BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF023M06

Length=656
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU23795.1|  hypothetical protein MIMGU_mgv1a015337mg                305   3e-102   Erythranthe guttata [common monkey flower]
ref|XP_011099767.1|  PREDICTED: 50S ribosomal protein L17, chloro...    302   2e-101   Sesamum indicum [beniseed]
ref|XP_002310514.2|  ribosomal protein L17                              301   7e-101   
ref|XP_007137704.1|  hypothetical protein PHAVU_009G148700g             297   2e-99    Phaseolus vulgaris [French bean]
ref|XP_010452976.1|  PREDICTED: 50S ribosomal protein L17, chloro...    292   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010520334.1|  PREDICTED: probable 39S ribosomal protein L1...    292   3e-97    Tarenaya hassleriana [spider flower]
ref|XP_002873421.1|  ribosomal protein L17 family protein               292   4e-97    Arabidopsis lyrata subsp. lyrata
emb|CDP04732.1|  unnamed protein product                                291   6e-97    Coffea canephora [robusta coffee]
ref|XP_010422944.1|  PREDICTED: 50S ribosomal protein L17, chloro...    291   6e-97    Camelina sativa [gold-of-pleasure]
ref|XP_006288819.1|  hypothetical protein CARUB_v10002154mg             291   6e-97    Capsella rubella
ref|XP_010484251.1|  PREDICTED: probable 39S ribosomal protein L1...    287   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_011007555.1|  PREDICTED: 50S ribosomal protein L17, chloro...    287   2e-95    Populus euphratica
ref|XP_010462907.1|  PREDICTED: probable 39S ribosomal protein L1...    287   3e-95    Camelina sativa [gold-of-pleasure]
ref|XP_002866626.1|  ribosomal protein L17 family protein               286   5e-95    
ref|XP_010444404.1|  PREDICTED: probable 39S ribosomal protein L1...    286   6e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006281236.1|  hypothetical protein CARUB_v10027279mg             286   6e-95    Capsella rubella
ref|XP_004245242.1|  PREDICTED: 50S ribosomal protein L17, chloro...    286   7e-95    Solanum lycopersicum
ref|NP_568216.1|  ribosomal protein L17 family protein                  286   8e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002307023.1|  ribosomal protein L17                              286   8e-95    Populus trichocarpa [western balsam poplar]
gb|KJB16008.1|  hypothetical protein B456_002G208300                    285   1e-94    Gossypium raimondii
ref|XP_009616322.1|  PREDICTED: 50S ribosomal protein L17, chloro...    285   1e-94    Nicotiana tomentosiformis
gb|KHN31132.1|  50S ribosomal protein L17                               285   2e-94    Glycine soja [wild soybean]
ref|XP_010245813.1|  PREDICTED: probable 39S ribosomal protein L1...    285   2e-94    Nelumbo nucifera [Indian lotus]
ref|XP_010690446.1|  PREDICTED: 50S ribosomal protein L17, chloro...    285   2e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006356626.1|  PREDICTED: 50S ribosomal protein L17, chloro...    285   3e-94    Solanum tuberosum [potatoes]
emb|CDY18701.1|  BnaA09g06940D                                          284   3e-94    Brassica napus [oilseed rape]
ref|NP_001240907.1|  uncharacterized protein LOC100785280               283   9e-94    Glycine max [soybeans]
ref|XP_007048324.1|  Ribosomal protein L17 family protein               283   9e-94    Theobroma cacao [chocolate]
ref|XP_009112146.1|  PREDICTED: probable 39S ribosomal protein L1...    283   1e-93    Brassica rapa
ref|NP_001237810.1|  uncharacterized protein LOC100305861               283   1e-93    Glycine max [soybeans]
emb|CDX81235.1|  BnaC09g06460D                                          283   1e-93    
ref|XP_010546366.1|  PREDICTED: probable 39S ribosomal protein L1...    283   1e-93    Tarenaya hassleriana [spider flower]
ref|XP_010244019.1|  PREDICTED: probable 39S ribosomal protein L1...    282   3e-93    Nelumbo nucifera [Indian lotus]
ref|XP_008244412.1|  PREDICTED: 50S ribosomal protein L17, chloro...    281   3e-93    Prunus mume [ume]
ref|XP_011022953.1|  PREDICTED: 50S ribosomal protein L17, chloro...    281   4e-93    Populus euphratica
ref|NP_568992.1|  large subunit ribosomal protein L17                   281   5e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517236.1|  ribosomal protein L17, putative                    281   5e-93    Ricinus communis
gb|KDP26142.1|  hypothetical protein JCGZ_22243                         281   6e-93    Jatropha curcas
ref|XP_002281739.1|  PREDICTED: probable 39S ribosomal protein L1...    281   7e-93    Vitis vinifera
ref|XP_007206065.1|  hypothetical protein PRUPE_ppa012729mg             280   1e-92    Prunus persica
ref|XP_006427799.1|  hypothetical protein CICLE_v10026667mg             280   1e-92    Citrus clementina [clementine]
gb|AAM63867.1|  50S ribosomal protein L17                               279   5e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KJB16009.1|  hypothetical protein B456_002G208300                    278   6e-92    Gossypium raimondii
gb|AET05307.2|  50S ribosomal protein L17                               278   8e-92    Medicago truncatula
gb|KJB16010.1|  hypothetical protein B456_002G208300                    277   3e-91    Gossypium raimondii
ref|XP_004502917.1|  PREDICTED: 50S ribosomal protein L17-like          275   2e-90    Cicer arietinum [garbanzo]
ref|XP_010245812.1|  PREDICTED: probable 39S ribosomal protein L1...    275   3e-90    Nelumbo nucifera [Indian lotus]
gb|EPS69520.1|  hypothetical protein M569_05246                         272   2e-89    Genlisea aurea
gb|KFK25270.1|  hypothetical protein AALP_AA8G090100                    272   2e-89    Arabis alpina [alpine rockcress]
emb|CDX81138.1|  BnaC03g03920D                                          272   3e-89    
emb|CAB89353.1|  ribsomal protein-like                                  271   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131122.1|  PREDICTED: 50S ribosomal protein L17, chloro...    267   2e-87    Brassica rapa
dbj|BAB11432.1|  50S ribosomal protein L17                              267   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003602582.1|  50S ribosomal protein L17                          265   1e-86    Medicago truncatula
ref|XP_008392015.1|  PREDICTED: 50S ribosomal protein L17, chloro...    265   2e-86    Malus domestica [apple tree]
gb|KHG30266.1|  50S ribosomal L17                                       265   2e-86    Gossypium arboreum [tree cotton]
ref|XP_010932763.1|  PREDICTED: probable 39S ribosomal protein L1...    264   2e-86    Elaeis guineensis
ref|XP_008344889.1|  PREDICTED: 50S ribosomal protein L17, chloro...    264   3e-86    
ref|XP_008803385.1|  PREDICTED: probable 39S ribosomal protein L1...    263   8e-86    Phoenix dactylifera
ref|XP_009341932.1|  PREDICTED: 50S ribosomal protein L17, chloro...    263   1e-85    Pyrus x bretschneideri [bai li]
gb|ACJ84008.1|  unknown                                                 262   2e-85    Medicago truncatula
ref|XP_004148646.1|  PREDICTED: 50S ribosomal protein L17-like          260   8e-85    Cucumis sativus [cucumbers]
dbj|BAC42886.1|  putative 50S ribosomal protein L17                     259   2e-84    Arabidopsis thaliana [mouse-ear cress]
emb|CAN65254.1|  hypothetical protein VITISV_026602                     259   1e-83    Vitis vinifera
ref|XP_004970519.1|  PREDICTED: probable 39S ribosomal protein L1...    257   2e-83    Setaria italica
ref|XP_010025565.1|  PREDICTED: 50S ribosomal protein L17, chloro...    256   3e-83    Eucalyptus grandis [rose gum]
ref|XP_006399460.1|  hypothetical protein EUTSA_v10014895mg             255   1e-82    Eutrema salsugineum [saltwater cress]
ref|NP_001044752.1|  Os01g0839300                                       254   1e-82    
ref|XP_008776922.1|  PREDICTED: probable 39S ribosomal protein L1...    254   2e-82    Phoenix dactylifera
ref|XP_006843890.1|  hypothetical protein AMTR_s00007p00266670          254   2e-82    Amborella trichopoda
gb|ABK23689.1|  unknown                                                 254   3e-82    Picea sitchensis
ref|XP_006654515.1|  PREDICTED: probable 39S ribosomal protein L1...    253   7e-82    Oryza brachyantha
dbj|BAK06308.1|  predicted protein                                      253   7e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM84912.1|  unnamed protein product                                253   8e-82    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006644980.1|  PREDICTED: probable 39S ribosomal protein L1...    253   9e-82    Oryza brachyantha
ref|XP_009381087.1|  PREDICTED: 50S ribosomal protein L17, chloro...    252   1e-81    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC79355.1|  hypothetical protein OsI_20233                          252   2e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_003564575.1|  PREDICTED: probable 39S ribosomal protein L1...    252   2e-81    Brachypodium distachyon [annual false brome]
ref|XP_003568304.2|  PREDICTED: probable 39S ribosomal protein L1...    253   8e-81    
ref|XP_010917739.1|  PREDICTED: probable 39S ribosomal protein L1...    247   1e-79    Elaeis guineensis
gb|KDO58345.1|  hypothetical protein CISIN_1g0313082mg                  245   3e-79    Citrus sinensis [apfelsine]
gb|KDO58348.1|  hypothetical protein CISIN_1g0313082mg                  243   3e-78    Citrus sinensis [apfelsine]
ref|XP_008441029.1|  PREDICTED: probable 39S ribosomal protein L1...    243   4e-78    Cucumis melo [Oriental melon]
ref|XP_002452603.1|  hypothetical protein SORBIDRAFT_04g028870          240   6e-77    Sorghum bicolor [broomcorn]
gb|KDO58347.1|  hypothetical protein CISIN_1g0313082mg                  239   8e-77    Citrus sinensis [apfelsine]
ref|XP_004306555.1|  PREDICTED: probable 39S ribosomal protein L1...    238   4e-76    Fragaria vesca subsp. vesca
ref|XP_010090868.1|  50S ribosomal protein L17                          238   4e-76    
ref|XP_002456607.1|  hypothetical protein SORBIDRAFT_03g039290          234   2e-74    Sorghum bicolor [broomcorn]
ref|NP_001150751.1|  LOC100284384                                       232   9e-74    Zea mays [maize]
gb|ACF85088.1|  unknown                                                 232   2e-73    Zea mays [maize]
gb|ACG40240.1|  50S ribosomal protein L17                               230   7e-73    Zea mays [maize]
gb|ACG35970.1|  50S ribosomal protein L17                               223   5e-70    Zea mays [maize]
ref|XP_009766669.1|  PREDICTED: 50S ribosomal protein L17, chloro...    214   3e-67    Nicotiana sylvestris
ref|XP_008655059.1|  PREDICTED: LOC100284384 isoform X1                 212   4e-66    Zea mays [maize]
ref|XP_006394129.1|  hypothetical protein EUTSA_v10005089mg             211   1e-65    Eutrema salsugineum [saltwater cress]
gb|KCW62282.1|  hypothetical protein EUGRSUZ_H049412                    204   3e-63    Eucalyptus grandis [rose gum]
ref|XP_010937968.1|  PREDICTED: probable 39S ribosomal protein L1...    198   2e-60    Elaeis guineensis
ref|XP_010424710.1|  PREDICTED: probable 39S ribosomal protein L1...    197   2e-59    
dbj|BAB09535.1|  50S ribosomal protein L17                              192   2e-58    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001055758.1|  Os05g0460700                                       192   8e-58    
gb|AAT39169.1|  putative 50S ribsomal protein L17                       192   2e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001775616.1|  predicted protein                                  187   5e-56    
gb|EMS49654.1|  50S ribosomal protein L17                               184   3e-55    Triticum urartu
ref|XP_003630831.1|  50S ribosomal protein L17                          187   5e-53    
gb|KDO58349.1|  hypothetical protein CISIN_1g0313082mg                  169   9e-50    Citrus sinensis [apfelsine]
ref|XP_005645443.1|  ribosomal protein L17                              169   7e-49    Coccomyxa subellipsoidea C-169
ref|XP_005849683.1|  hypothetical protein CHLNCDRAFT_17719              164   8e-48    Chlorella variabilis
gb|EMT26656.1|  Riboflavin biosynthesis protein ribBA, chloroplastic    177   9e-48    
gb|KJB14704.1|  hypothetical protein B456_002G138500                    157   2e-45    Gossypium raimondii
ref|XP_007512842.1|  50S ribosomal protein L17                          155   1e-43    Bathycoccus prasinos
ref|XP_009409623.1|  PREDICTED: LOW QUALITY PROTEIN: probable 39S...    151   4e-43    
ref|XP_002500495.1|  predicted protein                                  149   6e-41    Micromonas commoda
gb|EMS61388.1|  50S ribosomal protein L17                               141   1e-38    Triticum urartu
ref|XP_002946893.1|  mitochondrial ribosomal protein L17                137   2e-36    Volvox carteri f. nagariensis
ref|XP_005539469.1|  mitochondrial ribosomal protein L17 precursor      135   3e-36    Cyanidioschyzon merolae strain 10D
ref|XP_008875357.1|  ribosomal protein L17                              134   9e-36    Aphanomyces invadans
gb|KDD74995.1|  ribosomal protein L17                                   131   8e-35    Helicosporidium sp. ATCC 50920
ref|XP_001702909.1|  mitochondrial ribosomal protein L17                131   9e-35    Chlamydomonas reinhardtii
ref|XP_002996979.1|  50S ribosomal protein L17, putative                131   2e-34    Phytophthora infestans T30-4
gb|EMT03307.1|  hypothetical protein F775_52218                         138   3e-34    
gb|ABD51937.1|  chloroplast 50S ribosomal protein 17                    133   5e-34    Guillardia theta
ref|WP_028580614.1|  50S ribosomal protein L17                          129   6e-34    Desulfobulbus japonicus
emb|CCQ74581.1|  50S ribosomal subunit protein L17                      129   7e-34    Magnetospira sp. QH-2
ref|WP_010943458.1|  50S ribosomal protein L17                          130   7e-34    Geobacter sulfurreducens
ref|XP_011396884.1|  50S ribosomal protein L17                          129   8e-34    Auxenochlorella protothecoides
gb|EWM27294.1|  ribosomal protein l17                                   129   1e-33    Nannochloropsis gaditana
ref|XP_005829561.1|  hypothetical protein GUITHDRAFT_158129             133   1e-33    Guillardia theta CCMP2712
ref|XP_009531485.1|  Mitochondrial/chloroplast ribosomal protein L17    129   2e-33    Phytophthora sojae
ref|XP_008893619.1|  ribosomal protein L17                              128   2e-33    Phytophthora parasitica INRA-310
ref|XP_009830689.1|  ribosomal protein L17                              127   2e-33    Aphanomyces astaci
ref|XP_008620271.1|  50S ribosomal protein L17                          127   3e-33    Saprolegnia diclina VS20
ref|WP_027983566.1|  50S ribosomal protein L17                          129   4e-33    
ref|WP_028585161.1|  50S ribosomal protein L17                          127   5e-33    Desulfobulbus mediterraneus
ref|WP_039646455.1|  50S ribosomal protein L17                          128   5e-33    Geobacter
ref|WP_011712551.1|  50S ribosomal protein L17                          126   7e-33    Magnetococcus marinus
ref|WP_013163647.1|  50S ribosomal protein L17                          126   9e-33    Desulfurivibrio alkaliphilus
ref|WP_019374700.1|  50S ribosomal protein L17                          125   2e-32    Melaminivora alkalimesophila
ref|WP_013902949.1|  50S ribosomal protein L17                          124   3e-32    Ramlibacter tataouinensis
ref|WP_028319777.1|  50S ribosomal protein L17                          124   5e-32    Desulfobulbus elongatus
ref|XP_002961732.1|  hypothetical protein SELMODRAFT_76301              124   6e-32    
ref|WP_011734650.1|  50S ribosomal protein L17                          123   1e-31    Pelobacter propionicus
ref|WP_015723532.1|  50S ribosomal protein L17                          123   1e-31    
ref|WP_006001494.1|  50S ribosomal protein L17                          122   2e-31    Desulfuromonas acetoxidans
emb|CCA20129.1|  50S ribosomal protein L17 putative                     123   2e-31    Albugo laibachii Nc14
ref|WP_015719200.1|  50S ribosomal protein L17                          123   3e-31    Geobacter sp. M18
ref|WP_027101763.1|  50S ribosomal protein L17                          122   3e-31    Comamonadaceae bacterium URHA0028
ref|XP_003056069.1|  predicted protein                                  121   3e-31    Micromonas pusilla CCMP1545
ref|WP_044399292.1|  50S ribosomal protein L17                          122   4e-31    Acidovorax temperans
gb|EIE77791.1|  hypothetical protein RO3G_02495                         123   5e-31    Rhizopus delemar RA 99-880
ref|WP_011698440.1|  50S ribosomal protein L17                          122   6e-31    Syntrophobacter fumaroxidans
ref|WP_022728241.1|  50S ribosomal protein L17                          121   7e-31    Fodinicurvata sediminis
ref|WP_025511807.1|  MULTISPECIES: 50S ribosomal protein L17            121   9e-31    
ref|WP_006297859.1|  50S ribosomal protein L17                          120   9e-31    Hylemonella gracilis
ref|WP_012469440.1|  50S ribosomal protein L17                          120   1e-30    Geobacter lovleyi
ref|WP_007869297.1|  50S ribosomal protein L17                          120   1e-30    Polaromonas
ref|WP_028115046.1|  50S ribosomal protein L17                          120   1e-30    Ferrimonas kyonanensis
ref|WP_018046557.1|  50S ribosomal protein L17                          122   1e-30    
ref|WP_013706393.1|  50S ribosomal protein L17                          120   2e-30    Desulfobacca acetoxidans
ref|WP_015404308.1|  50S ribosomal protein L17                          120   2e-30    Desulfocapsa sulfexigens
ref|WP_026988126.1|  50S ribosomal protein L17                          120   2e-30    Fodinicurvata fenggangensis
ref|WP_004514262.1|  50S ribosomal protein L17                          121   2e-30    Geobacter metallireducens
ref|WP_019561691.1|  50S ribosomal protein L17                          120   2e-30    Caldimonas
ref|WP_023055879.1|  50S ribosomal protein L17                          119   2e-30    Peptoniphilus sp. BV3C26
ref|WP_012529394.1|  50S ribosomal protein L17                          120   2e-30    Geobacter bemidjiensis
ref|WP_029013628.1|  50S ribosomal protein L17                          120   2e-30    Niveispirillum irakense
ref|WP_035610268.1|  50S ribosomal protein L17                          119   3e-30    Hylemonella gracilis
ref|WP_039740539.1|  50S ribosomal protein L17                          120   3e-30    Geobacter pickeringii
emb|CBJ25670.1|  chloroplast 50S ribosomal protein 17                   120   4e-30    Ectocarpus siliculosus
ref|XP_009497965.1|  50S ribosomal protein L17                          120   4e-30    Fonticula alba
ref|WP_024078322.1|  50S ribosomal protein L17                          119   4e-30    Magnetospirillum gryphiswaldense
ref|WP_025596262.1|  50S ribosomal protein L17                          119   4e-30    
ref|WP_005583215.1|  50S ribosomal protein L17                          118   5e-30    [Clostridium] ultunense
gb|EPB87720.1|  50S ribosomal protein L17                               120   5e-30    Mucor circinelloides f. circinelloides 1006PhL
ref|WP_013723136.1|  50S ribosomal protein L17                          119   5e-30    Alicycliphilus denitrificans
ref|WP_011938021.1|  50S ribosomal protein L17                          120   5e-30    Geobacter uraniireducens
emb|CCI50312.1|  unnamed protein product                                119   5e-30    Albugo candida
dbj|GAN06490.1|  50S ribosomal protein L17                              120   5e-30    Mucor ambiguus
emb|CDS06597.1|  hypothetical protein LRAMOSA09125                      120   5e-30    Lichtheimia ramosa
emb|CEP17772.1|  hypothetical protein                                   120   7e-30    Parasitella parasitica
ref|WP_015838537.1|  50S ribosomal protein L17                          119   7e-30    Geobacter sp. M21
ref|WP_022314327.1|  50S ribosomal protein L17                          119   8e-30    
ref|WP_026842549.1|  50S ribosomal protein L17                          119   9e-30    Geobacter bremensis
ref|WP_014112117.1|  50S ribosomal protein L17                          118   9e-30    Taylorella asinigenitalis
ref|WP_028110681.1|  50S ribosomal protein L17                          118   9e-30    Ferrimonas futtsuensis
ref|WP_013743930.1|  50S ribosomal protein L17                          118   1e-29    Pusillimonas sp. T7-7
ref|WP_005663400.1|  MULTISPECIES: 50S ribosomal protein L17            118   1e-29    Massilia
dbj|BAQ17724.1|  LSU ribosomal protein L17p                             118   1e-29    Methyloceanibacter caenitepidi
ref|WP_031408875.1|  50S ribosomal protein L17                          118   1e-29    Thiomonas sp. FB-Cd
ref|WP_012648667.1|  50S ribosomal protein L17                          119   1e-29    Geobacter daltonii
ref|WP_029706486.1|  50S ribosomal protein L17                          118   1e-29    Rhodoferax saidenbachensis
ref|WP_011481469.1|  50S ribosomal protein L17                          118   1e-29    Polaromonas sp. JS666
ref|WP_015551158.1|  50S ribosomal protein L17                          118   1e-29    Taylorella asinigenitalis
ref|WP_009541249.1|  50S ribosomal protein L17                          118   1e-29    Caenispirillum salinarum
ref|WP_014344630.1|  50S ribosomal protein L17                          117   2e-29    
ref|WP_011803868.1|  MULTISPECIES: 50S ribosomal protein L17            117   2e-29    Comamonadaceae
ref|WP_011830990.1|  MULTISPECIES: 50S ribosomal protein L17            117   2e-29    Methylibium
ref|WP_026354947.1|  50S ribosomal protein L17                          117   2e-29    Massilia niastensis
ref|WP_028481914.1|  50S ribosomal protein L17                          118   2e-29    Nesiotobacter exalbescens
ref|WP_025725598.1|  50S ribosomal protein L17                          117   2e-29    Acholeplasma granularum
ref|WP_012565958.1|  50S ribosomal protein L17                          118   2e-29    Rhodospirillum centenum
ref|WP_009855685.1|  50S ribosomal protein L17                          117   2e-29    Rubrivivax benzoatilyticus
ref|WP_011286114.1|  50S ribosomal protein L17                          117   2e-29    Dechloromonas aromatica
ref|WP_005906828.1|  MULTISPECIES: 50S ribosomal protein L17            117   2e-29    Fusobacterium
ref|WP_044665971.1|  50S ribosomal protein L17                          117   2e-29    Syntrophaceticus schinkii
ref|WP_028355423.1|  50S ribosomal protein L17                          117   2e-29    Bordetella
ref|WP_009514907.1|  MULTISPECIES: 50S ribosomal protein L17            117   2e-29    Hydrogenophaga
ref|WP_019902404.1|  50S ribosomal protein L17                          117   2e-29    
ref|WP_027289377.1|  50S ribosomal protein L17                          117   2e-29    Rhodovibrio salinarum
ref|WP_013382256.1|  50S ribosomal protein L17                          117   2e-29    Clostridiales
ref|WP_028557468.1|  50S ribosomal protein L17                          117   2e-29    Paenibacillus sp. URHA0014
ref|WP_025872384.1|  50S ribosomal protein L17                          117   2e-29    Methylobacillus glycogenes
ref|WP_028854827.1|  50S ribosomal protein L17                          117   2e-29    Psychrilyobacter atlanticus
ref|WP_006116036.1|  MULTISPECIES: 50S ribosomal protein L17            117   3e-29    Acetobacter
ref|WP_023406308.1|  50S ribosomal protein L17                          117   3e-29    
ref|WP_005350112.1|  MULTISPECIES: 50S ribosomal protein L17            117   3e-29    Aeromonas
ref|WP_014426578.1|  50S ribosomal protein L17                          117   3e-29    Rubrivivax gelatinosus
ref|WP_014015763.1|  MULTISPECIES: 50S ribosomal protein L17            116   3e-29    Megasphaera
emb|CBA31527.1|  50S ribosomal protein L17                              117   3e-29    Curvibacter putative symbiont of Hydra magnipapillata
ref|WP_038501174.1|  50S ribosomal protein L17                          117   3e-29    Basilea psittacipulmonis
