENYGCPFSRTE  166



>gb|KIV77229.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Exophiala sideris]
Length=648

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 118/149 (79%), Gaps = 8/149 (5%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgaggaglr  331
            SR L+  ++R  S    + R+ ++Q       +     SY V+DH YDAVVVGAGGAGLR
Sbjct  17   SRALKP-TRRQFSTTRPVARVVASQPLRAKEASPFASKSYPVIDHQYDAVVVGAGGAGLR  75

Query  332  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD  511
            AA GL+E GFNTAC+TKLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGD
Sbjct  76   AAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGD  135

Query  512  QDAIQYMCREAPKAVIELENYGLPFSRTE  598
            QDAI YM REAP++VIELE+YG PFSRTE
Sbjct  136  QDAIHYMTREAPRSVIELESYGCPFSRTE  164



>gb|KDR81560.1| hypothetical protein GALMADRAFT_134991 [Galerina marginata CBS 
339.88]
Length=639

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 116/154 (75%), Gaps = 7/154 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVG-------GSSYTVVDHTYDavvvgag  316
            M+R       + SKR+    S + R+ +T               Y +++H +DAVVVGAG
Sbjct  1    MFRKALPKALVPSKRAFHASSSVSRVVATNPAKAEEVKSWSSGKYPLIEHEFDAVVVGAG  60

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAA GL+E GF TACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
Sbjct  61   GAGLRAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  120

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAI YMCREAP  VIELE+YG+PFSRT+
Sbjct  121  DWLGDQDAIHYMCREAPNTVIELEHYGVPFSRTK  154



>ref|XP_007264237.1| succinate dehydrogenase [Fomitiporia mediterranea MF3/22]
 gb|EJD06091.1| succinate dehydrogenase [Fomitiporia mediterranea MF3/22]
Length=643

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +2

Query  266  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  445
             Y V DH YDAVVVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGG+NAALGN
Sbjct  48   KYPVFDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGVNAALGN  107

Query  446  MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            MTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP++VIELE++G+PFSRT+
Sbjct  108  MTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRSVIELEHFGVPFSRTK  158



>gb|KIW22833.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Cladophialophora immunda]
Length=649

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 116/149 (78%), Gaps = 7/149 (5%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQA-------NVGGSSYTVVDHTYDavvvgaggaglr  331
            S  LR  S+R  S    + R+ ++Q        +    SY ++DH YDAVVVGAGGAGLR
Sbjct  17   STSLRHTSRRQFSSTRPVARVIASQPLRAKEAESFPYGSYPIIDHEYDAVVVGAGGAGLR  76

Query  332  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD  511
            AA GL+E GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGD
Sbjct  77   AAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGD  136

Query  512  QDAIQYMCREAPKAVIELENYGLPFSRTE  598
            QDAI YM REAP++VIELE YG PFSRTE
Sbjct  137  QDAIHYMTREAPRSVIELEGYGCPFSRTE  165



>ref|XP_742730.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 emb|CAH80708.1| hypothetical protein PC000183.04.0 [Plasmodium chabaudi chabaudi]
Length=218

 Score =   170 bits (431),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
             +Y ++DH YDAV+VGAGGAGLR+A+ LS++ +  ACITKLFPTRSHTVAAQGGINAALG
Sbjct  25   KAYDIIDHHYDAVIVGAGGAGLRSALELSKNKYKVACITKLFPTRSHTVAAQGGINAALG  84

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NMTEDDWRWH YDT+KGSDWLGDQ+AIQYMCREAP++VIELE +GLPFSRT+
Sbjct  85   NMTEDDWRWHAYDTIKGSDWLGDQNAIQYMCREAPESVIELEEFGLPFSRTK  136



>ref|XP_008720747.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Cyphellophora europaea CBS 101466]
 gb|ETN37215.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Cyphellophora europaea CBS 101466]
Length=647

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 115/145 (79%), Gaps = 5/145 (3%)
 Frame = +2