ref|WP_011390413.1|  50S ribosomal protein L17                          117   3e-29    Rhodospirillum rubrum
ref|WP_037445251.1|  50S ribosomal protein L17                          117   3e-29    Shewanella mangrovi
ref|WP_013520733.1|  50S ribosomal protein L17                          117   3e-29    Alicycliphilus
ref|WP_037485050.1|  50S ribosomal protein L17                          117   3e-29    Sphaerotilus natans
ref|WP_015827891.1|  50S ribosomal protein L17                          117   3e-29    Hirschia baltica
ref|WP_012812772.1|  50S ribosomal protein L17                          117   3e-29    Acetobacter pasteurianus
ref|WP_014840642.1|  50S ribosomal protein L17                          117   3e-29    Taylorella equigenitalis
ref|WP_029196442.1|  50S ribosomal protein L17                          116   4e-29    Paenibacillus
ref|WP_013521704.1|  50S ribosomal protein L17                          117   4e-29    Taylorella equigenitalis
ref|XP_005756603.1|  mitochondrial ribosomal protein L17                116   4e-29    Emiliania huxleyi CCMP1516
ref|WP_024048912.1|  50S ribosomal protein L17                          116   4e-29    Negativicoccus massiliensis
ref|WP_036240376.1|  50S ribosomal protein L17                          117   4e-29    Massilia sp. JS1662
ref|WP_008945184.1|  50S ribosomal protein L17                          117   4e-29    Oceanibaculum indicum
ref|WP_025860218.1|  50S ribosomal protein L17                          117   4e-29    Acetobacter papayae
ref|WP_019090056.1|  50S ribosomal protein L17                          117   4e-29    Acetobacter
ref|WP_018995992.1|  50S ribosomal protein L17                          117   4e-29    Hirschia maritima
ref|WP_028601641.1|  50S ribosomal protein L17                          116   4e-29    Ottowia thiooxydans
ref|WP_043810870.1|  50S ribosomal protein L17                          116   4e-29    Rubrivivax gelatinosus
gb|AFK40244.1|  unknown                                                 117   5e-29    Lotus japonicus
gb|EIE89565.1|  hypothetical protein RO3G_14276                         118   5e-29    Rhizopus delemar RA 99-880
ref|WP_034109565.1|  50S ribosomal protein L17                          116   5e-29    
ref|WP_026637580.1|  50S ribosomal protein L17                          116   5e-29    Duganella
ref|WP_044505149.1|  50S ribosomal protein L17                          115   5e-29    Megasphaera massiliensis
ref|WP_014752483.1|  MULTISPECIES: 50S ribosomal protein L17            116   5e-29    Alcaligenaceae
ref|WP_008540452.1|  50S ribosomal protein L17                          116   6e-29    Sutterella parvirubra
ref|WP_020376669.1|  50S ribosomal protein L17                          115   6e-29    Sulfobacillus thermosulfidooxidans
ref|WP_025495801.1|  50S ribosomal protein L17                          116   6e-29    
ref|XP_009621221.1|  PREDICTED: 50S ribosomal protein L17, chloro...    118   6e-29    Nicotiana tomentosiformis
ref|WP_007419207.1|  50S ribosomal protein L17                          116   6e-29    Idiomarina sp. A28L
ref|WP_007644470.1|  MULTISPECIES: 50S ribosomal protein L17            116   6e-29    Shewanella
ref|WP_023053331.1|  50S ribosomal protein L17                          115   7e-29    Megasphaera
ref|WP_042679510.1|  50S ribosomal protein L17                          115   7e-29    Anaerosalibacter massiliensis
ref|WP_005903918.1|  50S ribosomal protein L17                          115   7e-29    Fusobacterium
gb|EKE17428.1|  50S ribosomal protein L17                               116   7e-29    uncultured bacterium
ref|WP_011459109.1|  50S ribosomal protein L17                          115   7e-29    Desulfitobacterium hafniense
ref|WP_036806689.1|  50S ribosomal protein L17                          116   7e-29    Polaromonas sp. CG9_12
ref|WP_031597176.1|  50S ribosomal protein L17                          116   7e-29    Ferrovum
ref|WP_011621033.1|  MULTISPECIES: 50S ribosomal protein L17            116   7e-29    Shewanella
ref|WP_026435316.1|  50S ribosomal protein L17                          116   7e-29    Acidovorax sp. JHL-9
ref|WP_014746122.1|  50S ribosomal protein L17                          116   8e-29    Tistrella mobilis
ref|WP_011478673.1|  50S ribosomal protein L17                          115   8e-29    Methylobacillus flagellatus
ref|WP_018084576.1|  50S ribosomal protein L17                          115   8e-29    Desulfurispora thermophila
ref|WP_017758446.1|  50S ribosomal protein L17                          115   8e-29    Pseudacidovorax intermedius
ref|WP_035528337.1|  50S ribosomal protein L17                          116   8e-29    Hoeflea sp. BAL378
ref|WP_022073101.1|  50S ribosomal protein L17                          115   8e-29    
ref|WP_029526385.1|  50S ribosomal protein L17                          115   9e-29    Polaromonas glacialis
ref|WP_011466461.1|  50S ribosomal protein L17                          115   9e-29    Rhodoferax ferrireducens
ref|WP_026781243.1|  50S ribosomal protein L17                          115   9e-29    Polaromonas sp. EUR3 1.2.1
gb|EKF06413.1|  50S ribosomal protein L17                               116   9e-29    Thalassospira profundimaris WP0211
ref|WP_005434304.1|  50S ribosomal protein L17                          115   9e-29    Sutterella
ref|WP_025811595.1|  50S ribosomal protein L17                          116   9e-29    Komagataeibacter kakiaceti
ref|WP_004820380.1|  50S ribosomal protein L17                          115   1e-28    Peptoniphilus
ref|WP_008906513.1|  MULTISPECIES: 50S ribosomal protein L17            115   1e-28    Acidovorax
ref|WP_013593080.1|  MULTISPECIES: 50S ribosomal protein L17            115   1e-28    Acidovorax
ref|WP_011799774.1|  50S ribosomal protein L17                          115   1e-28    Polaromonas naphthalenivorans
ref|WP_005793668.1|  50S ribosomal protein L17                          115   1e-28    Acidovorax delafieldii
ref|WP_037466489.1|  50S ribosomal protein L17                          115   1e-28    
gb|ADZ70191.1|  50S ribosomal protein L17                               116   1e-28    Polymorphum gilvum SL003B-26A1
ref|WP_022850591.1|  50S ribosomal protein L17                          115   1e-28    Geovibrio sp. L21-Ace-BES
ref|WP_013388215.1|  50S ribosomal protein L17                          115   1e-28    Ilyobacter polytropus
ref|WP_009221329.1|  MULTISPECIES: 50S ribosomal protein L17            115   1e-28    
ref|WP_008855777.1|  50S ribosomal protein L17                          115   1e-28    
ref|WP_038201941.1|  50S ribosomal protein L17                          115   1e-28    
dbj|BAO79900.1|  ribosomal protein L17                                  115   1e-28    
ref|WP_012348922.1|  50S ribosomal protein L17                          115   1e-28    
emb|CEG70381.1|  Putative 50S ribosomal protein L17                     117   1e-28    
ref|WP_008900984.1|  MULTISPECIES: 50S ribosomal protein L17            114   1e-28    
ref|WP_024001165.1|  50S ribosomal protein L17                          115   1e-28    
ref|WP_037557327.1|  50S ribosomal protein L17                          115   1e-28    
ref|WP_007424198.1|  MULTISPECIES: 50S ribosomal protein L17            115   1e-28    
ref|WP_027276757.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_028994211.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_009736763.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_038484690.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_023949347.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_034302855.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_026688022.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_027456653.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_017235783.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_030004144.1|  50S ribosomal protein L17                          114   2e-28    
ref|WP_029461336.1|  50S ribosomal protein L17                          115   2e-28    
gb|KIY97354.1|  50S ribosomal protein L17                               124   2e-28    
ref|WP_028833792.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_007875352.1|  MULTISPECIES: 50S ribosomal protein L17            115   2e-28    
ref|WP_028250817.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_009209711.1|  MULTISPECIES: 50S ribosomal protein L17            115   2e-28    
ref|WP_028988533.1|  50S ribosomal protein L17                          114   2e-28    
gb|KIK93645.1|  hypothetical protein PAXRUDRAFT_828746                  119   2e-28    
ref|WP_022819895.1|  50S ribosomal protein L17                          114   2e-28    
ref|WP_019646020.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_026358888.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_029604160.1|  50S ribosomal protein L17                          115   2e-28    
ref|WP_013451598.1|  50S ribosomal protein L17                          114   2e-28    
ref|WP_042019386.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_012327238.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_015905414.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_019196603.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_014792411.1|  MULTISPECIES: 50S ribosomal protein L17            114   3e-28    
ref|WP_028107296.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_006021046.1|  MULTISPECIES: 50S ribosomal protein L17            114   3e-28    
ref|WP_011863991.1|  MULTISPECIES: 50S ribosomal protein L17            114   3e-28    
ref|WP_005502465.1|  MULTISPECIES: 50S ribosomal protein L17            114   3e-28    
ref|WP_014262811.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_012562859.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_025826922.1|  50S ribosomal protein L17                          114   3e-28    
emb|CDZ75232.1|  ribosomal protein L17                                  114   3e-28    
ref|WP_002712276.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_014004420.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_038496992.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_008444345.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_022194467.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_028997273.1|  50S ribosomal protein L17                          114   3e-28    
gb|EJK54195.1|  hypothetical protein THAOC_26239                        115   3e-28    
ref|WP_005917973.1|  50S ribosomal protein L17                          114   3e-28    
ref|WP_006083573.1|  50S ribosomal protein L17                          114   4e-28    
ref|WP_021951171.1|  50S ribosomal protein L17                          113   4e-28    
ref|WP_032847213.1|  50S ribosomal protein L17                          114   4e-28    
ref|WP_008113128.1|  50S ribosomal protein L17                          114   4e-28    
ref|WP_033073812.1|  50S ribosomal protein L17                          114   4e-28    
ref|WP_015829266.1|  MULTISPECIES: 50S ribosomal protein L17            114   4e-28    
ref|WP_043835430.1|  50S ribosomal protein L17                          114   4e-28    
ref|WP_028258418.1|  50S ribosomal protein L17                          114   4e-28    
ref|WP_003806934.1|  MULTISPECIES: 50S ribosomal protein L17            114   4e-28    
ref|WP_016962034.1|  50S ribosomal protein L17                          114   4e-28    
ref|WP_040307251.1|  50S ribosomal protein L17                          114   4e-28    
ref|WP_005017352.1|  MULTISPECIES: 50S ribosomal protein L17            114   4e-28    
ref|WP_005969138.1|  MULTISPECIES: 50S ribosomal protein L17            113   4e-28    
gb|AJD51344.1|  50S ribosomal protein L17                               114   4e-28    
ref|WP_011793802.1|  50S ribosomal protein L17                          114   5e-28    
ref|WP_026959583.1|  MULTISPECIES: 50S ribosomal protein L17            114   5e-28    
ref|WP_012415764.1|  50S ribosomal protein L17                          114   5e-28    
ref|WP_008802319.1|  50S ribosomal protein L17                          113   5e-28    
ref|WP_037513887.1|  50S ribosomal protein L17                          114   5e-28    
ref|WP_015836265.1|  50S ribosomal protein L17                          114   5e-28    
ref|WP_027128737.1|  50S ribosomal protein L17                          113   5e-28    
ref|WP_017009811.1|  50S ribosomal protein L17                          114   5e-28    
ref|WP_004181019.1|  50S ribosomal protein L17                          114   5e-28    
ref|WP_019429282.1|  50S ribosomal protein L17                          114   5e-28    
ref|WP_005891359.1|  MULTISPECIES: 50S ribosomal protein L17            113   5e-28    
ref|WP_013176350.1|  50S ribosomal protein L17                          113   6e-28    
ref|WP_009341031.1|  50S ribosomal protein L17                          114   6e-28    
ref|WP_039709672.1|  50S ribosomal protein L17                          113   6e-28    
ref|WP_019937361.1|  50S ribosomal protein L17                          113   6e-28    
ref|WP_008334167.1|  MULTISPECIES: 50S ribosomal protein L17            114   6e-28    
ref|WP_007861737.1|  50S ribosomal protein L17                          114   6e-28    
dbj|BAO82279.1|  ribosomal protein L17                                  114   6e-28    
ref|WP_024746891.1|  50S ribosomal protein L17                          113   6e-28    
ref|WP_034777008.1|  50S ribosomal protein L17                          114   6e-28    
gb|AEH22883.1|  50S ribosomal protein L17                               114   6e-28    
ref|WP_011641678.1|  50S ribosomal protein L17                          113   6e-28    
ref|WP_024813864.1|  50S ribosomal protein L17                          113   6e-28    
ref|WP_009124828.1|  50S ribosomal protein L17                          113   6e-28    
dbj|GAM23116.1|  hypothetical protein SAMD00019534_062910               115   6e-28    
ref|WP_029134289.1|  50S ribosomal protein L17                          113   6e-28    
ref|WP_025136324.1|  MULTISPECIES: 50S ribosomal protein L17            113   6e-28    
ref|WP_007716290.1|  50S ribosomal protein L17                          113   6e-28    
ref|WP_024538816.1|  50S ribosomal protein L17                          113   6e-28    
ref|WP_036172232.1|  50S ribosomal protein L17                          113   6e-28    
ref|WP_026334876.1|  50S ribosomal protein L17                          113   6e-28    
gb|EFO29202.1|  ribosomal protein L17                                   114   7e-28    
ref|WP_006943152.1|  50S ribosomal protein L17                          113   7e-28    
ref|WP_008810446.1|  MULTISPECIES: 50S ribosomal protein L17            113   7e-28    
ref|WP_022231098.1|  50S ribosomal protein L17                          113   7e-28    
ref|WP_006216513.1|  MULTISPECIES: 50S ribosomal protein L17            113   7e-28    
ref|WP_006389635.1|  MULTISPECIES: 50S ribosomal protein L17            113   7e-28    
ref|XP_009797179.1|  PREDICTED: 50S ribosomal protein L17, chloro...    115   7e-28    
emb|CEN55320.1|  50S ribosomal protein L17                              113   7e-28    
ref|WP_026067853.1|  50S ribosomal protein L17                          113   7e-28    
ref|WP_019006392.1|  50S ribosomal protein L17                          113   7e-28    
ref|WP_002541538.1|  50S ribosomal protein L17                          113   7e-28    
ref|WP_028774683.1|  50S ribosomal protein L17                          113   7e-28    
ref|WP_017247058.1|  50S ribosomal protein L17                          113   7e-28    
ref|WP_034471633.1|  50S ribosomal protein L17                          113   7e-28    
ref|WP_006464908.1|  50S ribosomal protein L17                          113   7e-28    
ref|WP_025514330.1|  50S ribosomal protein L17                          113   7e-28    
ref|WP_005583478.1|  50S ribosomal protein L17                          113   8e-28    
ref|WP_026320498.1|  50S ribosomal protein L17                          113   8e-28    
ref|WP_035038422.1|  MULTISPECIES: 50S ribosomal protein L17            114   8e-28    
ref|WP_025236908.1|  50S ribosomal protein L17                          113   8e-28    
ref|WP_039576662.1|  50S ribosomal protein L17                          113   8e-28    
ref|WP_025588618.1|  50S ribosomal protein L17                          113   8e-28    
ref|WP_028781249.1|  MULTISPECIES: 50S ribosomal protein L17            113   8e-28    
ref|WP_017969411.1|  MULTISPECIES: 50S ribosomal protein L17            114   8e-28    
ref|WP_043364838.1|  50S ribosomal protein L17                          113   8e-28    
ref|WP_003391928.1|  50S ribosomal protein L17                          112   8e-28    
ref|WP_015064753.1|  50S ribosomal protein L17                          113   8e-28    
ref|WP_042648860.1|  50S ribosomal protein L17                          113   9e-28    
ref|WP_005307999.1|  MULTISPECIES: 50S ribosomal protein L17            113   9e-28    
ref|WP_026397272.1|  50S ribosomal protein L17                          113   9e-28    
ref|WP_013728479.1|  50S ribosomal protein L17                          113   9e-28    
ref|WP_028452731.1|  50S ribosomal protein L17                          113   9e-28    
ref|WP_012144626.1|  50S ribosomal protein L17                          113   9e-28    
ref|WP_019427459.1|  50S ribosomal protein L17                          113   9e-28    
ref|WP_016452003.1|  50S ribosomal protein L17                          113   9e-28    
ref|WP_028461296.1|  50S ribosomal protein L17                          113   9e-28    
ref|WP_007197136.1|  50S ribosomal protein L17                          113   9e-28    
ref|WP_044585715.1|  50S ribosomal protein L17                          113   9e-28    
ref|WP_021024489.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_029101044.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_015253317.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_025917965.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_016856733.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_011314661.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_034933165.1|  MULTISPECIES: 50S ribosomal protein L17            113   1e-27    
ref|WP_039406335.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_007255191.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_007392381.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_022366097.1|  50S ribosomal protein L17                          112   1e-27    
ref|XP_010678420.1|  PREDICTED: 50S ribosomal protein L17, chloro...    115   1e-27    
ref|WP_002715394.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_012282501.1|  50S ribosomal protein L17                          112   1e-27    
gb|KJC34650.1|  50S ribosomal protein L17                               113   1e-27    
ref|WP_029495050.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_028101642.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_005885943.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_010506694.1|  MULTISPECIES: 50S ribosomal protein L17            113   1e-27    
gb|KDQ63634.1|  hypothetical protein JAAARDRAFT_29660                   117   1e-27    
ref|WP_043700258.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_005956144.1|  50S ribosomal protein L17                          112   1e-27    
ref|XP_006366797.1|  PREDICTED: 50S ribosomal protein L17, chloro...    115   1e-27    
ref|WP_028820145.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_005708118.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_005705993.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_038383101.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_026962560.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_027718568.1|  50S ribosomal protein L17                          112   1e-27    
ref|XP_004242470.1|  PREDICTED: 50S ribosomal protein L17, chloro...    115   1e-27    
ref|WP_015874199.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_005417273.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_007525756.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_025042184.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_010513067.1|  MULTISPECIES: 50S ribosomal protein L17            113   1e-27    
ref|XP_004242471.1|  PREDICTED: 50S ribosomal protein L17, chloro...    115   1e-27    
ref|WP_041514904.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_039163438.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_029168327.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_024575013.1|  MULTISPECIES: 50S ribosomal protein L17            113   1e-27    
ref|WP_013544103.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_005878814.1|  50S ribosomal protein L17                          112   1e-27    
gb|KJC40651.1|  50S ribosomal protein L17                               113   1e-27    
ref|WP_013745939.1|  MULTISPECIES: 50S ribosomal protein L17            112   1e-27    
ref|WP_007778494.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_044538563.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_005818715.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_010669147.1|  50S ribosomal protein L17                          113   1e-27    
ref|XP_006366798.1|  PREDICTED: 50S ribosomal protein L17, chloro...    114   1e-27    
ref|WP_028448416.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_022187474.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_026639670.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_029009724.1|  50S ribosomal protein L17                          113   1e-27    
ref|WP_041430585.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_009111220.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_025674303.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_009148338.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_011201180.1|  50S ribosomal protein L17 [                        112   1e-27    
ref|WP_026285360.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_007226641.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_005970246.1|  MULTISPECIES: 50S ribosomal protein L17            112   1e-27    
ref|WP_025822070.1|  50S ribosomal protein L17                          112   1e-27    
ref|WP_028077836.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_031472196.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_041972898.1|  50S ribosomal protein L17                          114   2e-27    
ref|WP_026032924.1|  MULTISPECIES: 50S ribosomal protein L17            113   2e-27    
ref|WP_033094756.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_035036289.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_044833213.1|  50S ribosomal protein L17                          112   2e-27    
ref|XP_009631246.1|  PREDICTED: 50S ribosomal protein L17, chloro...    114   2e-27    
ref|WP_006525031.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_005759610.1|  MULTISPECIES: 50S ribosomal protein L17            112   2e-27    
gb|KFH66393.1|  large subunit ribosomal protein L17                     115   2e-27    
ref|WP_034437559.1|  50S ribosomal protein L17                          112   2e-27    
gb|KIJ21671.1|  hypothetical protein PAXINDRAFT_159723                  116   2e-27    
ref|WP_014996087.1|  MULTISPECIES: 50S ribosomal protein L17            112   2e-27    
ref|WP_022259206.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_013218512.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_013047285.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_009548432.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_005501232.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_032963113.1|  50S ribosomal protein L17                          112   2e-27    
ref|WP_012549173.1|  MULTISPECIES: 50S ribosomal protein L17            112   2e-27    
ref|WP_029043791.1|  50S ribosomal protein L17                          112   2e-27    



>gb|EYU23795.1| hypothetical protein MIMGU_mgv1a015337mg [Erythranthe guttata]
Length=160

 Score =   305 bits (781),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R+AA FVRGDDV+HKLFTELA+RYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RQAAAFVRGDDVIHKLFTELAHRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            QSKPPTPQ PQR A+DPWT+SRL+RQ APPKEE+STDS+N
Sbjct  121  QSKPPTPQPPQRAAIDPWTRSRLTRQMAPPKEERSTDSDN  160



>ref|XP_011099767.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Sesamum 
indicum]
Length=160

 Score =   302 bits (774),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R+AA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RQAAAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            QSKPP PQ PQR  +DPWT+SRL+RQFAPPKEEK ++S+N
Sbjct  121  QSKPPVPQPPQRAPLDPWTRSRLTRQFAPPKEEKESESDN  160



>ref|XP_002310514.2| ribosomal protein L17 [Populus trichocarpa]
 gb|EEE90964.2| ribosomal protein L17 [Populus trichocarpa]
Length=160

 Score =   301 bits (771),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQL+KHERIETTVAKAKE+RRLADNMVQLGKEG+LCA+
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLIKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAS  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLF+ELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVIHKLFSELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQ PQR  MDPWT+SRL+RQFAPPKEEKS+D E
Sbjct  121  QSKPPTPQPPQRAPMDPWTRSRLTRQFAPPKEEKSSDPE  159



>ref|XP_007137704.1| hypothetical protein PHAVU_009G148700g [Phaseolus vulgaris]
 gb|ESW09698.1| hypothetical protein PHAVU_009G148700g [Phaseolus vulgaris]
Length=159

 Score =   297 bits (761),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEGT CAA
Sbjct  1    MTKFRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGTQCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAASFVRGDDVIHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKS  478
            Q+KPPTPQLPQR  +DPWT+SRLSRQFAPPKEEKS
Sbjct  121  QAKPPTPQLPQRAPLDPWTRSRLSRQFAPPKEEKS  155



>ref|XP_010452976.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Camelina 
sativa]
 ref|XP_010491617.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Camelina 
sativa]
Length=160

 Score =   292 bits (748),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ PQR  +DPW +SRL+RQFAPPKEEK++DSE
Sbjct  121  QSKPATPQPPQRVPLDPWERSRLTRQFAPPKEEKTSDSE  159



>ref|XP_010520334.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Tarenaya hassleriana]
Length=160

 Score =   292 bits (747),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTKLRKL RPTGHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTL AA
Sbjct  1    MTKLRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHKLFTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKLFTELAYRYKDRAGGYTRVLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ P R  +DPW +SRL+RQ APP+EEKS+DSE
Sbjct  121  QSKPATPQPPPRVPLDPWARSRLTRQLAPPEEEKSSDSE  159



>ref|XP_002873421.1| ribosomal protein L17 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49680.1| ribosomal protein L17 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score =   292 bits (747),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTV KAKEVRRLADNMVQLGKEGTL AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVTKAKEVRRLADNMVQLGKEGTLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ PQR  +DPW +SRL++QFAPPKEEKS+DSE
Sbjct  121  QSKPATPQPPQRVPLDPWERSRLTKQFAPPKEEKSSDSE  159



>emb|CDP04732.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   291 bits (746),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRYKERAGGYTR+LRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RRAAAFVRGDDVIHKLFTELAYRYKERAGGYTRVLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            Q+KPPTPQ PQR  +DPWTKSRLSRQFAPPKE+KS++S++
Sbjct  121  QAKPPTPQPPQRAPLDPWTKSRLSRQFAPPKEDKSSESDS  160



>ref|XP_010422944.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Camelina 
sativa]
Length=160

 Score =   291 bits (746),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ PQR  +DPW +SRL++QFAPPKEEK++DSE
Sbjct  121  QSKPATPQPPQRVPLDPWERSRLTKQFAPPKEEKTSDSE  159



>ref|XP_006288819.1| hypothetical protein CARUB_v10002154mg [Capsella rubella]
 gb|EOA21717.1| hypothetical protein CARUB_v10002154mg [Capsella rubella]
Length=160

 Score =   291 bits (745),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTV KAKEVRRLADNMVQLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVTKAKEVRRLADNMVQLGKEGSLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ PQR  +DPW +SRL+RQFAPPKEEK++DSE
Sbjct  121  QSKPATPQPPQRVPLDPWARSRLTRQFAPPKEEKTSDSE  159



>ref|XP_010484251.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Camelina sativa]
Length=160

 Score =   287 bits (735),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTL AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA GFVRGDDVLHK+FTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAGGFVRGDDVLHKIFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ P R  +DPW +SRL+RQ+APPKEEKS+DS+
Sbjct  121  QSKPATPQPPPRVPLDPWERSRLTRQYAPPKEEKSSDSD  159



>ref|XP_011007555.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Populus 
euphratica]
Length=160

 Score =   287 bits (735),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQL+KHERIETTVAKAKE+RRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLIKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLF+E+AYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVIHKLFSEMAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQ PQR  +DPWT+SRL+RQFAPPKEEKS+D E
Sbjct  121  QSKPPTPQPPQRAPLDPWTRSRLTRQFAPPKEEKSSDPE  159



>ref|XP_010462907.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Camelina sativa]
Length=161

 Score =   287 bits (735),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTL AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA GFVRGDDVLHK+FTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAGGFVRGDDVLHKIFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            QSKP TPQ P R  +DPW +SRL+RQ+APPKEEKS+DS +
Sbjct  121  QSKPATPQPPPRVPLDPWERSRLTRQYAPPKEEKSSDSAD  160



>ref|XP_002866626.1| ribosomal protein L17 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42885.1| ribosomal protein L17 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score =   286 bits (733),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ P R  +DPW +SRL+RQ+APPKEEKS DS+
Sbjct  121  QSKPATPQPPPRVPLDPWARSRLTRQYAPPKEEKSWDSD  159



>ref|XP_010444404.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Camelina sativa]
Length=160

 Score =   286 bits (732),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA GFVRGDDVLHK+FTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAGGFVRGDDVLHKIFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ P R  +DPW +SRL+RQ+APPKEEKS+DS+
Sbjct  121  QSKPATPQPPPRVPLDPWERSRLTRQYAPPKEEKSSDSD  159



>ref|XP_006281236.1| hypothetical protein CARUB_v10027279mg [Capsella rubella]
 gb|EOA14134.1| hypothetical protein CARUB_v10027279mg [Capsella rubella]
Length=160

 Score =   286 bits (732),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTV KAKEVRRLADNMVQLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVTKAKEVRRLADNMVQLGKEGSLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ P R  +DPW +SRL+RQ+APPKEEKS+DS+
Sbjct  121  QSKPATPQPPPRVPLDPWERSRLTRQYAPPKEEKSSDSD  159



>ref|XP_004245242.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Solanum 
lycopersicum]
Length=160

 Score =   286 bits (731),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQ GKEGTLCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQFGKEGTLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R+AA FVRGDDV+HKLFTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RQAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPP PQ PQRPAMDPWT+SRLSRQFAPPKEEK +DS+
Sbjct  121  QSKPPNPQPPQRPAMDPWTRSRLSRQFAPPKEEKISDSD  159



>ref|NP_568216.1| ribosomal protein L17 family protein [Arabidopsis thaliana]
 gb|AAM64301.1| ribsomal protein-like [Arabidopsis thaliana]
 gb|AAO24540.1| At5g09770 [Arabidopsis thaliana]
 dbj|BAF00072.1| ribsomal protein - like [Arabidopsis thaliana]
 gb|AED91444.1| ribosomal protein L17 family protein [Arabidopsis thaliana]
Length=160

 Score =   286 bits (731),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTV KAKEVRRLADNM+QLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVTKAKEVRRLADNMIQLGKEGSLSAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELA+RYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAHRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ PQR  +DPW +SRL+RQFAPPKEEK  DSE
Sbjct  121  QSKPATPQPPQRVPLDPWERSRLTRQFAPPKEEKIPDSE  159



>ref|XP_002307023.1| ribosomal protein L17 [Populus trichocarpa]
 gb|EEE94019.1| ribosomal protein L17 [Populus trichocarpa]
Length=160

 Score =   286 bits (731),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRT+VSQL+KHERIETTVAKAKE+RRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTLVSQLIKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLF+E+AYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVIHKLFSEMAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQ PQR  +DPWT+SRL+RQFAPPKEEKS+D E
Sbjct  121  QSKPPTPQPPQRAPLDPWTRSRLTRQFAPPKEEKSSDPE  159



>gb|KJB16008.1| hypothetical protein B456_002G208300 [Gossypium raimondii]
Length=160

 Score =   285 bits (730),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R AA FVRGDDV+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RHAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQ PQRP++DPWT+SRLSRQFAPPKEEKS++SE
Sbjct  121  QSKPPTPQPPQRPSLDPWTRSRLSRQFAPPKEEKSSESE  159



>ref|XP_009616322.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=160

 Score =   285 bits (730),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+L AA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLSAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R+AA FVRGDDV+HKLFTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RQAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPP PQ PQRPAMDPWT+SRLSRQFAPPKEEKS+DS+
Sbjct  121  QSKPPNPQPPQRPAMDPWTRSRLSRQFAPPKEEKSSDSD  159



>gb|KHN31132.1| 50S ribosomal protein L17 [Glycine soja]
Length=159

 Score =   285 bits (729),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+  AA
Sbjct  1    MTKFRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSQHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAASFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKS  478
            Q+K PTPQ PQR  +DPWT+SRLSRQFAPPKE+KS
Sbjct  121  QAKAPTPQPPQRAPLDPWTRSRLSRQFAPPKEDKS  155



>ref|XP_010245813.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
isoform X2 [Nelumbo nucifera]
Length=160

 Score =   285 bits (729),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAA MAYIEFIDRENELR
Sbjct  61   RRASAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAEMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            QSKP TPQ P R  +DPWT+SRLS+Q APPKE+ S+ S++
Sbjct  121  QSKPATPQPPPRAPLDPWTRSRLSKQLAPPKEDSSSHSDS  160



>ref|XP_010690446.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=160

 Score =   285 bits (728),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGK+G+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKDGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRYK RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVIHKLFTELAYRYKGRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQLPQR  +DPWTKS+L+RQ+A PKEEK +DS 
Sbjct  121  QSKPPTPQLPQRAPLDPWTKSKLTRQYASPKEEKISDSN  159



>ref|XP_006356626.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Solanum 
tuberosum]
Length=160

 Score =   285 bits (728),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRT+VSQLVKHERIETTVAKAKEVRRLADNMVQ GKEGTLCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTLVSQLVKHERIETTVAKAKEVRRLADNMVQFGKEGTLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R+AA FVRGDDV+HKLFTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RQAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            QSKPP PQ PQRPAMDPWT+SRLSRQFAPPKEEK  DS++
Sbjct  121  QSKPPNPQPPQRPAMDPWTRSRLSRQFAPPKEEKICDSDS  160



>emb|CDY18701.1| BnaA09g06940D [Brassica napus]
Length=160

 Score =   284 bits (727),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTKLRKL R TGHR+SMLRT+VSQLVKHERIETTV KAKEVRRLADNMVQLGKEGTL AA
Sbjct  1    MTKLRKLGRHTGHRMSMLRTLVSQLVKHERIETTVTKAKEVRRLADNMVQLGKEGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDV+HK+FTE AYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVIHKIFTEFAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QS PPTPQ PQR  +DPW +SRL RQ+APPKEEK++DS+
Sbjct  121  QSNPPTPQPPQRVPLDPWARSRLMRQYAPPKEEKNSDSD  159



>ref|NP_001240907.1| uncharacterized protein LOC100785280 [Glycine max]
 gb|ACU20456.1| unknown [Glycine max]
Length=159

 Score =   283 bits (724),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+  AA
Sbjct  1    MTKFRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSQHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAASFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKS  478
            Q+K PTPQ PQR  +DPW +SRLSRQFAPPKE+KS
Sbjct  121  QAKAPTPQPPQRAPLDPWARSRLSRQFAPPKEDKS  155



>ref|XP_007048324.1| Ribosomal protein L17 family protein [Theobroma cacao]
 gb|EOX92481.1| Ribosomal protein L17 family protein [Theobroma cacao]
Length=160

 Score =   283 bits (724),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+L AA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSLSAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGD V+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDAVIHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQ PQR  +DPWTKSRLSRQFAPPKEEK+++ E
Sbjct  121  QSKPPTPQPPQRAPLDPWTKSRLSRQFAPPKEEKNSEPE  159



>ref|XP_009112146.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Brassica rapa]
Length=160

 Score =   283 bits (724),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTKLRKL R TGHR+SMLRT+VSQLVKHERIETTV KAKEVRRLADNMVQLGKEG+L AA
Sbjct  1    MTKLRKLGRHTGHRMSMLRTLVSQLVKHERIETTVTKAKEVRRLADNMVQLGKEGSLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDV+HK+FTE AYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVIHKIFTEFAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QS PPTPQ PQR  +DPW +SRL RQ+APPKEEK++DS+
Sbjct  121  QSNPPTPQPPQRVPLDPWARSRLMRQYAPPKEEKNSDSD  159



>ref|NP_001237810.1| uncharacterized protein LOC100305861 [Glycine max]
 gb|ACU13748.1| unknown [Glycine max]
 gb|KHN09594.1| 50S ribosomal protein L17 [Glycine soja]
Length=159

 Score =   283 bits (724),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+  AA
Sbjct  1    MTKFRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSQHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R+AA FVRGDDV+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RQAASFVRGDDVIHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKS  478
            Q+K PTPQ PQR  +DPWT+SRLSRQFAPPKE+KS
Sbjct  121  QAKAPTPQPPQRAPLDPWTRSRLSRQFAPPKEDKS  155



>emb|CDX81235.1| BnaC09g06460D [Brassica napus]
Length=160

 Score =   283 bits (723),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTKLRKL R TGHR+SMLRT+VSQLVKHERIETT+ KAKEVRRLADNMVQLGKEG+L AA
Sbjct  1    MTKLRKLGRHTGHRMSMLRTLVSQLVKHERIETTITKAKEVRRLADNMVQLGKEGSLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDV+HK+FTE AYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVIHKIFTEFAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QS PPTPQ PQR  +DPW +SRL RQ+APPKEEK++DS+
Sbjct  121  QSNPPTPQPPQRVPLDPWARSRLMRQYAPPKEEKNSDSD  159



>ref|XP_010546366.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Tarenaya hassleriana]
Length=163

 Score =   283 bits (723),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTKLRKL RPTGHR SMLRTM SQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTL AA
Sbjct  1    MTKLRKLGRPTGHRTSMLRTMASQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHKLFTELAYRYK+RAGGYTR+LRTRIRVGDAA MAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKLFTELAYRYKDRAGGYTRVLRTRIRVGDAASMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            QSKP TPQ P R  MDPW +S  + QFAPPKEEKS DS +
Sbjct  121  QSKPATPQPPPRVPMDPWARSHFTCQFAPPKEEKSLDSSD  160



>ref|XP_010244019.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Nelumbo nucifera]
Length=160

 Score =   282 bits (721),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R AA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAA MAYIEFIDRENELR
Sbjct  61   RCAAAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAEMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ P R  +DPWT+SRLS+Q APPKE+ S+ S+
Sbjct  121  QSKPATPQPPPRAPLDPWTRSRLSKQLAPPKEDSSSHSD  159



>ref|XP_008244412.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Prunus 
mume]
Length=157

 Score =   281 bits (720),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTKLRKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RR AD MVQLGK+G+LCA 
Sbjct  1    MTKLRKLNRPTGHRISMLRTMVSQLVKHERIETTVAKAKEIRRKADKMVQLGKDGSLCAV  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRYK+R GGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVMHKLFTELAYRYKDRTGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTD  484
            QSKPP PQ PQR  +DPW +S+L +QFAPPKE+KS+D
Sbjct  121  QSKPPAPQ-PQRVPLDPWARSKLCKQFAPPKEDKSSD  156



>ref|XP_011022953.1| PREDICTED: 50S ribosomal protein L17, chloroplastic [Populus 
euphratica]
Length=160

 Score =   281 bits (720),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SM RTMVSQL+KHERIETTVAKAKE+RRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMFRTMVSQLIKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLF+E+AYRYK+RAGGYTR+LRTR+RVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVIHKLFSEMAYRYKDRAGGYTRMLRTRLRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQ PQR  +DPWT+SRL+RQFAP KEEKS+D E
Sbjct  121  QSKPPTPQPPQRAPLDPWTRSRLTRQFAPAKEEKSSDPE  159



>ref|NP_568992.1| large subunit ribosomal protein L17 [Arabidopsis thaliana]
 gb|ABF83622.1| At5g64650 [Arabidopsis thaliana]
 gb|AED97932.1| large subunit ribosomal protein L17 [Arabidopsis thaliana]
Length=160

 Score =   281 bits (719),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLV+HERIETTV KAKEVRRLADNM+QLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVQHERIETTVTKAKEVRRLADNMIQLGKEGSLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELA+RYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAHRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ P R  +DPW +SRL+RQ+APPKEEK++DS+
Sbjct  121  QSKPATPQPPPRVPLDPWARSRLTRQYAPPKEEKTSDSD  159



>ref|XP_002517236.1| ribosomal protein L17, putative [Ricinus communis]
 gb|EEF45136.1| ribosomal protein L17, putative [Ricinus communis]
Length=160

 Score =   281 bits (719),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL+RPTGHR+S+LRTMVSQLVKHERIETT+AKAKE+RRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLSRPTGHRMSLLRTMVSQLVKHERIETTIAKAKEIRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+R GGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVLHKLFTELAYRYKDREGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            +SKPPTPQ PQR  +DPWT+SRLS+QFAPPKEEKS++ E
Sbjct  121  KSKPPTPQPPQRDPLDPWTRSRLSKQFAPPKEEKSSEPE  159



>gb|KDP26142.1| hypothetical protein JCGZ_22243 [Jatropha curcas]
Length=160

 Score =   281 bits (719),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RPTGHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQ  QR  +DPW +SRLS+QFAPPKEEKS++ E
Sbjct  121  QSKPPTPQPQQREPLDPWARSRLSKQFAPPKEEKSSEPE  159



>ref|XP_002281739.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Vitis vinifera]
 emb|CBI37564.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   281 bits (718),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ PQR  +DPWT+SRL +QFAPPKE+KS+D E
Sbjct  121  QSKPATPQPPQRVPLDPWTRSRLCKQFAPPKEDKSSDPE  159



>ref|XP_007206065.1| hypothetical protein PRUPE_ppa012729mg [Prunus persica]
 gb|EMJ07264.1| hypothetical protein PRUPE_ppa012729mg [Prunus persica]
Length=157

 Score =   280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RR AD MVQLGK+G+LCA 
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRREADKMVQLGKDGSLCAV  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRYK+R GGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVMHKLFTELAYRYKDRTGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTD  484
            QSKPP PQ PQR  +DPW +S+L +QFAPPKE+KS+D
Sbjct  121  QSKPPAPQ-PQRVPLDPWARSKLCKQFAPPKEDKSSD  156



>ref|XP_006427799.1| hypothetical protein CICLE_v10026667mg [Citrus clementina]
 ref|XP_006464620.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006464621.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR41039.1| hypothetical protein CICLE_v10026667mg [Citrus clementina]
Length=160

 Score =   280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRYK+RAGGYTRLLR+RIRVGDAAPMAYIEF+DR NELR
Sbjct  61   RRAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRLLRSRIRVGDAAPMAYIEFVDRANELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP  PQ P R AMDPWT+SRL++ FAPPK+EKS+D+E
Sbjct  121  QSKPAVPQPPPRAAMDPWTRSRLTKNFAPPKQEKSSDAE  159



>gb|AAM63867.1| 50S ribosomal protein L17 [Arabidopsis thaliana]
Length=160

 Score =   279 bits (713),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLV+HERIETTV KA EVRRLADNM+QLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVQHERIETTVTKAIEVRRLADNMIQLGKEGSLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELA+RYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAHRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ P R  +DPW +SRL+RQ+APPKEEK++DS+
Sbjct  121  QSKPATPQPPPRVPLDPWARSRLTRQYAPPKEEKTSDSD  159



>gb|KJB16009.1| hypothetical protein B456_002G208300 [Gossypium raimondii]
Length=158

 Score =   278 bits (712),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 2/159 (1%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R AA FVRGDDV+HKLFTELAYRYK  AGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RHAAAFVRGDDVIHKLFTELAYRYK--AGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  118

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQ PQRP++DPWT+SRLSRQFAPPKEEKS++SE
Sbjct  119  QSKPPTPQPPQRPSLDPWTRSRLSRQFAPPKEEKSSESE  157



>gb|AET05307.2| 50S ribosomal protein L17 [Medicago truncatula]
Length=162

 Score =   278 bits (712),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 148/160 (93%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNR T HR+SMLRTMVSQLV+HERIETT++KAKEVRR+ADNMVQLGKEG++C+A
Sbjct  1    MTKFRKLNRETSHRISMLRTMVSQLVRHERIETTISKAKEVRRVADNMVQLGKEGSVCSA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+R GGYTR+LRTRIRVGDAAPMAYIE IDR+NELR
Sbjct  61   RRAASFVRGDDVLHKLFTELAYRYKDRTGGYTRVLRTRIRVGDAAPMAYIELIDRDNELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKS-TDSE  490
            QSKPPTPQ PQR  +DPWT+S L+RQFAPPK EKS +DS+
Sbjct  121  QSKPPTPQPPQRAPLDPWTRSHLTRQFAPPKGEKSDSDSD  160



>gb|KJB16010.1| hypothetical protein B456_002G208300 [Gossypium raimondii]
Length=165

 Score =   277 bits (708),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 5/164 (3%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYR-----YKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
            R AA FVRGDDV+HKLFTELAYR     Y++RAGGYTRLLRTRIRVGDAAPMAYIEFIDR
Sbjct  61   RHAAAFVRGDDVIHKLFTELAYRYNPMCYRDRAGGYTRLLRTRIRVGDAAPMAYIEFIDR  120

Query  359  ENELRQSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            ENELRQSKPPTPQ PQRP++DPWT+SRLSRQFAPPKEEKS++SE
Sbjct  121  ENELRQSKPPTPQPPQRPSLDPWTRSRLSRQFAPPKEEKSSESE  164



>ref|XP_004502917.1| PREDICTED: 50S ribosomal protein L17-like [Cicer arietinum]
Length=161

 Score =   275 bits (703),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNR   HR+SM RTMVSQLVKHERIETTVAKAKEVRR ADNMVQLGKEG+ CAA
Sbjct  1    MTKFRKLNRTAAHRISMFRTMVSQLVKHERIETTVAKAKEVRRFADNMVQLGKEGSECAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            + A+ FVRGDDVLHKLFTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAY+EF+DR+NELR
Sbjct  61   KCASRFVRGDDVLHKLFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYLEFVDRDNELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKS-TDSE  490
            QSKPPTPQ PQR  +DPWT+SRL+RQFAPPK +KS +DS+
Sbjct  121  QSKPPTPQQPQRAPLDPWTRSRLTRQFAPPKVKKSDSDSD  160



>ref|XP_010245812.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=174

 Score =   275 bits (702),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 148/174 (85%), Gaps = 14/174 (8%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKE------  175
            MTK RKL RPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKE      
Sbjct  1    MTKFRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEVPNNYT  60

Query  176  --------GTLCAARRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAP  331
                    G+LCAARRA+ FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAA 
Sbjct  61   WYGSYMFKGSLCAARRASAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAE  120

Query  332  MAYIEFIDRENELRQSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            MAYIEFIDRENELRQSKP TPQ P R  +DPWT+SRLS+Q APPKE+ S+ S++
Sbjct  121  MAYIEFIDRENELRQSKPATPQPPPRAPLDPWTRSRLSKQLAPPKEDSSSHSDS  174