Query  164  RCVSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaig  343
            RC S   + G      G S L+   +T  N+ G +Y VVDH YDA+V+GAGGAGLRA  G
Sbjct  24   RCFSSTSKTGK---YYGSSPLRAQEAT--NIHGHAYNVVDHQYDALVIGAGGAGLRATFG  78

Query  344  LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI  523
            L+E GFNTAC++KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGDQDAI
Sbjct  79   LAEAGFNTACVSKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAI  138

Query  524  QYMCREAPKAVIELENYGLPFSRTE  598
             YM REAP++VIELE YG PFSRTE
Sbjct  139  HYMTREAPQSVIELEGYGCPFSRTE  163



>gb|KDQ06748.1| hypothetical protein BOTBODRAFT_121111 [Botryobasidium botryosum 
FD-172 SS1]
Length=643

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +2

Query  266  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  445
             YT+++H YDA+VVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGG+NAALGN
Sbjct  48   KYTLIEHEYDAIVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGVNAALGN  107

Query  446  MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            MTEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  VIELE++G+PFSRT+
Sbjct  108  MTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPNTVIELEHFGVPFSRTK  158



>gb|KIK59746.1| hypothetical protein GYMLUDRAFT_261747 [Gymnopus luxurians FD-317 
M1]
Length=639

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 116/142 (82%), Gaps = 7/142 (5%)
 Frame = +2

Query  194  SKRSISGDSHLQRLFSTQ----ANV---GGSSYTVVDHTYDavvvgaggaglraaigLSE  352
            S+RS+   +   ++ ST     A V       Y +++H YDA+VVGAGGAGLRAA GL+E
Sbjct  13   SRRSLHSSAPALKVISTNPVRAAEVQSWSSGKYPLIEHEYDAIVVGAGGAGLRAAFGLAE  72

Query  353  HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYM  532
             GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI YM
Sbjct  73   AGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYM  132

Query  533  CREAPKAVIELENYGLPFSRTE  598
            CREAP+ VIELE++G+PFSRT+
Sbjct  133  CREAPQTVIELEHFGVPFSRTK  154



>ref|XP_007863722.1| succinate dehydrogenase [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58581.1| succinate dehydrogenase [Gloeophyllum trabeum ATCC 11539]
Length=639

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y +++H YDA+VVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  45   YPLIEHEYDAIVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNM  104

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP+ VIELE++G+PFSRT+
Sbjct  105  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGVPFSRTK  154



>ref|XP_005841533.1| hypothetical protein GUITHDRAFT_159138 [Guillardia theta CCMP2712]
 gb|EKX54553.1| hypothetical protein GUITHDRAFT_159138 [Guillardia theta CCMP2712]
Length=608

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y +VDHTYDAVVVGAGGAGLRAA+G +E+GFN ACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  16   YHIVDHTYDAVVVGAGGAGLRAAVGFAENGFNVACITKLFPTRSHTVAAQGGINAALGNM  75

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWH YDTVKGSDWLGDQDAI+YMC+EAP+AVIELE YG+PFSRT+
Sbjct  76   TEDDWRWHFYDTVKGSDWLGDQDAIEYMCKEAPRAVIELEAYGMPFSRTD  125



>ref|XP_007847694.1| succinate dehydrogenase flavoprotein subunit [Moniliophthora 
roreri MCA 2997]
 gb|ESK93056.1| succinate dehydrogenase flavoprotein subunit [Moniliophthora 
roreri MCA 2997]
Length=639

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 115/142 (81%), Gaps = 7/142 (5%)
 Frame = +2

Query  194  SKRSISGDSHLQRLFSTQANVG-------GSSYTVVDHTYDavvvgaggaglraaigLSE  352
            S RS+   + ++R+ ST               Y +++H YDA+VVGAGGAGLRAA GL+E
Sbjct  13   SHRSLHTSAPVRRVVSTSPVKAQEVQSWSSGKYPLIEHEYDAIVVGAGGAGLRAAFGLAE  72

Query  353  HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYM  532
             GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDW+WHMYDTVKGSDWLGDQDAI YM
Sbjct  73   AGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWKWHMYDTVKGSDWLGDQDAIHYM  132

Query  533  CREAPKAVIELENYGLPFSRTE  598
            CREAP+ VIELE++G+PFSRT+
Sbjct  133  CREAPRTVIELEHFGVPFSRTK  154



>gb|EPZ33613.1| putative succinate dehydrogenase [ubiquinone] flavoprotein subunit, 
mitochondrial [Rozella allomycis CSF55]
Length=599

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  254  VGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINA  433
            +G  SYTV+DHT+DAVVVGAGGAGLRAA GL+E G+  AC+TKLFPTRSHTVAAQGGINA
Sbjct  1    MGIKSYTVIDHTFDAVVVGAGGAGLRAAFGLAEAGYQVACVTKLFPTRSHTVAAQGGINA  60

Query  434  ALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            ALGNM +DDWRWHMYDTVKGSDWLGDQDAI YMCREAP  VIELENYG+PFSRT 
Sbjct  61   ALGNMGKDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPNTVIELENYGVPFSRTR  115



>ref|XP_008886639.1| flavoprotein subunit of succinate dehydrogenase [Hammondia hammondi]
 gb|KEP62680.1| flavoprotein subunit of succinate dehydrogenase [Hammondia hammondi]
Length=670

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = +2

Query  170  VSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLS  349
            V+RGL     ++       Q+ F T  N   ++Y V+DH YDA+VVGAGGAGLRAA GL+
Sbjct  37   VARGLDAAQPQATGAALVQQQRFFT--NAKKAAYRVIDHEYDAIVVGAGGAGLRAAFGLA  94

Query  350  EHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQY  529
              G  TAC++KLFPTRSHTVAAQGGINAALGNMTEDDWRWH YDTVKGSDWLGDQDAIQ+
Sbjct  95   SAGIKTACLSKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAIQH  154

Query  530  MCREAPKAVIELENYGLPFSRTE  598
            MCREAPK V ELE+YGLPFSRTE
Sbjct  155  MCREAPKVVRELESYGLPFSRTE  177



>gb|KFZ08763.1| hypothetical protein V502_09175 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=646

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  439
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  440  GNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GNM EDDWRWHMYDTVKGSDWLGDQDAI YM REAP +VIELENYG PFSRTE
Sbjct  111  GNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTE  163



>ref|XP_001014703.2| succinate dehydrogenase, flavoprotein subunit containing protein 
[Tetrahymena thermophila]
 gb|EAR94519.2| succinate dehydrogenase [ubiquinone] flavoprotein subunit [Tetrahymena 
thermophila SB210]
Length=636

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  266  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  445
             YTV+DHTYDA+VVGAGGAGLRAA GL E GF TACITKLFPTRSHTVAAQGGINAALGN
Sbjct  41   KYTVIDHTYDAIVVGAGGAGLRAAFGLVEEGFKTACITKLFPTRSHTVAAQGGINAALGN  100

Query  446  MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            MTEDDW+WH YDTVKGSDWLGDQDAIQYM REAP AV+ELE+YGLPFSRT
Sbjct  101  MTEDDWKWHFYDTVKGSDWLGDQDAIQYMTREAPAAVLELESYGLPFSRT  150



>ref|XP_008023526.1| hypothetical protein SETTUDRAFT_128655 [Setosphaeria turcica 
Et28A]
 gb|EOA88875.1| hypothetical protein SETTUDRAFT_128655 [Setosphaeria turcica 
Et28A]
Length=647

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 113/140 (81%), Gaps = 7/140 (5%)
 Frame = +2

Query  200  RSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHG  358
            R+ S     QR+ +T+       +    S Y ++DH YDA+VVGAGGAGLRAA GL+E G
Sbjct  24   RAFSSTRPAQRIIATENLRAKEASGFISSKYPIIDHEYDAIVVGAGGAGLRAAFGLAEAG  83