>gb|EPS69520.1| hypothetical protein M569_05246, partial [Genlisea aurea]
Length=151

 Score =   272 bits (696),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHRLSMLRTMVSQLVKHERIETT+AKAKEVRRLADNMVQLGKEGTLCAA
Sbjct  1    MTKFRKLNRPTGHRLSMLRTMVSQLVKHERIETTIAKAKEVRRLADNMVQLGKEGTLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTR RVGDAA MAYIEFIDR+NELR
Sbjct  61   RRAAAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRFRVGDAASMAYIEFIDRDNELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPK  466
            QSKP TPQ PQRP +DPWT+SRL+RQFAP K
Sbjct  121  QSKPATPQPPQRPGLDPWTRSRLTRQFAPEK  151



>gb|KFK25270.1| hypothetical protein AALP_AA8G090100 [Arabis alpina]
Length=160

 Score =   272 bits (696),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MT+ RKL R  GHR++MLRTMVSQLVKHERIETTV KAKEVRRLADNMVQLGKEG+LCAA
Sbjct  1    MTRFRKLGRHAGHRMNMLRTMVSQLVKHERIETTVTKAKEVRRLADNMVQLGKEGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R+AAGFVRGDDV+HKLFTELAYRYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RKAAGFVRGDDVIHKLFTELAYRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQ P R  +DPW +SRL +QFAPPKEEKS+DSE
Sbjct  121  QSKPPTPQPPPRVPLDPWARSRLMKQFAPPKEEKSSDSE  159



>emb|CDX81138.1| BnaC03g03920D [Brassica napus]
Length=160

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MT  RKL R  GHR+SMLRT+VSQLVKHERIETTV KAKEVRRLADNM+QLGKEG+L +A
Sbjct  1    MTNFRKLGRHAGHRISMLRTLVSQLVKHERIETTVTKAKEVRRLADNMIQLGKEGSLDSA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELAYRYK+R GGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAYRYKDRDGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QS P TPQ PQR  +DPW KSRL +Q APPKEEK  DSE
Sbjct  121  QSNPATPQPPQRVPLDPWDKSRLMKQVAPPKEEKIFDSE  159



>emb|CAB89353.1| ribsomal protein-like [Arabidopsis thaliana]
Length=156

 Score =   271 bits (693),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 143/159 (90%), Gaps = 4/159 (3%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLVKHERIETTV KAKEVRRLADNM+QLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVKHERIETTVTKAKEVRRLADNMIQLGKEGSLSAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELA+RYK+RAGGYTRLLRTRIRVGDAAPMAYIE    ENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAHRYKDRAGGYTRLLRTRIRVGDAAPMAYIE----ENELR  116

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ PQR  +DPW +SRL+RQFAPPKEEK  DSE
Sbjct  117  QSKPATPQPPQRVPLDPWERSRLTRQFAPPKEEKIPDSE  155



>ref|XP_009131122.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Brassica 
rapa]
Length=159

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MT  RKL R  GHR+SMLRT+VSQLVKHERIETTV KAKEVRRLADNM+QLGKEG+L +A
Sbjct  1    MTNFRKLGRHAGHRISMLRTLVSQLVKHERIETTVTKAKEVRRLADNMIQLGKEGSLDSA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELAYRYK+R GGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAYRYKDRDGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEK  475
            QS P TPQ PQR  +DPW KSRL +Q APPKEEK
Sbjct  121  QSNPATPQPPQRVPLDPWDKSRLMKQVAPPKEEK  154



>dbj|BAB11432.1| 50S ribosomal protein L17 [Arabidopsis thaliana]
Length=156

 Score =   267 bits (682),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 144/159 (91%), Gaps = 4/159 (3%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP GHR+SMLRTMVSQLV+HERIETTV KAKEVRRLADNM+QLGKEG+L AA
Sbjct  1    MTKFRKLGRPAGHRMSMLRTMVSQLVQHERIETTVTKAKEVRRLADNMIQLGKEGSLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDVLHK+FTELA+RYK+RAGGYTR+LRTRIRVGDAAPMAYIE    ENELR
Sbjct  61   RRAAGFVRGDDVLHKIFTELAHRYKDRAGGYTRMLRTRIRVGDAAPMAYIE----ENELR  116

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ P R  +DPW +SRL+RQ+APPKEEK++DS+
Sbjct  117  QSKPATPQPPPRVPLDPWARSRLTRQYAPPKEEKTSDSD  155



>ref|XP_003602582.1| 50S ribosomal protein L17 [Medicago truncatula]
 gb|AES72833.1| 50S ribosomal protein L17 [Medicago truncatula]
 gb|AFK49179.1| unknown [Medicago truncatula]
Length=162

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNR T HRLSMLRTMVSQLV+HERIETT+ KAKEVRRLADNMVQLGKEG++CAA
Sbjct  1    MTKFRKLNRDTSHRLSMLRTMVSQLVRHERIETTITKAKEVRRLADNMVQLGKEGSVCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+R GGYTR+LRTRIRVGDAAPMAYIE IDR+NELR
Sbjct  61   RRAASFVRGDDVLHKLFTELAYRYKDRTGGYTRVLRTRIRVGDAAPMAYIELIDRDNELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKS-TDSE  490
            QSKPPTPQ PQR  +DPWT+SRL+RQFAPPK EKS +DS+
Sbjct  121  QSKPPTPQPPQRTPLDPWTRSRLTRQFAPPKVEKSDSDSD  160



>ref|XP_008392015.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Malus 
domestica]
Length=158

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTV+KAKE+RR AD MVQLGK+G+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVSKAKEIRREADKMVQLGKDGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+R GGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVLHKLFTELAYRYKDRVGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTD  484
            QSK P PQ P+R  +DPW +S+L +QFAPPKE+KS++
Sbjct  121  QSKLPAPQPPERVPLDPWARSKLCKQFAPPKEDKSSE  157



>gb|KHG30266.1| 50S ribosomal L17 [Gossypium arboreum]
Length=160

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTVAKAKE+RRLADNMVQLGKEG+L AA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGSLFAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDS  487
            QSKPPTPQ PQRP++DPWT+SRLSRQFAPPKEEKS++S
Sbjct  121  QSKPPTPQPPQRPSLDPWTRSRLSRQFAPPKEEKSSES  158



>ref|XP_010932763.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Elaeis guineensis]
Length=160

 Score =   264 bits (675),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL RP  HR+SMLRTMVSQLVKHERIETTVAKAKEVRR+ADNMVQLGKEGTL AA
Sbjct  1    MAKFRKLGRPAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRVADNMVQLGKEGTLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RRAAAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KPPTPQ PQR  +DPWTKSR S+Q+A PKE +++ SE+
Sbjct  121  EAKPPTPQPPQRVPLDPWTKSRASQQWASPKENQNSGSES  160



>ref|XP_008344889.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Malus 
domestica]
Length=158

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTV+KAKE+RR AD MVQLGK+G+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVSKAKEIRREADKMVQLGKDGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGD+VLHKLFTE+AYRYK+R GGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDNVLHKLFTEMAYRYKDRVGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTD  484
            QSKPP PQ PQR  +DPW +S L + FAPPKE+KS++
Sbjct  121  QSKPPAPQPPQRVPLDPWARSXLCKXFAPPKEDKSSE  157



>ref|XP_008803385.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Phoenix dactylifera]
Length=161

 Score =   263 bits (672),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP  HR+SML+TMVSQLVKHERIETTVAKAKEVRR+ADNMVQLGKEGTL AA
Sbjct  1    MTKFRKLGRPAAHRVSMLKTMVSQLVKHERIETTVAKAKEVRRVADNMVQLGKEGTLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R AA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RHAAAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            ++KPP PQ PQR  +DPWTKSR S+Q+A PKE +++ SE
Sbjct  121  EAKPPNPQPPQRVPLDPWTKSRASQQWASPKENQNSGSE  159



>ref|XP_009341932.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Pyrus 
x bretschneideri]
Length=158

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRTMVSQLVKHERIETTV+KAKE+RR AD MVQLGK+G+LCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVSKAKEIRREADKMVQLGKDGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+R GGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAAFVRGDDVLHKLFTELAYRYKDRVGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTD  484
            QSK P PQ P+R  +DPW +S+L ++FAPPKE+KS++
Sbjct  121  QSKLPAPQPPERVPLDPWARSKLCKRFAPPKEDKSSE  157



>gb|ACJ84008.1| unknown [Medicago truncatula]
Length=162

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNR T HRLSMLRTMVSQLV+HERIETT+ KAKEVRRLADNMVQLGKEG++CAA
Sbjct  1    MTKFRKLNRDTSHRLSMLRTMVSQLVRHERIETTITKAKEVRRLADNMVQLGKEGSVCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+R GGYTR+LRTRIRVGDAAPMAYIE IDR+NELR
Sbjct  61   RRAASFVRGDDVLHKLFTELAYRYKDRTGGYTRVLRTRIRVGDAAPMAYIELIDRDNELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKS-TDSE  490
             SKPPTPQ PQR  +DPWT+SRL+RQFAPPK EKS +DS+
Sbjct  121  LSKPPTPQPPQRTPLDPWTRSRLTRQFAPPKVEKSDSDSD  160



>ref|XP_004148646.1| PREDICTED: 50S ribosomal protein L17-like [Cucumis sativus]
 ref|XP_004163049.1| PREDICTED: 50S ribosomal protein L17-like [Cucumis sativus]
 gb|KGN48368.1| hypothetical protein Csa_6G483480 [Cucumis sativus]
Length=159

 Score =   260 bits (665),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP  HR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTL AA
Sbjct  1    MTKFRKLGRPAAHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLSAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGD VLHKLFTELAYRYK+R GGYTR LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RRAAGFVRGDAVLHKLFTELAYRYKDRTGGYTRFLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPP P  PQRP +DPWT+SRLS+QFAPPKE KS DSE
Sbjct  121  QSKPPNPPPPQRPPLDPWTRSRLSKQFAPPKEIKS-DSE  158



>dbj|BAC42886.1| putative 50S ribosomal protein L17 [Arabidopsis thaliana]
Length=146

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  56   LSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLH  235
            +SMLRTMVSQLV+HERIETTV KAKEVRRLADNM+QLGKEG+L AARRAAGFVRGDDVLH
Sbjct  1    MSMLRTMVSQLVQHERIETTVTKAKEVRRLADNMIQLGKEGSLAAARRAAGFVRGDDVLH  60

Query  236  KLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPPTPQLPQRPA  415
            K+FTELA+RYK+RAGGYTR+LRTRIRVGDAAPMAYIEFIDRENELRQSKP TPQ P R  
Sbjct  61   KIFTELAHRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELRQSKPATPQPPPRVP  120

Query  416  MDPWTKSRLSRQFAPPKEEKSTDSE  490
            +DPW +SRL+RQ+APPKEEK++DS+
Sbjct  121  LDPWARSRLTRQYAPPKEEKTSDSD  145



>emb|CAN65254.1| hypothetical protein VITISV_026602 [Vitis vinifera]
Length=207

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 150/206 (73%), Gaps = 47/206 (23%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAK-----------------------  124
            MTK RKL RPTGHR+SMLRTMVSQLVKHERIETTVAK                       
Sbjct  1    MTKFRKLGRPTGHRMSMLRTMVSQLVKHERIETTVAKLVVTYARCETSEHCRNGQGSGPH  60

Query  125  ------------------------AKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVL  232
                                    AKE+RRLADNMVQLGKEG+LCAARRAA FVRGDDV+
Sbjct  61   HNLHEIVNGVIEEFQLNQFLSLKQAKEIRRLADNMVQLGKEGSLCAARRAAAFVRGDDVI  120

Query  233  HKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPPTPQLPQRP  412
            HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKP TPQ PQR 
Sbjct  121  HKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPATPQPPQRV  180

Query  413  AMDPWTKSRLSRQFAPPKEEKSTDSE  490
             +DPWT+SRL +QFAPPKE+KS+D E
Sbjct  181  PLDPWTRSRLCKQFAPPKEDKSSDPE  206



>ref|XP_004970519.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial-like 
[Setaria italica]
Length=161

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M   RKL RP  HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGTL AA
Sbjct  1    MGNFRKLGRPASHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGDD +HKLFTELAYRYK RAGGYTRLLRTRIRVGDAA MAYIEF+DRENELR
Sbjct  61   RRASAFVRGDDAVHKLFTELAYRYKNRAGGYTRLLRTRIRVGDAAEMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TPQ PQR  MDPW KSR S+Q+A PK  KS+ S+ 
Sbjct  121  EAKPATPQPPQRAPMDPWAKSRASQQWAGPKLTKSSGSDG  160



>ref|XP_010025565.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010025566.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Eucalyptus 
grandis]
Length=160

 Score =   256 bits (655),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP  HR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQ GKEGTL AA
Sbjct  1    MTKFRKLGRPAAHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQFGKEGTLHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R+AA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RQAAAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTD  484
            QSKPP PQ PQRP MDPWT+S+L +QFAPPKEEK ++
Sbjct  121  QSKPPVPQPPQRPPMDPWTRSKLCKQFAPPKEEKFSE  157



>ref|XP_006399460.1| hypothetical protein EUTSA_v10014895mg [Eutrema salsugineum]
 gb|ESQ40913.1| hypothetical protein EUTSA_v10014895mg [Eutrema salsugineum]
Length=160

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL R  GHR++MLRT+VSQLVKHERIETTV KAKEVRRLADNMVQLGKEGTL A 
Sbjct  1    MTKFRKLGRHAGHRMAMLRTLVSQLVKHERIETTVTKAKEVRRLADNMVQLGKEGTLAAT  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R+A GF+RGDDV+HK+FTELAYRYK+R GGYTR+LRTRIRVGDAAPMAYIEFIDRENELR
Sbjct  61   RQAGGFLRGDDVIHKIFTELAYRYKDRTGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QS PPTPQ PQR  +DPW KSRL +Q+APPKEEK++DSE
Sbjct  121  QSSPPTPQPPQRVPLDPWAKSRLMKQYAPPKEEKTSDSE  159



>ref|NP_001044752.1| Os01g0839300 [Oryza sativa Japonica Group]
 dbj|BAD81701.1| putative 50S ribosomal protein L17 [Oryza sativa Japonica Group]
 dbj|BAD81752.1| putative 50S ribosomal protein L17 [Oryza sativa Japonica Group]
 dbj|BAF06666.1| Os01g0839300 [Oryza sativa Japonica Group]
 gb|EAY76436.1| hypothetical protein OsI_04369 [Oryza sativa Indica Group]
 gb|EAZ14095.1| hypothetical protein OsJ_04018 [Oryza sativa Japonica Group]
 dbj|BAG89156.1| unnamed protein product [Oryza sativa Japonica Group]
Length=161

 Score =   254 bits (650),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGTL AA
Sbjct  1    MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGDDV+HKLFTELAYRYK RAGGYTRLLRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RRASAFVRGDDVVHKLFTELAYRYKNRAGGYTRLLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TPQ PQR  +DPW KSR S+Q+A PK  + +  E 
Sbjct  121  EAKPATPQPPQRSPLDPWAKSRASQQWAGPKISEGSRKEG  160



>ref|XP_008776922.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Phoenix dactylifera]
Length=144

 Score =   254 bits (648),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +2

Query  62   MLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKL  241
            MLRTMVSQLVKHERIETTVAKAKEVRR+ADNMVQLGKEGTL AARRA+ FVRGDDVLHKL
Sbjct  1    MLRTMVSQLVKHERIETTVAKAKEVRRVADNMVQLGKEGTLAAARRASAFVRGDDVLHKL  60

Query  242  FTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPPTPQLPQRPAMD  421
            FTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEF+DRENELR++KPPTPQ PQR  +D
Sbjct  61   FTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFVDRENELREAKPPTPQPPQRVPLD  120

Query  422  PWTKSRLSRQFAPPKEEKSTDSEN  493
            PWTKSR  +Q+A PKE +++ SE+
Sbjct  121  PWTKSRACQQWASPKENQNSGSES  144



>ref|XP_006843890.1| hypothetical protein AMTR_s00007p00266670 [Amborella trichopoda]
 gb|ERN05565.1| hypothetical protein AMTR_s00007p00266670 [Amborella trichopoda]
Length=160

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKLNRPTGHR+SMLRT+VSQLVKHERIETTVAKAKE+RRLADNMVQLGKEGTLCAA
Sbjct  1    MTKFRKLNRPTGHRMSMLRTLVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGTLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA F+RGDDV+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RRAAAFIRGDDVIHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDS  487
            QSKPPTPQ PQRP +DPW++SR S+Q+APPKEEK+ +S
Sbjct  121  QSKPPTPQPPQRPPLDPWSRSRASQQWAPPKEEKTAES  158



>gb|ABK23689.1| unknown [Picea sitchensis]
 gb|ABK26451.1| unknown [Picea sitchensis]
Length=152

 Score =   254 bits (648),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            +T  RKL RPTGHR++MLRTMVSQL+KHERIETTVAKAKEVRRLAD MVQLGKEGT  A 
Sbjct  2    VTNFRKLGRPTGHRMAMLRTMVSQLIKHERIETTVAKAKEVRRLADRMVQLGKEGTELAK  61

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA  FVRGDD+++KLFTE AYRYK+RAGGYTRLLRTRIR GDAA MAYIEFIDRENELR
Sbjct  62   RRAGSFVRGDDIVYKLFTEFAYRYKDRAGGYTRLLRTRIRQGDAAEMAYIEFIDRENELR  121

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPK  466
            Q+KP  PQ PQRP +DPWTKSRLS+Q+A PK
Sbjct  122  QAKPAVPQPPQRPPLDPWTKSRLSQQWASPK  152



>ref|XP_006654515.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial-like 
[Oryza brachyantha]
Length=161

 Score =   253 bits (646),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGTL AA
Sbjct  1    MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGDD++HKLFTELAYRYK+RAGGYTRLLRTRIR+GDAAPMAYIEF+DRENELR
Sbjct  61   RRASAFVRGDDIVHKLFTELAYRYKDRAGGYTRLLRTRIRIGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TPQ  QR  +DPWTKSR S+++A PK  +++ +E 
Sbjct  121  EAKPATPQPSQRAPLDPWTKSRASQRWAGPKISQNSRAEG  160



>dbj|BAK06308.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   253 bits (646),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M   RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGK+GTL AA
Sbjct  1    MGNFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKDGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGDDV+HKLFTELAYRYK+RAGGYTRLLRTRIR+GDAAPMAYIEF+DRENELR
Sbjct  61   RRASAFVRGDDVVHKLFTELAYRYKDRAGGYTRLLRTRIRIGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TP  PQR  +DPWTKSR S+Q+A PK  +++ +E 
Sbjct  121  EAKPATPSPPQRVPLDPWTKSRASQQWAGPKVSQNSKTEG  160



>emb|CDM84912.1| unnamed protein product [Triticum aestivum]
Length=161

 Score =   253 bits (645),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGK+GTL AA
Sbjct  1    MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKDGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGDDV+HKLFTELAYRYK+RAGGYTRLLRTRIR+GDAAPMAYIEF+DRENELR
Sbjct  61   RRASAFVRGDDVVHKLFTELAYRYKDRAGGYTRLLRTRIRIGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TP LPQR  +DPW KSR S+Q+A PK   +  SE 
Sbjct  121  EAKPATPPLPQRVPLDPWAKSRASQQWAGPKVTVNPKSEG  160



>ref|XP_006644980.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial-like 
[Oryza brachyantha]
Length=161

 Score =   253 bits (645),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGTL AA
Sbjct  1    MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGDDV+HKLFTELAYRYK RAGGYTRLLRTRIR+GDAAPMAYIEF+DRENELR
Sbjct  61   RRASAFVRGDDVVHKLFTELAYRYKNRAGGYTRLLRTRIRIGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP  PQ PQR  +DPW KSR S+Q+A PK  + +  E 
Sbjct  121  EAKPAVPQPPQRAPLDPWAKSRASQQWAGPKISEGSRKEG  160



>ref|XP_009381087.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=160

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL R   HR+SMLRTMVSQLVK+ERIETTVAKAKEVRRLADNMVQLGKEGTL AA
Sbjct  1    MTKFRKLGRHAAHRVSMLRTMVSQLVKYERIETTVAKAKEVRRLADNMVQLGKEGTLHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTE AYRYK+R GGYTRLLRTRIR GDAAPMAYIEF+DRENELR
Sbjct  61   RRAAAFVRGDDVLHKLFTEFAYRYKDRVGGYTRLLRTRIRKGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KPP PQ P+R  +DPW KSR S+Q+A PKE+ ++ SEN
Sbjct  121  EAKPPKPQPPERAPLDPWAKSRASQQWASPKEKANSGSEN  160



>gb|EEC79355.1| hypothetical protein OsI_20233 [Oryza sativa Indica Group]
Length=161

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVR  AD MVQLGKEGTL AA
Sbjct  1    MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRTKADQMVQLGKEGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGD+V+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RRASAFVRGDNVVHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TPQ PQR  +DPWTKS  S+Q+A PK  +++ +E 
Sbjct  121  EAKPATPQPPQRVPLDPWTKSLASKQWAGPKISQNSGAEG  160



>ref|XP_003564575.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Brachypodium distachyon]
Length=161

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGK+GTL AA
Sbjct  1    MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKDGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGDDV+HKLFTELAYRYK+RAGGYTRLLRTRIR+GDAAPMAYIEF+DRENELR
Sbjct  61   RRASAFVRGDDVVHKLFTELAYRYKDRAGGYTRLLRTRIRIGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TP  PQR  +DPW KSR S+Q+A PK   S+ +E 
Sbjct  121  EAKPATPPPPQRVPLDPWAKSRASQQWAGPKISGSSKAEG  160



>ref|XP_003568304.2| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Brachypodium distachyon]
Length=224

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = +2

Query  8    STMTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLC  187
            + M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGK+GTL 
Sbjct  61   AAMGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKDGTLD  120

Query  188  AARRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENE  367
            AARRA+ FVRGDDV+HK+FTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEF+DRENE
Sbjct  121  AARRASSFVRGDDVVHKIFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFVDRENE  180

Query  368  LRQSKPPTPQLPQRPAMDPWTKSRLSRQFAPPK-EEKSTDSEN  493
            LR++KP TPQ PQR  +DPWT+SR S+Q+A PK  +K++ +E 
Sbjct  181  LREAKPATPQPPQRIPLDPWTRSRASQQWAGPKVSQKNSGAEG  223



>ref|XP_010917739.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Elaeis guineensis]
Length=161

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP  HR+SMLRTMVSQLVKHERIETTVAKAKEVRR+ADNMVQLGKEGTL AA
Sbjct  1    MTKFRKLGRPAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRVADNMVQLGKEGTLAAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            R AA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RHAAAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KPP PQ PQR  +DPWTKSR S+Q+A PKE +++ SE+
Sbjct  121  EAKPPKPQPPQRVPLDPWTKSRASQQWASPKEHQNSGSES  160



>gb|KDO58345.1| hypothetical protein CISIN_1g0313082mg, partial [Citrus sinensis]
 gb|KDO58346.1| hypothetical protein CISIN_1g0313082mg, partial [Citrus sinensis]
Length=141