Query  359  FNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCR  538
            FNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGDQDAI YM R
Sbjct  84   FNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTR  143

Query  539  EAPKAVIELENYGLPFSRTE  598
            EAP++VIELENYG PFSRT+
Sbjct  144  EAPQSVIELENYGCPFSRTD  163



>gb|KFY53709.1| hypothetical protein V496_07397 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY78918.1| hypothetical protein V498_09017 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=646

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  439
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  440  GNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GNM EDDWRWHMYDTVKGSDWLGDQDAI YM REAP +VIELENYG PFSRTE
Sbjct  111  GNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTE  163



>gb|ELR10143.1| succinate dehydrogenase flavoprotein subunit, mitochondrial [Pseudogymnoascus 
destructans 20631-21]
Length=646

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  439
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  440  GNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GNM EDDWRWHMYDTVKGSDWLGDQDAI YM REAP +VIELENYG PFSRTE
Sbjct  111  GNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTE  163



>gb|KIW83248.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Fonsecaea pedrosoi CBS 271.37]
Length=649

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 115/146 (79%), Gaps = 7/146 (5%)
 Frame = +2

Query  182  LRIGSKRSISGDSHLQRLFSTQA-------NVGGSSYTVVDHTYDavvvgaggaglraai  340
            LR  S+R  S    + R+ ++Q        +    +Y ++DH YDAVVVGAGGAGLRAA 
Sbjct  20   LRQTSRRQFSSTRPVARVIASQPLRAKEAESFPYGTYPIIDHEYDAVVVGAGGAGLRAAF  79

Query  341  gLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDA  520
            GL+E GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGDQDA
Sbjct  80   GLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDA  139

Query  521  IQYMCREAPKAVIELENYGLPFSRTE  598
            I YM REAP++VIELE YG PFSRTE
Sbjct  140  IHYMTREAPRSVIELEGYGCPFSRTE  165



>ref|XP_007827022.1| succinate dehydrogenase [Pestalotiopsis fici W106-1]
 gb|ETS86422.1| succinate dehydrogenase [Pestalotiopsis fici W106-1]
Length=640

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 111/133 (83%), Gaps = 9/133 (7%)
 Frame = +2

Query  224  LQRLFSTQ--------ANVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACIT  379
            L R+F+ Q        A+V  S Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+
Sbjct  25   LTRIFANQPLRAKEASAHVS-SKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACIS  83

Query  380  KLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVI  559
            KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGDQDAI YM REAP ++I
Sbjct  84   KLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASII  143

Query  560  ELENYGLPFSRTE  598
            ELENYG PFSRTE
Sbjct  144  ELENYGCPFSRTE  156



>gb|KFY69831.1| hypothetical protein V499_09711 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFZ00659.1| hypothetical protein V501_10569 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=646

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  439
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  440  GNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            GNM EDDWRWHMYDTVKGSDWLGDQDAI YM REAP +VIELENYG PFSRTE
Sbjct  111  GNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTE  163



>gb|KFH69943.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Mortierella verticillata NRRL 6337]
Length=644

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y ++DHTYDA+VVGAGGAGLRAA GL+E G NTACI+KLFPTRSHTVAAQGG+NAALG
Sbjct  49   SKYPIIDHTYDALVVGAGGAGLRAAFGLAEAGLNTACISKLFPTRSHTVAAQGGVNAALG  108

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NM EDDWRWHMYDTVKGSDWLGDQDAI YMCREAP +VIELE+YG+PFSRT+
Sbjct  109  NMGEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHSVIELEHYGVPFSRTK  160



>ref|XP_009266237.1| hypothetical protein J056_002098 [Wallemia ichthyophaga EXF-994]
 gb|EOR04020.1| hypothetical protein J056_002098 [Wallemia ichthyophaga EXF-994]
Length=641

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 114/151 (75%), Gaps = 19/151 (13%)
 Frame = +2

Query  200  RSISGDSHLQRLFSTQANV-------------------GGSSYTVVDHTYDavvvgagga  322
            R+I G    +R FST A V                     S+Y V+DH YDAVVVGAGG+
Sbjct  5    RNIRGSPLSRRAFSTSAVVSRVVATDPVKAKHAENNGFAASNYPVIDHEYDAVVVGAGGS  64

Query  323  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW  502
            GLRAA GL+E G  TACITKLFPTRSHTVAAQGGINAALGNMT+DDWRWHMYDTVKGSDW
Sbjct  65   GLRAAFGLAEAGHKTACITKLFPTRSHTVAAQGGINAALGNMTKDDWRWHMYDTVKGSDW  124

Query  503  LGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            LGDQDAI YMCREAP+ V+ELE+YG+PFSRT
Sbjct  125  LGDQDAIHYMCREAPRTVVELEHYGVPFSRT  155



>ref|XP_006114284.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial, partial [Pelodiscus sinensis]
Length=300

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAALG
Sbjct  55   TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALG  114

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NM ED+WRWH YDTVKGSDWLGDQDAI YM  EAP AV+ELENYG+PFSRTE
Sbjct  115  NMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEEAPAAVVELENYGMPFSRTE  166



>emb|CDW52121.1| flavoprotein subunit of succinate dehydrogenase [Trichuris trichiura]
Length=647

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 117/155 (75%), Gaps = 17/155 (11%)
 Frame = +2

Query  158  MWRC--------VSRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvga  313
            M RC        V R L++ + RS   DS   R  ST       SY +VDH+YD VVVGA
Sbjct  1    MLRCRGTLNGNAVQRLLQVSASRSY--DSSASRKMST-------SYKIVDHSYDVVVVGA  51

Query  314  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG  493
            GGAGLRAA+GL E GF TA +TKLFPTRSHTVAAQGG+NAALGNM  DDWRWH YDTVKG
Sbjct  52   GGAGLRAAMGLVEAGFKTAVVTKLFPTRSHTVAAQGGVNAALGNMEPDDWRWHFYDTVKG  111

Query  494  SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            SDWLGDQDAI YMCREAP+AV+ELENYG+PFSRT+
Sbjct  112  SDWLGDQDAIHYMCREAPRAVLELENYGMPFSRTK  146



>ref|XP_008889762.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Phytophthora parasitica INRA-310]
 gb|ETI57531.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Phytophthora parasitica P1569]
 gb|ETK97267.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Phytophthora parasitica]
 gb|ETL50618.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Phytophthora parasitica]
 gb|ETM56947.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Phytophthora parasitica]
 gb|ETN23578.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Phytophthora parasitica INRA-310]
 gb|ETO86276.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Phytophthora parasitica P1976]
 gb|ETP27301.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Phytophthora parasitica CJ01A1]
Length=645

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 9/142 (6%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSE  352
            +RG  + S + ++G          + +   S YT+VDH YDAVVVGAGGAGLRAA+G +E
Sbjct  21   TRGFAVRSSKPLAG---------VETSALTSKYTIVDHEYDAVVVGAGGAGLRAAMGCAE  71

Query  353  HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYM  532
             G  TACI+KLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQDAI YM
Sbjct  72   AGLKTACISKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIHYM  131

Query  533  CREAPKAVIELENYGLPFSRTE  598
            CREAP+AV ELE++GLPFSRTE
Sbjct  132  CREAPEAVRELEDFGLPFSRTE  153



>gb|EKG22188.1| Fumarate reductase/succinate dehydrogenase FAD-binding site [Macrophomina 
phaseolina MS6]
Length=647

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 117/149 (79%), Gaps = 8/149 (5%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQ-------ANVGGSSYTVVDHTYDavvvgaggaglr  331
            SR LR    R+ S    + ++F+ +       +    + Y V+DH YDA+VVGAGG+GLR
Sbjct  16   SRALRP-QARAFSSTRSVSKIFTNEPLRAKEASPFLSNKYPVIDHEYDALVVGAGGSGLR  74