 Score =   245 bits (626),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +2

Query  71   TMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTE  250
            TMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+LCAARRAA FVRGDDV+HKLFTE
Sbjct  1    TMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLCAARRAAAFVRGDDVIHKLFTE  60

Query  251  LAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPPTPQLPQRPAMDPWT  430
            LAYRYK+RAGGYTRLLR+RIRVGDAAPMAYIEF+DRENELRQSKP  PQ P R A+DPWT
Sbjct  61   LAYRYKDRAGGYTRLLRSRIRVGDAAPMAYIEFVDRENELRQSKPAVPQPPPRAALDPWT  120

Query  431  KSRLSRQFAPPKEEKSTDSE  490
            +SRL++ FAPPK+EKS+D+E
Sbjct  121  RSRLTKNFAPPKQEKSSDAE  140



>gb|KDO58348.1| hypothetical protein CISIN_1g0313082mg [Citrus sinensis]
Length=140

 Score =   243 bits (620),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTEL  253
            MVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+LCAARRAA FVRGDDV+HKLFTEL
Sbjct  1    MVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLCAARRAAAFVRGDDVIHKLFTEL  60

Query  254  AYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPPTPQLPQRPAMDPWTK  433
            AYRYK+RAGGYTRLLR+RIRVGDAAPMAYIEF+DRENELRQSKP  PQ P R A+DPWT+
Sbjct  61   AYRYKDRAGGYTRLLRSRIRVGDAAPMAYIEFVDRENELRQSKPAVPQPPPRAALDPWTR  120

Query  434  SRLSRQFAPPKEEKSTDSE  490
            SRL++ FAPPK+EKS+D+E
Sbjct  121  SRLTKNFAPPKQEKSSDAE  139



>ref|XP_008441029.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Cucumis melo]
Length=159

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP  HR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTL AA
Sbjct  1    MTKFRKLGRPAAHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLSAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGD +LHKLFTELAYRYK+RAGGYTR LRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RRAAAFVRGDAILHKLFTELAYRYKDRAGGYTRFLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPP P  PQRP +DPWT+SRLS+Q APPKE KS DSE
Sbjct  121  QSKPPNPPPPQRPPLDPWTRSRLSKQLAPPKEIKS-DSE  158



>ref|XP_002452603.1| hypothetical protein SORBIDRAFT_04g028870 [Sorghum bicolor]
 gb|EES05579.1| hypothetical protein SORBIDRAFT_04g028870 [Sorghum bicolor]
Length=161

 Score =   240 bits (613),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HRLSMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGT  AA
Sbjct  1    MGKFRKLGRGYSHRLSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTEHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRY++RAGGYTR+LRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RRAAAFVRGDDVVHKLFTELAYRYRDRAGGYTRMLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TP  PQR  +DPWTKSR S+Q+A PK  K+++S+ 
Sbjct  121  EAKPATPPPPQRVPLDPWTKSRASQQWAGPKITKTSESDG  160



>gb|KDO58347.1| hypothetical protein CISIN_1g0313082mg, partial [Citrus sinensis]
Length=142

 Score =   239 bits (611),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 133/141 (94%), Gaps = 1/141 (1%)
 Frame = +2

Query  71   TMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTE  250
            TMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+LCAARRAA FVRGDDV+HKLFTE
Sbjct  1    TMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLCAARRAAAFVRGDDVIHKLFTE  60

Query  251  LAYRYKERAGGYTRLLRTRIRVGDAAPMAYIE-FIDRENELRQSKPPTPQLPQRPAMDPW  427
            LAYRYK+RAGGYTRLLR+RIRVGDAAPMAYI+ F+DRENELRQSKP  PQ P R A+DPW
Sbjct  61   LAYRYKDRAGGYTRLLRSRIRVGDAAPMAYIDRFVDRENELRQSKPAVPQPPPRAALDPW  120

Query  428  TKSRLSRQFAPPKEEKSTDSE  490
            T+SRL++ FAPPK+EKS+D+E
Sbjct  121  TRSRLTKNFAPPKQEKSSDAE  141



>ref|XP_004306555.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Fragaria vesca subsp. vesca]
 ref|XP_004306556.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Fragaria vesca subsp. vesca]
 ref|XP_011468841.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=161

 Score =   238 bits (608),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTKLRKLNR T HR+SML+TMVSQLVKHERIETTVAKAKEVRR AD MVQLGK+G+LCAA
Sbjct  1    MTKLRKLNRTTAHRISMLKTMVSQLVKHERIETTVAKAKEVRRQADRMVQLGKDGSLCAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRYK+R GGYTR+LRTRIRVGDAAPMAYIEFIDR+NELR
Sbjct  61   RRAAAFVRGDDVIHKLFTELAYRYKDRVGGYTRMLRTRIRVGDAAPMAYIEFIDRDNELR  120

Query  374  QSK-PPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSK P     P R  +DPW +S+L +QFAPPKE+KS  +E
Sbjct  121  QSKPPAPQPPPPRVPLDPWARSKLCKQFAPPKEDKSKSTE  160



>ref|XP_010090868.1| 50S ribosomal protein L17 [Morus notabilis]
 gb|EXB40993.1| 50S ribosomal protein L17 [Morus notabilis]
Length=154

 Score =   238 bits (607),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 146/159 (92%), Gaps = 6/159 (4%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RPTGHR+S+LRTMVSQLVKHERIETTVAKAKE+RRLADNM      G+LCAA
Sbjct  1    MTKFRKLGRPTGHRMSLLRTMVSQLVKHERIETTVAKAKEIRRLADNM------GSLCAA  54

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  55   RRAAAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFVDRENELR  114

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKPPTPQ PQRP MDPWT+S+L RQ+APPKEEKS++ E
Sbjct  115  QSKPPTPQPPQRPPMDPWTRSKLCRQYAPPKEEKSSEDE  153



>ref|XP_002456607.1| hypothetical protein SORBIDRAFT_03g039290 [Sorghum bicolor]
 gb|EES01727.1| hypothetical protein SORBIDRAFT_03g039290 [Sorghum bicolor]
Length=161

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HRLSMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGT  AA
Sbjct  1    MGKFRKLGRDYSHRLSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTEHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELAYRY+ RAGGYTR+LRT+IR  DA+ MAYIEF+DRENELR
Sbjct  61   RRAASFVRGDDVVHKLFTELAYRYRNRAGGYTRMLRTKIRTSDASTMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            + KP TP  PQR  +DPWTKSR S+Q+A PK  K+++S++
Sbjct  121  EPKPATPPPPQRVPLDPWTKSRSSQQWAGPKITKTSESDS  160



>ref|NP_001150751.1| LOC100284384 [Zea mays]
 gb|ACG40214.1| 50S ribosomal protein L17 [Zea mays]
Length=161

 Score =   232 bits (592),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R    RL MLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGT  AA
Sbjct  1    MGKFRKLGRNYSQRLCMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTQHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELA+RY++RAGGYTR+LRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RRAAAFVRGDDVVHKLFTELAFRYRDRAGGYTRMLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TP  PQR  +DPW KSR S+Q+A PK  K+++S+ 
Sbjct  121  EAKPATPPPPQRVPLDPWAKSRASQQWAGPKITKTSESDG  160



>gb|ACF85088.1| unknown [Zea mays]
 gb|AFW84641.1| 50S ribosomal protein L17 [Zea mays]
Length=161

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R    R+ MLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGT  AA
Sbjct  1    MGKFRKLGRDYSQRICMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTQHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELA+RY++RAGGYTR+LRTRIRVGDAAPMAYIEF+DRENELR
Sbjct  61   RRAAAFVRGDDVVHKLFTELAFRYRDRAGGYTRMLRTRIRVGDAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TP  PQR  +DPW KSR S+Q+A PK  KS++++ 
Sbjct  121  EAKPATPPPPQRVPLDPWAKSRASQQWAGPKITKSSETDG  160



>gb|ACG40240.1| 50S ribosomal protein L17 [Zea mays]
Length=161

 Score =   230 bits (586),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R    RL MLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGT  AA
Sbjct  1    MGKFRKLGRNYSQRLCMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTQHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAA FVRGDDV+HKLFTELA+RY++RAGGYTR+LRTRIRVG AAPMAYIEF+DRENELR
Sbjct  61   RRAAAFVRGDDVVHKLFTELAFRYRDRAGGYTRMLRTRIRVGXAAPMAYIEFVDRENELR  120

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TP  PQR  +DPW KSR S+Q+A PK  K+++S+ 
Sbjct  121  EAKPATPPPPQRAPLDPWAKSRASQQWAGPKITKTSESDG  160



>gb|ACG35970.1| 50S ribosomal protein L17 [Zea mays]
Length=175

 Score =   223 bits (569),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 136/174 (78%), Gaps = 14/174 (8%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R    RL MLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGT  AA
Sbjct  1    MGKFRKLGRNYSQRLCMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTQHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKE--------------RAGGYTRLLRTRIRVGDAAP  331
            RRAA FVRGDDV+HKLFTELA+RY++              RAGGYTR+LRTRIRVGDAAP
Sbjct  61   RRAAAFVRGDDVVHKLFTELAFRYRQCGIRRTTVVQYLIDRAGGYTRMLRTRIRVGDAAP  120

Query  332  MAYIEFIDRENELRQSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            MAYIEF+DRENELR++KP TP  PQR  +DPW KSR S+Q+A PK  K+++S+ 
Sbjct  121  MAYIEFVDRENELREAKPATPPPPQRVPLDPWAKSRASQQWAGPKITKTSESDG  174



>ref|XP_009766669.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Nicotiana 
sylvestris]
Length=125

 Score =   214 bits (546),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +2

Query  122  KAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLR  301
            +AKEVRRLADNMVQLGKEG+L AAR+AA FVRGDDV+HKLFTELAYRYK+RAGGYTR+LR
Sbjct  2    QAKEVRRLADNMVQLGKEGSLSAARQAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRMLR  61

Query  302  TRIRVGDAAPMAYIEFIDRENELRQSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKST  481
            TRIRVGDAAPMAYIEFIDRENELRQSKPP PQ PQRPAMDPWT+SRLSRQFAPPKEEKS+
Sbjct  62   TRIRVGDAAPMAYIEFIDRENELRQSKPPNPQPPQRPAMDPWTRSRLSRQFAPPKEEKSS  121

Query  482  DSE  490
            DS+
Sbjct  122  DSD  124



>ref|XP_008655059.1| PREDICTED: LOC100284384 isoform X1 [Zea mays]
 gb|ACG24014.1| 50S ribosomal protein L17 [Zea mays]
 gb|AFW84639.1| 50S ribosomal protein L17 isoform 1 [Zea mays]
 gb|AFW84640.1| 50S ribosomal protein L17 isoform 2 [Zea mays]
Length=141

 Score =   212 bits (540),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  74   MVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTEL  253
            MVSQLVKHERIETTVAKAKEVRR AD MVQLGKEGT  AARRAA FVRGDDV+HKLFTEL
Sbjct  1    MVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTQHAARRAAAFVRGDDVVHKLFTEL  60

Query  254  AYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPPTPQLPQRPAMDPWTK  433
            A+RY++RAGGYTR+LRTRIRVGDAAPMAYIEF+DRENELR++KP TP  PQR  +DPW K
Sbjct  61   AFRYRDRAGGYTRMLRTRIRVGDAAPMAYIEFVDRENELREAKPATPPPPQRVPLDPWAK  120

Query  434  SRLSRQFAPPKEEKSTDSEN  493
            SR S+Q+A PK  KS++++ 
Sbjct  121  SRASQQWAGPKITKSSETDG  140



>ref|XP_006394129.1| hypothetical protein EUTSA_v10005089mg [Eutrema salsugineum]
 gb|ESQ31415.1| hypothetical protein EUTSA_v10005089mg [Eutrema salsugineum]
Length=143

 Score =   211 bits (537),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 127/159 (80%), Gaps = 17/159 (11%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL R TGHR+SMLRT+VSQLVKHERIETT+ K                 G+L AA
Sbjct  1    MTKFRKLGRHTGHRMSMLRTLVSQLVKHERIETTLTK-----------------GSLDAA  43

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRAAGFVRGDDV+HKLFTELA+RYK+RAGGYTR+LRT IRVGDAAPMA+IEFIDRENELR
Sbjct  44   RRAAGFVRGDDVIHKLFTELAHRYKDRAGGYTRMLRTHIRVGDAAPMAFIEFIDRENELR  103

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            QSKP TPQ P +  +DPW +SR +RQ+APPKEE S+ SE
Sbjct  104  QSKPATPQPPPQLPLDPWARSRHTRQYAPPKEETSSISE  142



>gb|KCW62282.1| hypothetical protein EUGRSUZ_H049412, partial [Eucalyptus grandis]
 gb|KCW62283.1| hypothetical protein EUGRSUZ_H049412, partial [Eucalyptus grandis]
Length=110

 Score =   204 bits (518),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            MTK RKL RP  HR+SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQ GKEGTL AA
Sbjct  1    MTKFRKLGRPAAHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQFGKEGTLHAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYI  343
            R+AA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYI
Sbjct  61   RQAAAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYI  110



>ref|XP_010937968.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Elaeis guineensis]
 gb|AGE46017.1| large subunit ribosomal protein L17 [Elaeis guineensis]
Length=153

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 112/127 (88%), Gaps = 3/127 (2%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHE---RIETTVAKAKEVRRLADNMVQLGKEGTL  184
            M K RKL RP  HR+SMLRTMVSQLVKHE   R  T   KAKEVRR+ADNMVQLGKEGTL
Sbjct  1    MAKFRKLGRPAAHRVSMLRTMVSQLVKHETTIRKPTVRQKAKEVRRVADNMVQLGKEGTL  60

Query  185  CAARRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDREN  364
             AARRAA FVRGDDVLHKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIEF+DREN
Sbjct  61   AAARRAAAFVRGDDVLHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEFVDREN  120

Query  365  ELRQSKP  385
            ELR++KP
Sbjct  121  ELREAKP  127



>ref|XP_010424710.1| PREDICTED: probable 39S ribosomal protein L17, mitochondrial 
[Camelina sativa]
Length=199

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 112/136 (82%), Gaps = 4/136 (3%)
 Frame = +2

Query  86   LVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVL----HKLFTEL  253
            LV+    ET   +AKEVRRLADNMVQLGKEG+L AARRAAGFV GDD++     K+FTEL
Sbjct  34   LVERSNKETLALQAKEVRRLADNMVQLGKEGSLAAARRAAGFVGGDDMMSSTHDKIFTEL  93

Query  254  AYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPPTPQLPQRPAMDPWTK  433
            AYRYK+RAGGYTR+LRTRIRVGDA PMAYIEFIDRE ELRQSKP TPQ PQR  +DPW +
Sbjct  94   AYRYKDRAGGYTRMLRTRIRVGDATPMAYIEFIDREIELRQSKPATPQPPQRVPLDPWER  153

Query  434  SRLSRQFAPPKEEKST  481
            SRL++Q+ P K+EK+ 
Sbjct  154  SRLTKQWMPEKKEKNV  169



>dbj|BAB09535.1| 50S ribosomal protein L17 [Arabidopsis thaliana]
Length=140

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 106/140 (76%), Gaps = 29/140 (21%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSM-----------------------------LRTMVSQLVKHERI  106
            MTK RKL RP GHR+SM                             LRTMVSQLVKHERI
Sbjct  1    MTKFRKLGRPAGHRMSMLRFSLQLFFLLRLTFFLDRNRLIFEVLVSLRTMVSQLVKHERI  60

Query  107  ETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTELAYRYKERAGGY  286
            ETTV KAKEVRRLADNM+QLGKEG+L AARRAAGFVRGDDVLHK+FTELA+RYK+RAGGY
Sbjct  61   ETTVTKAKEVRRLADNMIQLGKEGSLSAARRAAGFVRGDDVLHKIFTELAHRYKDRAGGY  120

Query  287  TRLLRTRIRVGDAAPMAYIE  346
            TRLLRTRIRVGDAAPMAYIE
Sbjct  121  TRLLRTRIRVGDAAPMAYIE  140



>ref|NP_001055758.1| Os05g0460700 [Oryza sativa Japonica Group]
 dbj|BAF17672.1| Os05g0460700 [Oryza sativa Japonica Group]
 dbj|BAG96015.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63988.1| hypothetical protein OsJ_18817 [Oryza sativa Japonica Group]
Length=196

 Score =   192 bits (489),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVR  AD MVQLGKEGTL AA
Sbjct  1    MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRTKADQMVQLGKEGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGD+V+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIE   +++ + 
Sbjct  61   RRASAFVRGDNVVHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEHSKKKSSVS  120

Query  374  QSKP  385
             +K 
Sbjct  121  FTKS  124



>gb|AAT39169.1| putative 50S ribsomal protein L17 [Oryza sativa Japonica Group]
Length=202

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVR  AD MVQLGKEGTL AA
Sbjct  1    MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRTKADQMVQLGKEGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGD+V+HKLFTELAYRYK+RAGGYTRLLRTRIRVGDAAPMAYIE   +++ + 
Sbjct  61   RRASAFVRGDNVVHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEHSKKKSSVS  120

Query  374  QSK  382
             +K
Sbjct  121  FTK  123



>ref|XP_001775616.1| predicted protein [Physcomitrella patens]
 gb|EDQ59563.1| predicted protein [Physcomitrella patens]
Length=151

 Score =   187 bits (474),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            +RKL R + HR ++LR +VSQLV+HERIETTV KAKE+RR+ADNMVQLGKEGTL A RRA
Sbjct  1    MRKLGRTSAHRWALLRNLVSQLVQHERIETTVPKAKELRRVADNMVQLGKEGTLAARRRA  60

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
            A  + GD+ LHK+F+ELA+RYK+RAGGYTR+L TR R GDAAPMAYIEF+DR NELR+SK
Sbjct  61   AAVIHGDENLHKVFSELAFRYKDRAGGYTRVLATRSRQGDAAPMAYIEFVDRPNELRESK  120

Query  383  PPTPQLPQRPAMDPWTKSRLSRQFAP  460
            PP      R  + PW ++R +R FAP
Sbjct  121  PPVTPPAPRVPLPPWLQARHARCFAP  146



>gb|EMS49654.1| 50S ribosomal protein L17 [Triticum urartu]
Length=135

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 111/160 (69%), Gaps = 26/160 (16%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M   RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGK+GTL AA
Sbjct  1    MGNFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKDGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGDDV+HKLFTELAYRYK                          F+DRENELR
Sbjct  61   RRASAFVRGDDVVHKLFTELAYRYK--------------------------FVDRENELR  94

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSEN  493
            ++KP TP  PQ   +DPWTKSR S+Q+A PK  +++ +E 
Sbjct  95   EAKPATPPPPQCAPLDPWTKSRASQQWAGPKVSQNSKTEG  134



>ref|XP_003630831.1| 50S ribosomal protein L17 [Medicago truncatula]
Length=438

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 108/140 (77%), Gaps = 7/140 (5%)
 Frame = +2

Query  74   MVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTEL  253
            + S  V HER +        +R       ++   G++C+ARRAA FVRGDDVLHKLFTEL
Sbjct  303  LSSNPVFHERTKHIEVDCHFIRE------KILSGGSVCSARRAASFVRGDDVLHKLFTEL  356

Query  254  AYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPPTPQLPQRPAMDPWTK  433
            AYRYK+R GGYTR+LRTRIRVGDAAPMAYIE IDR+NELRQSKPPTPQ PQR  +DPWT+
Sbjct  357  AYRYKDRTGGYTRVLRTRIRVGDAAPMAYIELIDRDNELRQSKPPTPQPPQRAPLDPWTR  416

Query  434  SRLSRQFAPPKEEKS-TDSE  490
            S L+RQFAPPK EKS +DS+
Sbjct  417  SHLTRQFAPPKGEKSDSDSD  436


 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKE  175
            MTK RKLNR T HR+SMLRTMVSQLV+HERIETT++KAKEVRR+ADNMVQLGKE
Sbjct  1    MTKFRKLNRETSHRISMLRTMVSQLVRHERIETTISKAKEVRRVADNMVQLGKE  54



>gb|KDO58349.1| hypothetical protein CISIN_1g0313082mg, partial [Citrus sinensis]
Length=92

 Score =   169 bits (427),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +2

Query  71   TMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTE  250
            TMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEG+LCAARRAA FVRGDDV+HKLFTE
Sbjct  1    TMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLCAARRAAAFVRGDDVIHKLFTE  60

Query  251  LAYRYKERAGGYTRLLRTRIRVGDAAPMAYIE  346
            LAYRYK+RAGGYTRLLR+RIRVGDAAPMAYIE
Sbjct  61   LAYRYKDRAGGYTRLLRSRIRVGDAAPMAYIE  92



>ref|XP_005645443.1| ribosomal protein L17 [Coccomyxa subellipsoidea C-169]
 gb|EIE20899.1| ribosomal protein L17 [Coccomyxa subellipsoidea C-169]
Length=157

 Score =   169 bits (427),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 102/130 (78%), Gaps = 4/130 (3%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R L R   HR S+LRTMVSQLV+HERIETTVAKAKE+R+LAD ++  GKEG L A R+AA
Sbjct  8    RNLGRTVAHRWSLLRTMVSQLVRHERIETTVAKAKELRKLADRVITWGKEGDLHARRKAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKP  385
              VRGDDVL K+FTE+A RYK+R GGYTR+LRTR R  DAA MAYIE++DR+ ELR ++P
Sbjct  68   AVVRGDDVLQKVFTEMAERYKDRDGGYTRILRTRQRTNDAAHMAYIEYVDRDGELRPARP  127

Query  386  P----TPQLP  403
            P    +P LP
Sbjct  128  PPGRQSPFLP  137



>ref|XP_005849683.1| hypothetical protein CHLNCDRAFT_17719, partial [Chlorella variabilis]
 gb|EFN57581.1| hypothetical protein CHLNCDRAFT_17719, partial [Chlorella variabilis]
Length=121

 Score =   164 bits (416),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
             RKL R + HR SMLRTMVSQL++HERIETTV KAKE+RR+AD MV LGK+G L A RRA
Sbjct  1    FRKLRRTSAHRWSMLRTMVSQLIRHERIETTVQKAKELRRIADQMVTLGKQGDLHARRRA  60

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
            A  V GD  LHKLFT+LA RY++R GGYTR+LRT +R GDAA MA+IE++DR  ELR ++
Sbjct  61   AAVVNGDAELHKLFTQLAERYRDRDGGYTRILRTDVRQGDAAQMAFIEYVDRPGELRPAR  120

Query  383  P  385
            P
Sbjct  121  P  121



>gb|EMT26656.1| Riboflavin biosynthesis protein ribBA, chloroplastic [Aegilops 
tauschii]
Length=691

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 101/146 (69%), Gaps = 26/146 (18%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M   RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGK+GTL AA
Sbjct  1    MGNFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKDGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
            RRA+ FVRGDDV+HKLFTELAYRYK                          F+DRENELR
Sbjct  61   RRASAFVRGDDVVHKLFTELAYRYK--------------------------FVDRENELR  94