Query  332  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD  511
            AA GL+E GFNTACI+KLFPTRSHTVAAQGGINAALGNM EDDWRWHMYDTVKGSDWLGD
Sbjct  75   AAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGD  134

Query  512  QDAIQYMCREAPKAVIELENYGLPFSRTE  598
            QDAI YM REAP++VIELENYG PFSRTE
Sbjct  135  QDAIHYMTREAPQSVIELENYGCPFSRTE  163



>gb|KIY70536.1| succinate dehydrogenase [Cylindrobasidium torrendii FP15055 ss-10]
Length=638

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 120/154 (78%), Gaps = 8/154 (5%)
 Frame = +2

Query  158  MWRCVSRGLRIGSKRSISGDSHLQRLFSTQANVG-------GSSYTVVDHTYDavvvgag  316
            M R ++R L +G++R+ +  +  QR+ ST               Y +++H YDA+VVGAG
Sbjct  1    MQRGLTRRL-LGARRTFTSSAVTQRIASTNPVKAQEVPAWASGKYPLIEHEYDAIVVGAG  59

Query  317  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  496
            GAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
Sbjct  60   GAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS  119

Query  497  DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            DWLGDQDAI YM REAP  V+ELE+YG+PFSRT+
Sbjct  120  DWLGDQDAIHYMTREAPNTVVELEHYGVPFSRTK  153



>gb|ETM03646.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Phytophthora parasitica]
Length=645

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 9/142 (6%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSE  352
            +RG  + S + ++G          + +   S YT+VDH YDAVVVGAGGAGLRAA+G +E
Sbjct  21   TRGFAVRSSKPLAG---------VETSALTSKYTIVDHEYDAVVVGAGGAGLRAAMGCAE  71

Query  353  HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYM  532
             G  TACI+KLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQDAI YM
Sbjct  72   AGLKTACISKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIHYM  131

Query  533  CREAPKAVIELENYGLPFSRTE  598
            CREAP+AV ELE++GLPFSRTE
Sbjct  132  CREAPEAVRELEDFGLPFSRTE  153



>ref|XP_008077212.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868]
 gb|EPE36394.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868]
Length=647

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            + Y VVDH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAALG
Sbjct  52   NKYPVVDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  111

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NM EDDWRWHMYDTVKGSDWLGDQDAI YM REAP++VIELENYG PFSRTE
Sbjct  112  NMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTE  163



>ref|XP_007321927.1| minor succinate dehydrogenase isozyme, Sdh1p [Serpula lacrymans 
var. lacrymans S7.9]
 gb|EGN95437.1| SDHA, succinate dehydrogenase subunit [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO20970.1| minor succinate dehydrogenase isozyme, Sdh1p [Serpula lacrymans 
var. lacrymans S7.9]
Length=644

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y +++H YDA+VVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  50   YPLIEHEYDAIVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNM  109

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP  VIELE++G+PFSRT+
Sbjct  110  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPSTVIELEHFGVPFSRTK  159



>gb|ETP55265.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Phytophthora parasitica P10297]
Length=645

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 9/142 (6%)
 Frame = +2

Query  173  SRGLRIGSKRSISGDSHLQRLFSTQANVGGSSYTVVDHTYDavvvgaggaglraaigLSE  352
            +RG  + S + ++G          + +   S YT+VDH YDAVVVGAGGAGLRAA+G +E
Sbjct  21   TRGFAVRSSKPLAG---------VETSALTSKYTIVDHEYDAVVVGAGGAGLRAAMGCAE  71

Query  353  HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYM  532
             G  TACI+KLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGSDWLGDQDAI YM
Sbjct  72   AGLKTACISKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIHYM  131