Query  374  QSKPPTPQLPQRPAMDPWTKSRLSRQ  451
            ++KP TP  PQR  +DPWTKS  S+ 
Sbjct  95   EAKPATPPPPQRAPLDPWTKSHASQH  120



>gb|KJB14704.1| hypothetical protein B456_002G138500 [Gossypium raimondii]
Length=91

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +2

Query  74   MVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTEL  253
            MVSQLVKHERIETTVAK KE+RRL DNMVQLGKEG+  AAR AA FVR  DV+HKLFTEL
Sbjct  1    MVSQLVKHERIETTVAKEKEIRRLGDNMVQLGKEGSYFAARHAAAFVREYDVIHKLFTEL  60

Query  254  AYRYKERAGGYTRLLRTRIRVGDAAPMAYIE  346
            AYRYK+RA GYTRLLRTRIRVGD APMAYIE
Sbjct  61   AYRYKDRASGYTRLLRTRIRVGDVAPMAYIE  91



>ref|XP_007512842.1| 50S ribosomal protein L17 [Bathycoccus prasinos]
 emb|CCO17442.1| 50S ribosomal protein L17 [Bathycoccus prasinos]
Length=168

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 4/133 (3%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKL R + HR +MLRTM  QL++HERIETTV KAKE+RR+AD M+ LGKEGTL A RRA
Sbjct  8    LRKLGRDSAHRWAMLRTMADQLIQHERIETTVPKAKELRRVADKMITLGKEGTLSARRRA  67

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R D  L KLF  LA RY+ R+GGYTR+ +TRIRVGDAA MAYIE+IDR  ELR   
Sbjct  68   KAILRTDASLIKLFGPLAERYEGRSGGYTRVTQTRIRVGDAAKMAYIEYIDRVGELR---  124

Query  383  PPTPQLPQRPAMD  421
             PT    +R + D
Sbjct  125  -PTRSSGKRNSGD  136



>ref|XP_009409623.1| PREDICTED: LOW QUALITY PROTEIN: probable 39S ribosomal protein 
L17, mitochondrial [Musa acuminata subsp. malaccensis]
Length=93

 Score =   151 bits (382),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 81/95 (85%), Gaps = 2/95 (2%)
 Frame = +2

Query  62   MLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKL  241
            MLRTMVSQLVKHERIETTVAKAK+VRR+ADNMVQLGK G       AA FVRGDDVLHKL
Sbjct  1    MLRTMVSQLVKHERIETTVAKAKQVRRIADNMVQLGKAGYTSCCMCAAAFVRGDDVLHKL  60

Query  242  FTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIE  346
            FTELAYRYK   GGYTRLL T IR+GDAAPMAYI+
Sbjct  61   FTELAYRYK--FGGYTRLLXTFIRMGDAAPMAYIK  93



>ref|XP_002500495.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61753.1| predicted protein [Micromonas sp. RCC299]
Length=177

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
             RKL +   HR +M+RTMV+QL++HERI+TTVAKAKE+RR+AD +V   KEG+L A R+A
Sbjct  7    FRKLGKDASHRWAMMRTMVTQLIEHERIQTTVAKAKELRRVADRVVTFAKEGSLRARRKA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
            A  VR D +++KLFTELA RYKER GG+TR+L+   R  D+A MAYIE++DR+ ELR ++
Sbjct  67   AAVVRTDAMVNKLFTELAERYKERPGGFTRVLQIGQRKSDSAAMAYIEYVDRDGELRPAR  126

Query  383  PPT  391
            P T
Sbjct  127  PAT  129



>gb|EMS61388.1| 50S ribosomal protein L17 [Triticum urartu]
Length=138

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGK+GTL AA
Sbjct  1    MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKDGTLDAA  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYK  268
            RRA+ FVRGDDV+HKLFTELAYRYK
Sbjct  61   RRASAFVRGDDVVHKLFTELAYRYK  85



>ref|XP_002946893.1| mitochondrial ribosomal protein L17 [Volvox carteri f. nagariensis]
 gb|EFJ52119.1| mitochondrial ribosomal protein L17 [Volvox carteri f. nagariensis]
Length=187

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    TRSTMTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGT  181
             R  +    +LNR   HR+SM++TMV+QL++ ERI TT+AKAK ++R AD ++ LGK+GT
Sbjct  4    VRLRLGNWNRLNRKWEHRVSMMKTMVTQLLEKERIRTTLAKAKTLQRYADKVITLGKKGT  63

Query  182  LCAARRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
              A  +A G +R D  LHKLFT++A RY+ER GG+TRL+R   R  DAAP+A+IE +DR 
Sbjct  64   RDAWIQARGIIRTDRELHKLFTQIALRYRERPGGFTRLVRAGWRERDAAPVAFIELVDRP  123

Query  362  NELRQSKPPTPQL  400
             ELR ++PP P +
Sbjct  124  GELRPARPPLPHI  136



>ref|XP_005539469.1| mitochondrial ribosomal protein L17 precursor [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM83433.1| mitochondrial ribosomal protein L17 precursor [Cyanidioschyzon 
merolae strain 10D]
Length=139

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKL R + HRL++LR +VS L++HE IETTVAKAKE+RR+AD MV LGK G   +  RA
Sbjct  7    LRKLGRDSAHRLALLRNLVSSLIEHESIETTVAKAKELRRVADKMVTLGKRGDGLSRIRA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID  355
             GFVRG  ++ KLF  LA RY+ER GGYTR++R+R R GD APMA +E +D
Sbjct  67   LGFVRGPHLVQKLFRTLAERYRERNGGYTRVMRSRNRRGDNAPMAIVELVD  117



>ref|XP_008875357.1| ribosomal protein L17 [Aphanomyces invadans]
 gb|ETV96046.1| ribosomal protein L17 [Aphanomyces invadans]
Length=134

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
             R+L RPTGHRL++LR  V+ L++HERI+TT+ KAKE+RRLAD ++ L K+  L A R A
Sbjct  7    FRRLGRPTGHRLALLRNQVTSLIEHERIQTTLPKAKELRRLADQVITLAKKNDLPARREA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
             G VR   +  KLF  L  RY++RAGGYTR+L++  R GD A MA IE+IDR  ELR+ +
Sbjct  67   EGIVRTKPMFDKLFDVLGPRYEDRAGGYTRILKSGFRYGDNAEMAVIEYIDRPGELRRPR  126

Query  383  PPT  391
            P T
Sbjct  127  PGT  129



>gb|KDD74995.1| ribosomal protein L17 [Helicosporidium sp. ATCC 50920]
Length=120

 Score =   131 bits (329),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  74   MVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTEL  253
            MVSQL++H+RIETT+ KAKE+RR+AD++V LGKE +L A R+A   VRG+  +H+LFTE+
Sbjct  1    MVSQLIEHQRIETTIQKAKELRRVADHVVTLGKEDSLHARRQAMAIVRGEQNVHRLFTEM  60

Query  254  AYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKP  385
              RY+ RAGGYTR+LRT+ R  DAA MA+IEF+DR  ELR ++P
Sbjct  61   NERYRFRAGGYTRILRTQNRPNDAAEMAFIEFVDRPGELRPARP  104



>ref|XP_001702909.1| mitochondrial ribosomal protein L17 [Chlamydomonas reinhardtii]
 gb|EDO96762.1| mitochondrial ribosomal protein L17, partial [Chlamydomonas reinhardtii]
Length=136

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 92/128 (72%), Gaps = 4/128 (3%)
 Frame = +2

Query  29   KLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAG  208
            +LNR   HR+SM++TMV+QL++ ERI TT+AKAK ++R AD ++ LGK+GT  A   A G
Sbjct  13   RLNRKWQHRVSMMKTMVTQLLEKERIRTTLAKAKTLQRYADKVITLGKQGTREAWSEARG  72

Query  209  FVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPP  388
             VR D  LHKLFT++A RY+ER GG+TRL+R   R  DAAP+A++E +DR  ELR   P 
Sbjct  73   IVRTDRELHKLFTQVALRYRERPGGFTRLVRAGWRERDAAPVAFVELVDRPGELR---PA  129

Query  389  TPQLPQRP  412
             P L QRP
Sbjct  130  NPAL-QRP  136



>ref|XP_002996979.1| 50S ribosomal protein L17, putative [Phytophthora infestans T30-4]
 gb|EEY70259.1| 50S ribosomal protein L17, putative [Phytophthora infestans T30-4]
Length=146

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 87/123 (71%), Gaps = 0/123 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
             RKLNR + HR +MLRTMV+QL++HERI TT+ KAKE+RR+AD +V + K+G   A +RA
Sbjct  7    FRKLNRTSAHREAMLRTMVTQLIEHERIRTTLPKAKELRRIADKVVTMAKQGDEPARKRA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R  + L KLF  +  RY  R GGYTR+L+   R GD A MA IE++DR  E+R++K
Sbjct  67   QSVLRTPEALTKLFDVVGPRYALREGGYTRILKADFRKGDGAEMAVIEYVDRPGEMRKAK  126

Query  383  PPT  391
            PPT
Sbjct  127  PPT  129



>gb|EMT03307.1| hypothetical protein F775_52218 [Aegilops tauschii]
Length=581

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKE-GTLCA  190
            M K RKL R   HR+SMLRTMVSQLVKHERIETTVAKAKEVRR AD MVQLGK+ GTL A
Sbjct  1    MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKDNGTLDA  60

Query  191  ARRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENEL  370
            ARRA+ FVRGDDV+HKLFTELAYRYK     +  ++   + V +      I  ++R  +L
Sbjct  61   ARRASAFVRGDDVVHKLFTELAYRYKTFRPAFAYVVSNTLPVQEDFCQRII--VNRIIQL  118

Query  371  RQSKPPT  391
            R + PP 
Sbjct  119  RFAIPPV  125



>gb|ABD51937.1| chloroplast 50S ribosomal protein 17 [Guillardia theta]
Length=252

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = +2

Query  20   KLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARR  199
            K  KLNRP   R++MLR M + L+ +ERI+TTVA+AK +RR+AD MV L K+GTL A R+
Sbjct  97   KKNKLNRPYDRRMAMLRNMATDLIMYERIKTTVARAKALRRVADRMVTLAKQGTLMARRQ  156

Query  200  AAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRI-RVGDAAPMAYIEFIDRENELRQ  376
              GF+R  + + KLF +L  RY +R GGYTR++R    R GD A MA+IE+IDRE ELR 
Sbjct  157  LGGFLRTGESISKLFLDLVPRYAQRHGGYTRIVRCIAPRKGDNADMAWIEYIDREGELRP  216

Query  377  SKPPTPQLP  403
             KP   +LP
Sbjct  217  CKPAATRLP  225



>ref|WP_028580614.1| 50S ribosomal protein L17 [Desulfobulbus japonicus]
Length=130

 Score =   129 bits (324),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL + T HR +MLR MV+ L++HERI TTV KAKE RR+A+ M+ LGK G L A R+A 
Sbjct  8    RKLGKTTSHRKAMLRNMVTSLLEHERIVTTVPKAKEARRMAEKMITLGKRGDLHAKRQAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENEL  370
             ++R  DV+ KLF EL+ +Y +R GGYTR++RT  R GDAAPMA +E +D  + +
Sbjct  68   AYIRSRDVVAKLFDELSQQYADRQGGYTRIIRTGFRQGDAAPMAIVELVDYNDSI  122



>emb|CCQ74581.1| 50S ribosomal subunit protein L17 [Magnetospira sp. QH-2]
Length=144

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HR +M   M   L+ HE+I+TT+ KAK++R+ AD M+ LGK G L A R+A 
Sbjct  8    RKLNRTSTHRKAMFANMTVSLLTHEQIKTTLPKAKDLRKFADKMISLGKRGDLHARRQAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
             F+R D+ + KLF+ LA RYKER GGYTR+L+   R GDAAPMA+IE +DR+ E +
Sbjct  68   SFLRSDEAVSKLFSTLADRYKERPGGYTRVLKAGFRYGDAAPMAFIELVDRDPEAK  123



>ref|WP_010943458.1| 50S ribosomal protein L17 [Geobacter sulfurreducens]
 ref|NP_953873.1| 50S ribosomal protein L17 [Geobacter sulfurreducens PCA]
 sp|Q749B4.1|RL17_GEOSL RecName: Full=50S ribosomal protein L17 [Geobacter sulfurreducens 
PCA]
 gb|AAR36223.1| ribosomal protein L17 [Geobacter sulfurreducens PCA]
 gb|ADI85583.1| ribosomal protein L17 [Geobacter sulfurreducens KN400]
Length=175

 Score =   130 bits (327),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 4/157 (3%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HR++M R MV+ L  HERI TT AKAKE+R +A+ M+ LGK G L A R+AA
Sbjct  8    RRLGRTTSHRIAMFRNMVTSLFAHERITTTDAKAKELRSIAEKMITLGKRGDLHAVRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR--ENELRQS  379
             ++R   V+ KLF+ +A RYKER GGYTR+++  IR GD AP++ IE ++   E ++++S
Sbjct  68   SYIRDKKVVTKLFSTIAPRYKERDGGYTRIIKLGIRPGDCAPLSVIELVEEQFEKKVKKS  127

Query  380  KPPTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTDSE  490
            KP  P   Q  A  P  +       A P+E +   SE
Sbjct  128  KPTAPA--QAVATKPAVEETREAAAAQPQEPEVEISE  162



>ref|XP_011396884.1| 50S ribosomal protein L17 [Auxenochlorella protothecoides]
 gb|KFM24006.1| 50S ribosomal protein L17 [Auxenochlorella protothecoides]
Length=124

 Score =   129 bits (323),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  74   MVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTEL  253
            MVSQLV+HERIETT+ KAKE+RR+AD +V LGKE +  A R+A   +RGD  +HK+F+ L
Sbjct  1    MVSQLVEHERIETTLPKAKELRRVADQVVTLGKEASQHARRQAMAILRGDAEVHKVFSVL  60

Query  254  AYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPPTP  394
            A RY +R GGYTR+LRT+ R  DAA MA+IEF+DR  ELR ++P  P
Sbjct  61   AQRYSQRDGGYTRVLRTQQRGNDAAQMAFIEFVDRPGELRPARPGRP  107



>gb|EWM27294.1| ribosomal protein l17 [Nannochloropsis gaditana]
Length=157

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R + HR +MLR MV+ LV+HERI TT AKAKE+RR+AD MV   K+G+L A R+AA
Sbjct  4    RKLGRTSSHRWAMLRNMVTSLVEHERIRTTTAKAKELRRVADRMVTWAKDGSLHARRQAA  63

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLR-TRIRVGDAAPMAYIEFIDRENELRQSK  382
              +R  + L KLF  L  RY  RAGGYTR+L+  R R GDAA M+ IEF+ R  ELR ++
Sbjct  64   MVIRTKEHLKKLFDVLGPRYLTRAGGYTRVLKLQRFRPGDAAEMSLIEFVGRPGELRPAR  123

Query  383  PPTPQL  400
            PP  ++
Sbjct  124  PPQTEI  129



>ref|XP_005829561.1| hypothetical protein GUITHDRAFT_158129 [Guillardia theta CCMP2712]
 gb|EKX42581.1| hypothetical protein GUITHDRAFT_158129 [Guillardia theta CCMP2712]
Length=289

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = +2

Query  20   KLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARR  199
            K  KLNRP   R++MLR M + L+ +ERI+TTVA+AK +RR+AD MV L K+GTL A R+
Sbjct  97   KKNKLNRPYDRRMAMLRNMATDLIMYERIKTTVARAKALRRVADRMVTLAKQGTLMARRQ  156

Query  200  AAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRI-RVGDAAPMAYIEFIDRENELRQ  376
              GF+R  + + KLF +L  RY +R GGYTR++R    R GD A MA+IE+IDRE ELR 
Sbjct  157  LGGFLRTGESISKLFLDLVPRYAQRHGGYTRIVRCIAPRKGDNADMAWIEYIDREGELRP  216

Query  377  SKPPTPQLP  403
             KP   +LP
Sbjct  217  CKPAATRLP  225



>ref|XP_009531485.1| Mitochondrial/chloroplast ribosomal protein L17 [Phytophthora 
sojae]
 gb|EGZ14056.1| Mitochondrial/chloroplast ribosomal protein L17 [Phytophthora 
sojae]
Length=148

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 87/123 (71%), Gaps = 0/123 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
             RKLNR + HR +MLRTMV+QL++HERI TT+ KAKE+RR+A+ +V + K+G   A +RA
Sbjct  7    FRKLNRTSAHRQAMLRTMVTQLIEHERIRTTLPKAKELRRVAEQVVTMAKQGDEPARKRA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R  + + KLF  +  RY  R GGYTR+L+   R GD A MA IE++DR  E+R++K
Sbjct  67   QSILRTPEAVTKLFDVVGPRYALREGGYTRILKADFRKGDGAEMAVIEYVDRPGEMRKAK  126

Query  383  PPT  391
            PPT
Sbjct  127  PPT  129



>ref|XP_008893619.1| ribosomal protein L17 [Phytophthora parasitica INRA-310]
 gb|ETI44738.1| ribosomal protein L17 [Phytophthora parasitica P1569]
 gb|ETK84722.1| ribosomal protein L17 [Phytophthora parasitica]
 gb|ETL38155.1| ribosomal protein L17 [Phytophthora parasitica]
 gb|ETL91261.1| ribosomal protein L17 [Phytophthora parasitica]
 gb|ETM44582.1| ribosomal protein L17 [Phytophthora parasitica]
 gb|ETN21902.1| ribosomal protein L17 [Phytophthora parasitica INRA-310]
 gb|ETO73365.1| ribosomal protein L17 [Phytophthora parasitica P1976]
 gb|ETP14548.1| ribosomal protein L17 [Phytophthora parasitica CJ01A1]
 gb|ETP42628.1| ribosomal protein L17 [Phytophthora parasitica P10297]
Length=146

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 87/123 (71%), Gaps = 0/123 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
             RKLNR + HR +MLRTMV+QL++HERI TT+ KAKE+RR+A+ +V + K+G   A +RA
Sbjct  7    FRKLNRTSAHREAMLRTMVTQLIEHERIRTTLPKAKELRRVAEKVVTMAKQGDEPARKRA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R  + + KLF  +  RY  R GGYTR+L+   R GD A MA IE++DR  E+R++K
Sbjct  67   QSILRTPEAVTKLFDVVGPRYALREGGYTRILKADFRKGDGAEMAVIEYVDRPGEMRKAK  126

Query  383  PPT  391
            PPT
Sbjct  127  PPT  129



>ref|XP_009830689.1| ribosomal protein L17 [Aphanomyces astaci]
 gb|ETV79753.1| ribosomal protein L17 [Aphanomyces astaci]
Length=134

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
             R+L RPT HRL++LR  V+ L++HERI+TT+ KAKE+RRLAD ++ L K+  L A R A
Sbjct  7    FRRLGRPTEHRLALLRNQVTSLIEHERIQTTLPKAKELRRLADQVITLAKQNDLPARREA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R   +  KLF  L  RY++RAGGYTR+L++  R GD A MA IE+IDR  ELR+ +
Sbjct  67   ESIIRTKPMFDKLFDVLGPRYEDRAGGYTRILKSGFRYGDNAEMAVIEYIDRPGELRRPR  126

Query  383  P  385
            P
Sbjct  127  P  127



>ref|XP_008620271.1| 50S ribosomal protein L17 [Saprolegnia diclina VS20]
 gb|EQC26276.1| 50S ribosomal protein L17 [Saprolegnia diclina VS20]
 gb|KDO22987.1| 50S ribosomal protein L17 [Saprolegnia parasitica CBS 223.65]
Length=138

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            +R+L R   HR +MLR  V+ L++HERI TT+ KAKE+RR+A+ +V L K+  +CA R+A
Sbjct  7    MRRLGRDGEHRWAMLRNQVTSLIEHERIRTTLPKAKELRRVAEQVVTLAKQNDICARRQA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
             G VR      KLF  L  RY +RAGGYTR+++   R GD A MA IE+IDR  ELR++K
Sbjct  67   QGIVRTKTEFDKLFDTLGPRYMDRAGGYTRIVKADFRYGDNAEMAVIEYIDRPGELRRAK  126

Query  383  PPTPQLPQR  409
            P T  L ++
Sbjct  127  PGTAHLAKK  135



>ref|WP_027983566.1| 50S ribosomal protein L17 [delta proteobacterium JGI 0000059-O15]
Length=183

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R T HR +MLR MV+  +KHE+IETT  KAKE+RR+AD M+ L KEG L A R+AA
Sbjct  8    RKLGRTTSHRTAMLRNMVTSFLKHEKIETTDVKAKELRRVADRMITLAKEGGLHARRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
              +R  DV+ KLF E+  R+ +R GGYTR+++T  R GD+APMA IE +
Sbjct  68   ALIRDKDVVKKLFDEIGTRFADRQGGYTRIVKTGFRAGDSAPMAVIELM  116



>ref|WP_028585161.1| 50S ribosomal protein L17 [Desulfobulbus mediterraneus]
Length=126

 Score =   127 bits (318),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R T HR +MLR MV+ L++HERI TTV KAKE RR+A+ M+ LGK G L A R+A 
Sbjct  8    RKLGRTTAHRKAMLRNMVTSLLEHERIVTTVPKAKEARRMAEKMITLGKRGDLHAKRQAL  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
             ++R  DV+ KLF +L+ +Y +R GGYTR++RT  R GDAAPMA +E +
Sbjct  68   SYIRSKDVVAKLFDQLSEQYADRQGGYTRIIRTGFRSGDAAPMAIVELV  116



>ref|WP_039646455.1| 50S ribosomal protein L17 [Geobacter sp. GSS01]
 gb|KIE43201.1| 50S ribosomal protein L17 [Geobacter sp. GSS01]
Length=175

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 93/136 (68%), Gaps = 4/136 (3%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HR++M R MV+ L  HERI TT AKAKE+R +A+ M+ LGK G L A R+AA
Sbjct  8    RRLGRTTSHRIAMFRNMVTSLFAHERITTTDAKAKELRSIAEKMITLGKRGDLHAVRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR--ENELRQS  379
             ++R   V+ KLF+ +A RY ER GGYTR+++  IR GD AP++ IE ++   E ++++S
Sbjct  68   SYIRDKKVVTKLFSTIAPRYTEREGGYTRIIKLGIRPGDCAPLSVIELVEEQFEKKVKKS  127

Query  380  KPPTP--QLPQRPAMD  421
            KP  P   +  +PA++
Sbjct  128  KPAAPAQAVSAKPAVE  143



>ref|WP_011712551.1| 50S ribosomal protein L17 [Magnetococcus marinus]
 sp|A0L5Z9.1|RL17_MAGSM RecName: Full=50S ribosomal protein L17 [Magnetococcus marinus 
MC-1]
 gb|ABK43392.1| LSU ribosomal protein L17P [Magnetococcus marinus MC-1]
Length=126

 Score =   126 bits (316),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L+R T HR +M++ M+  L KHERIETTV +AKE+R +A+ ++ LGK G L A R+A 
Sbjct  8    RRLSRDTSHRQAMIKNMLVSLFKHERIETTVPRAKELRPVAEKVITLGKRGDLHARRQAL  67

Query  206  GFVRGD-DVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
              + GD +V+HKLFT+LA R K+R GGYTR+L+TR R GD APM++IE ++R+
Sbjct  68   SILNGDKEVVHKLFTDLAERNKDRQGGYTRILKTRFRYGDCAPMSFIELVERD  120



>ref|WP_013163647.1| 50S ribosomal protein L17 [Desulfurivibrio alkaliphilus]
 gb|ADH86119.1| ribosomal protein L17 [Desulfurivibrio alkaliphilus AHT2]
Length=132

 Score =   126 bits (316),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +2

Query  29   KLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAG  208
            +L+R T HR +M+R MV+ L++HERI TTVAKAKEVR++AD M+ LGK G L A R+A  
Sbjct  9    RLSRTTPHRQAMIRNMVTSLLQHERIVTTVAKAKEVRKVADKMITLGKRGDLHARRQALA  68

Query  209  FVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID-RENELRQSKP  385
             VR   V+ KLF  L+  YKERAGGYTR++RT  RVGDAA MA +E ++ +E E + S+ 
Sbjct  69   VVRDKKVVAKLFDTLSQEYKERAGGYTRIIRTGQRVGDAASMAILEMVNYQEKEDQASEA  128

Query  386  PTPQ  397
               +
Sbjct  129  AAAE  132



>ref|WP_019374700.1| 50S ribosomal protein L17 [Alicycliphilus sp. CRZ1]
Length=132

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR T HRL+MLR M++ L++HE I+TTV KAKE+RR+ + M+ L KE T+   R A
Sbjct  7    LRKLNRTTSHRLAMLRNMMNSLIEHEAIKTTVPKAKELRRVIEPMITLAKEDTVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENE  367
               +R  D + KLF EL  R+K R GGYTR+L+   RVGD APMAY+EF++R  E
Sbjct  67   FDRLRNRDSVTKLFNELGPRFKARPGGYTRILKMGFRVGDNAPMAYVEFVERAEE  121



>ref|WP_013902949.1| 50S ribosomal protein L17 [Ramlibacter tataouinensis]
 gb|AEG94719.1| Candidate 50S ribosomal protein L17 [Ramlibacter tataouinensis 
TTB310]
Length=134

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M++ L++HE I+TTV KAKE+RR+ + M+ L KE TL   R A
Sbjct  7    LRKLNRTSEHRLAMLRNMMNSLLQHEAIKTTVPKAKELRRVVEPMITLAKEPTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D++ KLFTEL  RYK R GGYTR+L+   RVGD APMA +E +DR
Sbjct  67   FDRLRDRDIVAKLFTELGPRYKARPGGYTRILKMGFRVGDNAPMALVELVDR  118



>ref|WP_028319777.1| 50S ribosomal protein L17 [Desulfobulbus elongatus]
Length=131

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R + HR +MLR MV+ L+  ERI TTVAKAKE RR+A+ M+ LGK+G L A R+A 
Sbjct  8    RRLGRTSSHRDAMLRNMVTSLLDQERIVTTVAKAKEARRVAEQMITLGKKGDLHARRQAL  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID  355
             ++R   ++ KLF +L+ +Y ER GGYTR++RT  R+GDAAPMA +E +D
Sbjct  68   AYIRSKSIVAKLFDQLSSQYAERKGGYTRIIRTGSRMGDAAPMAILELVD  117



>ref|XP_002961732.1| hypothetical protein SELMODRAFT_76301 [Selaginella moellendorffii]
 gb|EFJ36992.1| hypothetical protein SELMODRAFT_76301 [Selaginella moellendorffii]
Length=135

 Score =   124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 85/128 (66%), Gaps = 21/128 (16%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLR---------------------TMVSQLVKHERIETTVAKAKEVRR  142
            RKL R   HR +MLR                     TMVSQL++HERIETT+AKAKEVRR
Sbjct  8    RKLGRTAEHRWAMLRYVPCFLSSHRVTRLWIRSLHRTMVSQLIEHERIETTLAKAKEVRR  67

Query  143  LADNMVQLGKEGTLCAARRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGD  322
            LAD M+ LGK GTL A RRA   +R D+ +HK+F +LA RY +R GGYTR+++TR R+GD
Sbjct  68   LADKMITLGKAGTLSAIRRAGAVLRTDETVHKVFYKLAPRYADRHGGYTRVVQTRHRLGD  127

Query  323  AAPMAYIE  346
             + MA++E
Sbjct  128  KSMMAFLE  135



>ref|WP_011734650.1| 50S ribosomal protein L17 [Pelobacter propionicus]
 sp|A1ALW8.1|RL17_PELPD RecName: Full=50S ribosomal protein L17 [Pelobacter propionicus 
DSM 2379]
 gb|ABK98338.1| LSU ribosomal protein L17P [Pelobacter propionicus DSM 2379]
Length=127

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HR +M R MV+ L  HE+I TT AKAKE+R +A+ M+ LGK G L + R AA
Sbjct  8    RRLGRKTSHREAMFRNMVTSLFAHEKITTTDAKAKEIRSVAEKMITLGKRGDLHSTRIAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
             F+R   V+ KLF+ +A RYKERAGGYTR+++   R GDAAPM+ IE ++ E
Sbjct  68   AFIREKSVVTKLFSTIAPRYKERAGGYTRIIKVGSRNGDAAPMSIIELVEEE  119



>ref|WP_015723532.1| 50S ribosomal protein L17 [Desulfobulbus propionicus]
 gb|ADW16988.1| LSU ribosomal protein L17P [Desulfobulbus propionicus DSM 2032]
Length=131

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R   HR +MLR MV+ L++ ERI TTV KAKE RR+ + M+ LGK G L A R+A 
Sbjct  8    RKLGRTASHRDAMLRNMVTSLLEQERIVTTVTKAKEARRVTEQMITLGKRGDLHARRQAL  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDREN  364
             F+R   ++ KLF +L+ +Y ER GGYTR++RT  R+GDAAPMA +E +D ++
Sbjct  68   AFIRSKSIVAKLFDQLSNQYAERQGGYTRIIRTGTRLGDAAPMAILELVDYQD  120



>ref|WP_006001494.1| 50S ribosomal protein L17 [Desulfuromonas acetoxidans]
 gb|EAT15198.1| ribosomal protein L17 [Desulfuromonas acetoxidans DSM 684]
Length=123

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R + HR +MLR MV+ L+ HERI TT A+AKEVR++A+ M+ LGK G L A R+A 
Sbjct  8    RRLGRNSSHRAAMLRNMVTSLIDHERITTTDARAKEVRKIAEKMITLGKRGDLHARRQAL  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
              +R  +V+ KLF  LA R+ ERAGGYTR+++   R+GD AP++ IEF+D+E
Sbjct  68   SVIREKEVVAKLFDRLAPRFSERAGGYTRIIKVGNRLGDNAPVSIIEFVDQE  119



>emb|CCA20129.1| 50S ribosomal protein L17 putative [Albugo laibachii Nc14]
Length=146

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  50   HRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDV  229
            H  S  RTMV+QL++HERI TT+ KAKE+RR+AD +V L KE T  + RRA G +R    
Sbjct  18   HNKSANRTMVTQLIEHERIRTTLPKAKELRRVADQVVTLAKEATESSRRRAQGILRTPLA  77

Query  230  LHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPP  388
            + KLF +L  RY+ RAGGYTR+L+   R GD A MA IE+IDR  E+R+SKPP
Sbjct  78   MEKLFKQLGPRYELRAGGYTRVLKADFRRGDGAEMAVIEYIDRPGEIRRSKPP  130



>ref|WP_015719200.1| 50S ribosomal protein L17 [Geobacter sp. M18]
 gb|ADW12339.1| ribosomal protein L17 [Geobacter sp. M18]
Length=167

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HR++M R MV+  ++HE+I TT AKAKE+R +A+ M+ LGK+G L A R+AA
Sbjct  8    RRLGRTTSHRIAMFRNMVTSFLQHEKITTTDAKAKELRSIAEKMITLGKKGDLHATRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
             ++R   V+ KLFTE+A RY ER GGYTR+++  IR GD AP++ IE ++ E
Sbjct  68   AYIRDKKVVTKLFTEIAPRYAERPGGYTRIIKLGIRPGDTAPVSVIELVEAE  119



>ref|WP_027101763.1| 50S ribosomal protein L17 [Comamonadaceae bacterium URHA0028]
Length=134

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M++ L++HE I+TTV KAKE+RR+ + M+ L KE TL   R A
Sbjct  7    LRKLNRTSEHRLAMLRNMMNSLLEHEVIKTTVPKAKELRRVVEPMITLAKEPTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D++ KLF EL  RYK R GGYTR+L+   RVGD APMA +E +DR
Sbjct  67   FDRLRDRDIVTKLFAELGPRYKARPGGYTRILKMGFRVGDNAPMALVELVDR  118



>ref|XP_003056069.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH59445.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=110

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +2

Query  59   SMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHK  238
            +MLRTMV+QL+ HERI+TTVAKAK++RR+AD +V L K+GT+   RRA   +R D+   K
Sbjct  1    NMLRTMVTQLITHERIKTTVAKAKDLRRVADRVVTLAKQGTIAGRRRARALLRTDEAEQK  60

Query  239  LFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPP  388
            LF  LA RYK+RAGG+TR+L+T  R  D+A MA+IEF+DRE E+R ++P 
Sbjct  61   LFYTLAARYKDRAGGFTRVLQTDQRRSDSAKMAFIEFVDREGEMRPARPA  110



>ref|WP_044399292.1| 50S ribosomal protein L17 [Acidovorax temperans]
 gb|KJA10048.1| 50S ribosomal protein L17 [Acidovorax temperans]
Length=130

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+ML+ M++ L++HE I+TTV KAKE+RR+ + M+ L KE ++   R A
Sbjct  7    LRKLNRTSSHRLAMLQNMMNSLIEHEAIKTTVPKAKELRRVIEPMITLAKEDSVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQS  379
               +R  D + KLF EL  R+K R GGYTR+L+   RVGD APMAY+E +DR  E   S
Sbjct  67   FNRLRDRDSVTKLFNELGPRFKARPGGYTRILKMGFRVGDNAPMAYVELVDRTAETENS  125



>gb|EIE77791.1| hypothetical protein RO3G_02495 [Rhizopus delemar RA 99-880]
Length=190

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            +R+LNR +GHR S+LR +VS L++H RIETTVAKAK ++ +AD MV LGK G + A ++A
Sbjct  7    VRRLNRSSGHRNSLLRNLVSSLIEHGRIETTVAKAKTIQPIADAMVTLGKRGDVEAKKQA  66

Query  203  AGFVRGDDV-LHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQ  376
             G++   DV + KLF ELA R+ +R GGYTR+ R   R GD APMA IE+ID   +L++
Sbjct  67   LGYLNSRDVTIPKLFNELAPRFADRQGGYTRIQRIGKRYGDNAPMAVIEYIDGPTDLKK  125



>ref|WP_011698440.1| 50S ribosomal protein L17 [Syntrophobacter fumaroxidans]
 sp|A0LIL8.1|RL17_SYNFM RecName: Full=50S ribosomal protein L17 [Syntrophobacter fumaroxidans 
MPOB]
 gb|ABK17270.1| LSU ribosomal protein L17P [Syntrophobacter fumaroxidans MPOB]
Length=151

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 93/153 (61%), Gaps = 9/153 (6%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR T HRL+M R MV+ L++HERI TT+ KAKE+RR AD M+ LGK G L A R+  
Sbjct  8    RKLNRATSHRLAMFRNMVTSLLQHERIFTTLPKAKELRRWADWMISLGKRGDLHARRQVM  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKP  385
              VR  + + K+F EL  RY+ R GGYTR+++   R GDA+PM  IE I    E +Q  P
Sbjct  68   ACVREKETVQKIFAELGPRYQSRPGGYTRIVKAGYRRGDASPMCLIELI---TEAKQ--P  122

Query  386  PTPQLPQRPAMDPWTKSRLSRQFAPPKEEKSTD  484
            P  +  ++PA  P      S    P  EEK+ D
Sbjct  123  PRKEKAKKPA--PVQAEEAS--ATPASEEKAQD  151



>ref|WP_022728241.1| 50S ribosomal protein L17 [Fodinicurvata sediminis]
Length=142

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 82/123 (67%), Gaps = 1/123 (1%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR T HR +M   M + L+KHE+I TT+ KAKE+RR+AD ++ LGK   L A R+AA
Sbjct  8    RKLNRKTQHRKAMFSNMATSLIKHEQIVTTLPKAKELRRIADRLITLGKRNNLHARRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR-QSK  382
              VR +  L KLF ELA RY+ R GGYTR+L+   R GD AP+A IE +DR  + + Q  
Sbjct  68   ITVRDNKQLQKLFGELAERYQSRNGGYTRVLKAGFRYGDMAPLAVIELVDRNPDAKGQDS  127

Query  383  PPT  391
             PT
Sbjct  128  GPT  130



>ref|WP_025511807.1| MULTISPECIES: 50S ribosomal protein L17 [Bacteria]
Length=131

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HR +MLR M + L++HE I+TTV KAKE+RR+ + ++ L KE TL   R A
Sbjct  7    LRKLNRTSEHRQAMLRNMCNSLLQHEAIKTTVPKAKELRRVVEPLITLAKEATLANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D++ KLF EL  RYK R GGYTR+L+   RVGD APMA++E +DR
Sbjct  67   FNRLRDRDIVTKLFNELGPRYKARPGGYTRILKMGFRVGDNAPMAFVELVDR  118



>ref|WP_006297859.1| 50S ribosomal protein L17 [Hylemonella gracilis]
 gb|EGI76902.1| 50S ribosomal protein L17 [Hylemonella gracilis ATCC 19624]
Length=128

 Score =   120 bits (302),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M++ L++HE I+TTV KAKE+RR+ + M+ L KE T+   R A
Sbjct  7    LRKLNRTSEHRLAMLRNMMNSLIEHEVIKTTVPKAKELRRVVEPMITLAKEATVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R  D + KLF EL  R+K R GGYTR+L+   RVGD APMA +E +DR  E  Q K
Sbjct  67   FDRLRSRDSVVKLFDELGPRFKARPGGYTRILKMGFRVGDNAPMALVELVDRPAEADQGK  126



>ref|WP_012469440.1| 50S ribosomal protein L17 [Geobacter lovleyi]
 sp|B3E858.1|RL17_GEOLS RecName: Full=50S ribosomal protein L17 [Geobacter lovleyi SZ]
 gb|ACD95095.1| ribosomal protein L17 [Geobacter lovleyi SZ]
Length=124

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HR++M R MV+ L+ HERI TT AKAKE+R +A+ M+ LGK G L A R+AA
Sbjct  8    RRLGRTTSHRIAMFRNMVTSLLNHERIVTTDAKAKEIRSVAEKMITLGKRGDLHAHRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID  355
             ++R   V+ KLF+ +A RYK+RAGGYTR+++   R+GDAA ++ IE ++
Sbjct  68   AYIREKSVVTKLFSTIAPRYKDRAGGYTRIIKLGQRLGDAASLSVIELVE  117



>ref|WP_007869297.1| 50S ribosomal protein L17 [Polaromonas sp. CF318]
 gb|EJL83622.1| ribosomal protein L17 [Polaromonas sp. CF318]
Length=133

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M++ L++HE I+TT+ KAKE+RR+ + M+ LGKE TL   R A
Sbjct  7    LRKLNRTSEHRLAMLRNMMNSLLQHEVIKTTLPKAKELRRVVEPMITLGKEPTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D++ KLF E+  RYK R GGYTR+L+   RVGD APMA +E +DR
Sbjct  67   FDRLRDRDMVVKLFAEIGPRYKARPGGYTRILKMGFRVGDNAPMALVELVDR  118



>ref|WP_028115046.1| 50S ribosomal protein L17 [Ferrimonas kyonanensis]
Length=132

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+LNR + HR +M R M S LV+HE I+TTV KAKE+RR+ + ++ L K  ++   R A 
Sbjct  8    RQLNRNSSHRQAMFRNMASSLVRHEIIKTTVPKAKELRRVVEPLITLAKTDSVANRRLAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               R +DV+ KLF EL  RY+ERAGGYTR+L+   R GD APMAYIE +DR
Sbjct  68   ARTRDNDVVSKLFNELGPRYQERAGGYTRILKCGFRAGDNAPMAYIELVDR  118



>ref|WP_018046557.1| 50S ribosomal protein L17 [Nitrospina sp. AB-629-B06]
Length=206

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 88/142 (62%), Gaps = 4/142 (3%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL RP+ HR ++ R MV+ L+  ERI TT+AKAKE+R   +  + LGK+GTL A R A 
Sbjct  8    RKLGRPSAHRKALFRNMVTALIDRERIRTTLAKAKELRGKVEKTITLGKKGTLHARRHAL  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKP  385
              V    VL K+F  LA RY  R GGYTR+++   R+GD APMA+IE +DRE EL    P
Sbjct  68   KLVADRGVLKKIFGPLAERYANRPGGYTRVIKLGHRLGDDAPMAFIELVDREGEL----P  123

Query  386  PTPQLPQRPAMDPWTKSRLSRQ  451
              P    +  ++  TK +++ Q
Sbjct  124  ANPSAKGKKKVEGATKKKVADQ  145



>ref|WP_013706393.1| 50S ribosomal protein L17 [Desulfobacca acetoxidans]
 gb|AEB09282.1| 50S ribosomal protein L17 [Desulfobacca acetoxidans DSM 11109]
Length=133

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L+R   HRL+M+R +V+ L++HER+ETT AKAKE+R+LA+ M+ L K+  L A R+A 
Sbjct  8    RQLSRTKEHRLAMMRNLVTSLLEHERLETTAAKAKELRQLAEQMITLAKKNDLHARRQAL  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQS  379
              VR  DV+ KLF+EL  RY ER+GGYTR++   +R+GDAAP++ IE + R  +++++
Sbjct  68   AVVRSKDVVFKLFSELRERYVERSGGYTRIIPKGLRLGDAAPISVIELLGRPEKIKRT  125



>ref|WP_015404308.1| 50S ribosomal protein L17 [Desulfocapsa sulfexigens]
 gb|AGF78618.1| LSU ribosomal protein L17P [Desulfocapsa sulfexigens DSM 10523]
Length=128

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HRL+M+R MV+ + +HERI TT  KAKEVR++ D M+ L K G L A R+A 
Sbjct  8    RRLGRTTSHRLAMVRNMVTSVFEHERIVTTTPKAKEVRKVVDKMITLAKRGDLHAKRQAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENEL  370
             F++  DV+ KLF E+A +Y +R GGYTR+++T  R GDAAPMA +E ++   E+
Sbjct  68   SFIQSRDVVAKLFDEIAGQYSDRNGGYTRIIQTGHRRGDAAPMAILELVNYSEEI  122



>ref|WP_026988126.1| 50S ribosomal protein L17 [Fodinicurvata fenggangensis]
Length=142

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 82/123 (67%), Gaps = 1/123 (1%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HR +M   M + L+KHE+I TT+ KAKE+RR+AD ++ LGK   L A R+AA
Sbjct  8    RKLNRKSQHRKAMFSNMATSLIKHEQIVTTLPKAKELRRIADRLITLGKRNNLHARRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR-QSK  382
              VR +  L KLF ELA RY+ R GGYTR+L+   R GD AP+A IE +DR  + + Q  
Sbjct  68   ITVRDNKQLQKLFGELAERYQSRNGGYTRVLKAGFRYGDMAPLAVIELVDRNPDAKGQDS  127

Query  383  PPT  391
             PT
Sbjct  128  GPT  130



>ref|WP_004514262.1| 50S ribosomal protein L17 [Geobacter metallireducens]
 sp|Q39XX8.1|RL17_GEOMG RecName: Full=50S ribosomal protein L17 [Geobacter metallireducens 
GS-15]
 gb|ABB30896.1| ribosomal protein L17 [Geobacter metallireducens GS-15]
 gb|EHP84791.1| ribosomal protein L17 [Geobacter metallireducens RCH3]
Length=178

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HR++M R MV+  ++HERI TT AKAKE+R +A+ M+ LGK G L A R+AA
Sbjct  8    RRLGRTTSHRIAMFRNMVTSFLEHERITTTDAKAKELRSIAEKMITLGKRGDLHAQRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
             ++R   V+ KLF+ +A RYKER GGYTR+++  IR GD AP++ IE ++ +
Sbjct  68   SYIRDKKVVTKLFSTIAPRYKERDGGYTRIIKLGIRPGDNAPLSVIELVEEQ  119



>ref|WP_019561691.1| 50S ribosomal protein L17 [Caldimonas manganoxidans]
Length=138

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M + L++HE I+TT+ KAKE+RR+ + ++ LGKE T+   R A
Sbjct  7    LRKLNRTSEHRLAMLRNMANALIEHEAIKTTLPKAKELRRIVEPLITLGKEPTVANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D + KLF  L  RYK R GGYTR+L+   RVGD APMAY+E +DR
Sbjct  67   FARLRNRDNVVKLFNVLGERYKTRPGGYTRILKMGFRVGDNAPMAYVELVDR  118



>ref|WP_023055879.1| 50S ribosomal protein L17 [Peptoniphilus sp. BV3C26]
 gb|ERT57579.1| ribosomal protein L17 [Peptoniphilus sp. BV3C26]
Length=113

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M KLRKL RPT HRL+MLR +V+  ++  +IETT+ +AKE RR+A+ M+ LGK G L A 
Sbjct  1    MAKLRKLGRPTDHRLAMLRNLVTSFLREGQIETTLTRAKETRRMAEKMISLGKRGDLHAR  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
            R+A  ++  +DV+ KLFTE+A +Y+ER GGYTR+L+   R GDAA +A ++ +
Sbjct  61   RQALAYIYDEDVVTKLFTEIAPKYQERNGGYTRILKKGPRRGDAAEVAILQLV  113



>ref|WP_012529394.1| 50S ribosomal protein L17 [Geobacter bemidjiensis]
 gb|ACH37982.2| ribosomal protein L17 [Geobacter bemidjiensis Bem]
Length=163

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HR++M R MV+  ++HE+I TT AKAKE+R +A+ M+ LGK G L A R+AA
Sbjct  8    RRLGRTTSHRIAMFRNMVTSFLQHEKITTTDAKAKELRSIAEKMITLGKRGDLHATRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
             ++R   V+ KLFTE+A RY ER GGYTR+++  IR GD AP++ +E ++ E
Sbjct  68   AYIRDKKVVTKLFTEIAPRYTERPGGYTRIIKLGIRPGDNAPVSVLELVEAE  119



>ref|WP_029013628.1| 50S ribosomal protein L17 [Niveispirillum irakense]
Length=142

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RK +R T HRL+M   M + L+KHE+I+TT+ KAK++R + + ++ LGK+G L A R+A 
Sbjct  8    RKFSRTTSHRLAMFSNMANALIKHEQIKTTLPKAKDLRPIVEKLITLGKKGGLSAKRQAY  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
              +R + V+ KLFT +A RYK+R GGYTR+L+   R GD APMA IEF+DR+
Sbjct  68   AELRDNAVVDKLFTVIAERYKDRNGGYTRVLKAGFRYGDNAPMAVIEFVDRD  119