Query  533  CREAPKAVIELENYGLPFSRTE  598
            CREAP+AV ELE++GLPFSRTE
Sbjct  132  CREAPEAVRELEDFGLPFSRTE  153



>dbj|BAE87311.1| unnamed protein product [Macaca fascicularis]
Length=253

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAALG
Sbjct  53   AQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALG  112

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NM ED+WRWH YDTVKGSDWLGDQDAI YM  +AP AV+ELENYG+PFSRTE
Sbjct  113  NMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTE  164



>gb|KIK49372.1| hypothetical protein CY34DRAFT_797317 [Suillus luteus UH-Slu-Lm8-n1]
Length=644

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 111/143 (78%), Gaps = 17/143 (12%)
 Frame = +2

Query  221  HLQRLFSTQANV-----------------GGSSYTVVDHTYDavvvgaggaglraaigLS  349
            H QR FST   V                     Y +++H YDA+VVGAGGAGLRAA GL+
Sbjct  17   HPQRTFSTSLPVRRVVASNPVKAEEVKSWSSGKYPLIEHEYDAIVVGAGGAGLRAAFGLA  76

Query  350  EHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQY  529
            E GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI Y
Sbjct  77   EAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHY  136

Query  530  MCREAPKAVIELENYGLPFSRTE  598
            MCREAP++V ELE+YG+PFSRT+
Sbjct  137  MCREAPRSVYELEHYGVPFSRTK  159



>ref|XP_007340905.1| succinate dehydrogenase [Auricularia delicata TFB-10046 SS5]
 gb|EJD50761.1| succinate dehydrogenase [Auricularia delicata TFB-10046 SS5]
Length=644

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 118/142 (83%), Gaps = 8/142 (6%)
 Frame = +2

Query  197  KRSISGDSHLQRLFSTQ------ANVGGSS--YTVVDHTYDavvvgaggaglraaigLSE  352
            +RS S  +  +++ +T+      A   G++  Y +++H YDA+VVGAGGAGLRAA GL+E
Sbjct  18   RRSFSASAAARKVVATEPVKAQEAKTWGTAGKYPLIEHEYDAIVVGAGGAGLRAAFGLAE  77

Query  353  HGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYM  532
             GF TACITKLFPTRSHTVAAQGG+NAALGNMTEDDWRWHMYDTVKGSDWLGDQDAI YM
Sbjct  78   AGFKTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYM  137

Query  533  CREAPKAVIELENYGLPFSRTE  598
            CREAPK VIELE++G+PFSRT+
Sbjct  138  CREAPKTVIELEHFGVPFSRTK  159



>ref|XP_001439561.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK72164.1| unnamed protein product [Paramecium tetraurelia]
Length=636

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  266  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  445
             YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAALGN
Sbjct  41   KYTVIDHTYDAVVVGAGGAGLRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGN  100

Query  446  MTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT  595
            MTEDDWRWH YDT+KGSDWLGDQDAI YMC+EAPKAV ELE+YGLPFSRT
Sbjct  101  MTEDDWRWHAYDTIKGSDWLGDQDAISYMCKEAPKAVYELESYGLPFSRT  150



>gb|KIJ16848.1| succinate dehydrogenase [Paxillus involutus ATCC 200175]
Length=644

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  448
            Y +++H YDA+VVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAALGNM
Sbjct  50   YPLIEHEYDAIVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNM  109

Query  449  TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            TEDDWRWHMYDTVKGSDWLGDQDAI YMCREAP++VIELE+YG+PFSRT+
Sbjct  110  TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRSVIELEHYGVPFSRTK  159



>ref|XP_007724687.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Capronia coronata CBS 617.96]
 gb|EXJ88681.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Capronia coronata CBS 617.96]
Length=648

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  442
            S Y V+DH YDAVVVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAALG
Sbjct  53   SKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALG  112

Query  443  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE  598
            NM EDDWRWHMYDTVKGSDWLGDQDAI YM REAP++VIELE+YG PFSRTE
Sbjct  113  NMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPRSVIELESYGCPFSRTE  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510