>ref|WP_035610268.1| 50S ribosomal protein L17 [Hylemonella gracilis]
 gb|EYC52639.1| 50S ribosomal protein L17 [Hylemonella gracilis str. Niagara 
R]
Length=128

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M++ L++HE I+TTV KAKE+RR+ + M+ L KE T+   R A
Sbjct  7    LRKLNRTSEHRLAMLRNMMNSLIEHEVIKTTVPKAKELRRVVEPMITLAKEATVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R  D + KLF EL  R+K R GGYTR+L+   RVGD APMA +E +DR  +  ++K
Sbjct  67   FDRLRSRDSVVKLFDELGPRFKARPGGYTRILKMGFRVGDNAPMALVELVDRPADAEETK  126



>ref|WP_039740539.1| 50S ribosomal protein L17 [Geobacter pickeringii]
 gb|AJE02557.1| 50S ribosomal protein L17 [Geobacter pickeringii]
Length=172

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HR++M R MV+  + HERI TT AKAKE+R +A+ M+ LGK G L A R+AA
Sbjct  8    RRLGRTTSHRVAMFRNMVTSFLNHERITTTDAKAKELRSIAEKMITLGKRGDLHAMRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENE  367
             ++R   V+ KLF+ +A RY ERAGGYTR+++  IR GD AP++ IE ++   E
Sbjct  68   AYIRDKKVVTKLFSTIAPRYAERAGGYTRIIKLGIRPGDNAPLSIIELVEETVE  121



>emb|CBJ25670.1| chloroplast 50S ribosomal protein 17 [Ectocarpus siliculosus]
Length=154

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 84/123 (68%), Gaps = 1/123 (1%)
 Frame = +2

Query  17   TKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAAR  196
              + +L R   HRL+MLR MV+  + HERI TTV +AKE+R++ADNMV L K+GT    R
Sbjct  5    VNMHRLGRDMSHRLAMLRNMVTSFIYHERIRTTVPRAKELRKVADNMVTLAKKGTPHHQR  64

Query  197  RAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLR-TRIRVGDAAPMAYIEFIDRENELR  373
            +A G VR +  + KLF  L  RYK+R GGYTR+++  + R GD A MA IEF+DRE ELR
Sbjct  65   QAQGVVRENAAVVKLFEVLGPRYKDRPGGYTRVMKLQKPRKGDQADMAIIEFVDREGELR  124

Query  374  QSK  382
             ++
Sbjct  125  PAR  127



>ref|XP_009497965.1| 50S ribosomal protein L17 [Fonticula alba]
 gb|KCV67627.1| 50S ribosomal protein L17 [Fonticula alba]
Length=152

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +2

Query  32   LNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGF  211
            LNR +  R+ MLR MV+QL+KHERI TT AKAK ++ LA+ MV L K+GTL + R+A  F
Sbjct  10   LNRDSKSRMHMLRVMVTQLIKHERITTTHAKAKAIQPLAEKMVTLAKDGTLHSRRQALAF  69

Query  212  VRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID  355
            V    ++ KLF E A RY+ER+GGYTR+LR   R+GD AP + IEF+D
Sbjct  70   VNEPALVTKLFNEFAPRYRERSGGYTRVLRNGTRLGDRAPQSVIEFVD  117



>ref|WP_024078322.1| 50S ribosomal protein L17 [Magnetospirillum gryphiswaldense]
 emb|CAM77773.1| 50S ribosomal protein L17 [Magnetospirillum gryphiswaldense MSR-1]
 emb|CDK97278.1| 50S ribosomal subunit protein L17 [Magnetospirillum gryphiswaldense 
MSR-1 v2]
Length=139

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HR +M   MV+ L+KHE+I+TT+ KAK++R +A+ ++ LGK GTL   RRA 
Sbjct  8    RKLNRTSSHRKAMFSNMVTALLKHEQIKTTLPKAKDLRPIAEKIISLGKSGTLHDRRRAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
              +R D V+ KLF  +  RYK+R GGYTR+L+   R GD APMA IE +DR+
Sbjct  68   AILRDDAVVAKLFAVIGPRYKDRNGGYTRVLKAGFRYGDCAPMAVIELVDRD  119



>ref|WP_025596262.1| 50S ribosomal protein L17 [Comamonadaceae bacterium JGI 0001013-A16]
Length=131

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M + L+ HE I+TT+ KAKE+RR+ + ++ L K+ TL   R A
Sbjct  7    LRKLNRTSEHRLAMLRNMTNSLLTHEAIKTTLPKAKELRRVVEPLITLAKDATLANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  DV+ KLF E+  RYK R GGYTR+L+   RVGD APMA++E +DR
Sbjct  67   FDRLRDRDVVTKLFAEIGPRYKARPGGYTRILKMGFRVGDNAPMAFVELVDR  118



>ref|WP_005583215.1| 50S ribosomal protein L17 [Clostridium ultunense]
 emb|CCQ93512.1| ribosomal protein L17 (BL15) [Clostridium ultunense Esp]
Length=113

 Score =   118 bits (296),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M  LRKL RPT HR +MLR  V+ L+KH RIETTV +AKE RR+A+ M+ LGK G L A 
Sbjct  1    MATLRKLGRPTDHRKAMLRNQVTSLLKHGRIETTVTRAKETRRMAEKMITLGKRGDLHAR  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
            R+A  ++  +DV+ KLF E+A RY +R GGYTR+L+   R GD   MA +E +
Sbjct  61   RQALAYIYDEDVVKKLFDEIAPRYSDRNGGYTRVLKLGPRRGDGTEMAILELV  113



>gb|EPB87720.1| 50S ribosomal protein L17 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=190

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LR+LNR +GHR S+LR MVS LV+H RIETTVAKAK ++ +AD+++ LGK+G + A ++A
Sbjct  7    LRRLNRTSGHRNSLLRNMVSSLVEHGRIETTVAKAKTIQPIADSIITLGKKGDVEAKKQA  66

Query  203  AGFVRGDDV-LHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID  355
              ++   D+ + KLF ELA R+  R GGYTR+ R   R GD APMA IE+ID
Sbjct  67   LAYLNSRDITMPKLFDELAPRFANRQGGYTRIQRIGKRYGDNAPMAIIEYID  118



>ref|WP_013723136.1| 50S ribosomal protein L17 [Alicycliphilus denitrificans]
 gb|AEB86657.1| 50S ribosomal protein L17 [Alicycliphilus denitrificans K601]
Length=129

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+ML+ M++ L++HE I+TT+ KAKE+RR+ + M+ L KE ++   R A
Sbjct  7    LRKLNRTSSHRLAMLQNMMNSLIEHEAIKTTLPKAKELRRVIEPMITLAKEDSVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENE  367
               +R  D + KLF +L +R+K R GGYTR+L+   RVGD APMA++E +DR  E
Sbjct  67   FNRLRDRDSVTKLFNDLGHRFKARPGGYTRILKMGFRVGDNAPMAFVELVDRAEE  121



>ref|WP_011938021.1| 50S ribosomal protein L17 [Geobacter uraniireducens]
 sp|A5GAU7.1|RL17_GEOUR RecName: Full=50S ribosomal protein L17 [Geobacter uraniireducens 
Rf4]
 gb|ABQ25299.1| LSU ribosomal protein L17P [Geobacter uraniireducens Rf4]
Length=184

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            ++L R T HR++M R MV+  + HERI TT  KAKE+R +A+ M+ LGK+G L A R+AA
Sbjct  8    KRLGRTTSHRIAMYRNMVTSFLNHERITTTDVKAKELRSIAEKMITLGKKGDLHAMRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
             ++R   V+ KLFT +A RY ERAGGYTR+++  IR GD AP++ IE ++ E
Sbjct  68   SYIRDKKVVTKLFTAIAPRYAERAGGYTRIIKLGIRPGDNAPLSVIELVEEE  119



>emb|CCI50312.1| unnamed protein product [Albugo candida]
Length=124

 Score =   119 bits (297),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +2

Query  62   MLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAGFVRGDDVLHKL  241
            MLRTMV+QL++HERI TT+ KAKE+RR+AD +V L K+ T  + RRA G +R    + KL
Sbjct  1    MLRTMVTQLIEHERIRTTLPKAKELRRVADQVVTLAKKATESSRRRAQGILRTPTAIEKL  60

Query  242  FTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPPT  391
            F +L  RY+ RAGGYTR+L+   R GD A MA IE+IDR  E+R+ KP T
Sbjct  61   FGQLGPRYEMRAGGYTRVLKADFRRGDGAEMAIIEYIDRPGEIRRFKPRT  110



>dbj|GAN06490.1| 50S ribosomal protein L17 [Mucor ambiguus]
Length=191

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LR+LNR +GHR S+LR MVS LV+H RIETTVAKAK ++ +AD+++ LGK+G + A ++A
Sbjct  7    LRRLNRTSGHRNSLLRNMVSSLVEHGRIETTVAKAKTIQPIADSIITLGKKGDVEAKKQA  66

Query  203  AGFVRGDDV-LHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID  355
              ++   D+ + KLF ELA R+  R GGYTR+ R   R GD APMA IE+ID
Sbjct  67   LAYLNSRDITMPKLFEELAPRFANRQGGYTRIQRIGKRYGDNAPMAIIEYID  118



>emb|CDS06597.1| hypothetical protein LRAMOSA09125 [Absidia idahoensis var. thermophila]
Length=186

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LR+LNR + HR +MLR +VS L++H RIETTVAKAKE++ +AD MV LGK+G + A ++A
Sbjct  7    LRRLNRTSSHRNAMLRNLVSSLIEHGRIETTVAKAKEIQPIADRMVTLGKKGDVNARKQA  66

Query  203  AGFVRG-DDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
              ++   D  + KLF ELA R+  R GGYTR+ R   R GD APMA IE+ID   +L+
Sbjct  67   LSYLNSRDTTIPKLFGELAQRFASRQGGYTRVQRIGNRYGDNAPMAVIEYIDGPTDLK  124



>emb|CEP17772.1| hypothetical protein [Parasitella parasitica]
Length=189

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LR+LNR +GHR S+L+ +VS LV+H RIETTVAKAK ++ LAD+M+ LGK+G + A ++A
Sbjct  7    LRRLNRTSGHRSSLLKNLVSSLVEHGRIETTVAKAKTIQPLADSMITLGKKGDVEAKKQA  66

Query  203  AGFVRGDDV-LHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID  355
              ++   D+ + KLF ELA R+  R GGYTR+ R   R GD APMA IE++D
Sbjct  67   LAYLNSRDITMPKLFEELAPRFANRQGGYTRIQRIGKRYGDNAPMAIIEYVD  118



>ref|WP_015838537.1| 50S ribosomal protein L17 [Geobacter sp. M21]
 sp|C6E4M9.1|RL17_GEOSM RecName: Full=50S ribosomal protein L17 [Geobacter sp. M21]
 gb|ACT19325.1| ribosomal protein L17 [Geobacter sp. M21]
Length=168

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HR++M R MV+  ++HE+I TT AKAKE+R +A+ M+ LGK G L A R+AA
Sbjct  8    RRLGRTTSHRIAMFRNMVTSFLQHEKITTTDAKAKELRSIAEKMITLGKRGDLHATRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID  355
             ++R   V+ KLFTE+A RY ER GGYTR+++  IR GD AP++ +E ++
Sbjct  68   AYIRDKKVVTKLFTEIAPRYTERPGGYTRIIKLGIRPGDNAPVSVLELVE  117



>ref|WP_022314327.1| 50S ribosomal protein L17 [Ruminococcus sp. CAG:382]
 emb|CDD01792.1| 50S ribosomal protein L17 [Ruminococcus sp. CAG:382]
Length=143

 Score =   119 bits (297),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R T HR+SML+ M + L+++ +IETTV +AKEV  LAD M+ LGKE TL + RRA 
Sbjct  5    RKLGRTTDHRMSMLKGMTTFLLENGKIETTVTRAKEVSALADKMITLGKENTLTSKRRAF  64

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKP  385
             F++ ++V++KLF ++A  Y +R GGYTR+L+T  R GD A MA + F+D +   ++ +P
Sbjct  65   AFLKKEEVVYKLFNKIAPFYADRNGGYTRVLKTGPRRGDGAEMAIVTFVDADKLYKKEEP  124



>ref|WP_026842549.1| 50S ribosomal protein L17 [Geobacter bremensis]
Length=163

 Score =   119 bits (298),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+L R T HR++M R MV+  ++HE+I TT AKAKE+R +A+ M+ LGK G L A R+AA
Sbjct  8    RRLGRTTSHRIAMFRNMVTSFLQHEKITTTDAKAKELRSIAEKMITLGKRGDLHATRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID  355
             ++R   V+ KLFTE+A RY ER GGYTR+++  IR GD AP++ +E ++
Sbjct  68   AYIRDKKVVTKLFTEIAPRYTERPGGYTRIIKLGIRPGDNAPVSVLELVE  117



>ref|WP_014112117.1| 50S ribosomal protein L17 [Taylorella asinigenitalis]
 ref|YP_004875246.1| 50S ribosomal protein L17p [Taylorella asinigenitalis MCE3]
 gb|AEP37223.1| LSU ribosomal protein L17p [Taylorella asinigenitalis MCE3]
Length=129

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+M R M   L+ HE I+TT+ KAKE+RR+ + ++ L KE T+   R A
Sbjct  7    LRKLNRTSSHRLAMFRNMSVSLIHHEAIKTTLPKAKELRRIIEPLITLAKEPTVANRRIA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D + KLF EL  R+KER GGYTR+L+   R GD APMAY+EF+DR
Sbjct  67   FARLRDRDAVVKLFNELGPRFKERPGGYTRILKMGFRQGDNAPMAYMEFVDR  118



>ref|WP_028110681.1| 50S ribosomal protein L17 [Ferrimonas futtsuensis]
Length=132

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+LNR + HR +M R M   LV+HE I+TTV KAKE+RR+ + ++ L K  ++   R A 
Sbjct  8    RQLNRNSSHRQAMFRNMAGSLVRHEIIKTTVPKAKELRRVVEPLITLAKTDSVANRRLAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               R +DV+ KLF EL  RY+ERAGGYTR+L+   R GD APMAYIE +DR
Sbjct  68   ARTRDNDVVSKLFNELGPRYQERAGGYTRILKCGFRAGDNAPMAYIELVDR  118



>ref|WP_013743930.1| 50S ribosomal protein L17 [Pusillimonas sp. T7-7]
 gb|AEC21403.1| 50S ribosomal protein L17 [Pusillimonas sp. T7-7]
Length=127

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+M R M   L+ HE I+TT+ KAKE+RR+ + ++ LGKE TL   R A
Sbjct  7    LRKLNRTSSHRLAMFRNMAVSLLTHEAIKTTLPKAKELRRVVEPLITLGKEPTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D + KLF E+  RYKER GGYTR+L+   R GD APMA++E +DR
Sbjct  67   FARLRDRDAVTKLFAEIGPRYKERNGGYTRVLKMGFRQGDNAPMAFMELVDR  118



>ref|WP_005663400.1| MULTISPECIES: 50S ribosomal protein L17 [Massilia]
 gb|EKU84241.1| 50S ribosomal protein L17 [Massilia timonae CCUG 45783]
 gb|KFC73632.1| 50S ribosomal protein L17 [Massilia sp. LC238]
 gb|KFI08051.1| 50S ribosomal protein L17 [Massilia sp. BSC265]
Length=131

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 81/125 (65%), Gaps = 0/125 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M   L++HE I+TTV KAKE+RR+ + ++ LGK  TL   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMTVSLLRHEAIKTTVPKAKELRRVIEPILTLGKTDTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R  +++ KLF EL  RY  R GGY R+L+   RVGD APMAY+E +DR       +
Sbjct  67   FARLRDREMVQKLFAELGPRYANRNGGYLRILKMGFRVGDNAPMAYVELLDRPEVTSAEE  126

Query  383  PPTPQ  397
             PT +
Sbjct  127  APTAE  131



>dbj|BAQ17724.1| LSU ribosomal protein L17p [Methyloceanibacter caenitepidi]
Length=142

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HR S+   M + L+KHE+I TT+ KAKE+RR+AD ++ L K G L A R A 
Sbjct  8    RKLNRTSTHRSSLFANMAAALIKHEQIVTTLPKAKELRRVADQLITLAKRGDLHARRLAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR-QSK  382
              +R +D + KLF  L  RY ER GGYTR+L+   R GD+APMA IE +DR+ + R Q  
Sbjct  68   ARIRDEDQVAKLFETLGPRYAERPGGYTRVLKAGFRYGDSAPMAVIELVDRDEDARGQDS  127

Query  383  PPT  391
             PT
Sbjct  128  GPT  130



>ref|WP_031408875.1| 50S ribosomal protein L17 [Thiomonas sp. FB-Cd]
Length=131

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR T HRL+MLR M + L+ HE I+TT+ KAKE+RR+ + ++ LGK+ +L   R A
Sbjct  7    LRKLNRTTSHRLAMLRNMANSLIAHEAIKTTLPKAKELRRVVEPLITLGKKPSLANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENE  367
               +R  D + KLF EL  RYK R GGYTR+L+   RVGD APMA +E +DR +E
Sbjct  67   FDRLRDRDSVVKLFGELGERYKTRPGGYTRILKFGYRVGDNAPMALVELVDRPDE  121



>ref|WP_012648667.1| 50S ribosomal protein L17 [Geobacter daltonii]
 sp|B9M6F1.1|RL17_GEODF RecName: Full=50S ribosomal protein L17 [Geobacter daltonii FRC-32]
 gb|ACM21939.1| ribosomal protein L17 [Geobacter daltonii FRC-32]
Length=181

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            ++L R T HR++M R MV+  + HERI TT AKAK +R +A+ M+ LGK+G L A R+AA
Sbjct  8    KRLGRTTSHRIAMYRNMVTSFLNHERITTTDAKAKGLRSIAEKMITLGKKGDLNAMRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFID  355
             F+R   V+ KLFT +A RY ERAGGYTR+++  IR GD AP++ IE ++
Sbjct  68   SFIRDKKVVTKLFTTIAPRYAERAGGYTRIIKLGIRPGDNAPLSVIELVE  117



>ref|WP_029706486.1| 50S ribosomal protein L17 [Rhodoferax saidenbachensis]
Length=131

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M++ +++HE I+TTV KAKE+RR+ + M+ L KE T+   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMMNSIIEHEAIKTTVPKAKELRRVIEPMITLSKEATVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENE  367
               +R  D + KLF  L  R+K R GGYTR+L+   RVGD APMA +EF+DR  E
Sbjct  67   FDRLRDRDSVTKLFDVLGPRFKARPGGYTRILKMGFRVGDNAPMALVEFVDRAVE  121



>ref|WP_011481469.1| 50S ribosomal protein L17 [Polaromonas sp. JS666]
 sp|Q12G76.1|RL17_POLSJ RecName: Full=50S ribosomal protein L17 [Polaromonas sp. JS666]
 gb|ABE42466.1| LSU ribosomal protein L17P [Polaromonas sp. JS666]
Length=132

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M++ L++HE I+TT+ KAKE+RR+ + M+ L KE T+   R A
Sbjct  7    LRKLNRTSEHRLAMLRNMMNSLLQHEVIKTTLPKAKELRRVVEPMITLAKEPTVANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D++ KLF EL  RYK R GGYTR+L+   RVGD APMA +E +DR
Sbjct  67   FDRLRDRDMVVKLFAELGPRYKARPGGYTRILKMGFRVGDNAPMALVELVDR  118



>ref|WP_015551158.1| 50S ribosomal protein L17 [Taylorella asinigenitalis]
 ref|YP_007821157.1| 50S ribosomal protein L17 [Taylorella asinigenitalis 14/45]
 emb|CCG18982.1| 50S ribosomal protein L17 [Taylorella asinigenitalis 14/45]
Length=129

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+M R M   L+ HE I+TT+ KAKE+RR+ + ++ L KE T+   R A
Sbjct  7    LRKLNRTSSHRLAMFRNMSVSLIHHEAIKTTLPKAKELRRIIEPLITLAKEPTVANRRIA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D + KLF EL  R+KER GGYTR+L+   R GD APMAY+EF+DR
Sbjct  67   FARLRDRDAVVKLFNELGPRFKERPGGYTRVLKMGFRQGDNAPMAYMEFVDR  118



>ref|WP_009541249.1| 50S ribosomal protein L17 [Caenispirillum salinarum]
 gb|EKV29284.1| LSU ribosomal protein L17p [Caenispirillum salinarum AK4]
Length=141

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HR +M   M + L+KHE+I+TTV KAK++R + + ++ L K  TL   R+AA
Sbjct  8    RKLNRTSSHRKAMFANMATALLKHEQIKTTVPKAKDLRPVVEKLITLAKRNTLHTRRQAA  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
              +R D V+ KLF+EL  RYK+R GGYTR+L+   R GDAAPMA IE +DR 
Sbjct  68   AIIREDAVVRKLFSELGERYKDRNGGYTRVLKAGYRYGDAAPMAVIELVDRN  119



>ref|WP_014344630.1| 50S ribosomal protein L17 [Sulfobacillus acidophilus]
 gb|AEW03885.1| LSU ribosomal protein L17P [Sulfobacillus acidophilus DSM 10332]
Length=114

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R L R  GHR +M+R +V+ L++ ERIETTV +A+EV R+A++M+ LGK G L A R A 
Sbjct  6    RTLGRNGGHRRAMMRNLVTSLLREERIETTVTRAREVNRVAEHMITLGKRGDLAARRLAL  65

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
             ++  +DV+ KLFT +A +Y++R GGYTR++RT  R GDAAPMA IE +
Sbjct  66   AYILDEDVVTKLFTTIAPKYQDRNGGYTRIMRTGFRRGDAAPMAIIELV  114



>ref|WP_011803868.1| MULTISPECIES: 50S ribosomal protein L17 [Acidovorax]
 sp|A1W334.1|RL17_ACISJ RecName: Full=50S ribosomal protein L17 [Acidovorax sp. JS42]
 sp|B9MBW3.1|RL17_ACIET RecName: Full=50S ribosomal protein L17 [Acidovorax ebreus TPSY]
 gb|ABM40659.1| LSU ribosomal protein L17P [Acidovorax sp. JS42]
 gb|ACM31883.1| ribosomal protein L17 [Acidovorax ebreus TPSY]
Length=129

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+ML+ M++ L++HE I+TT+ KAKE+RR+ + M+ L KE ++   R A
Sbjct  7    LRKLNRTSSHRLAMLQNMMNSLIEHEAIKTTLPKAKELRRVIEPMITLAKEDSVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D + KLF +L  R+K R GGYTR+L+   RVGD APMAY+E +DR
Sbjct  67   FNRLRDRDSVTKLFNDLGPRFKTRPGGYTRILKMGFRVGDNAPMAYVELVDR  118



>ref|WP_011830990.1| MULTISPECIES: 50S ribosomal protein L17 [Methylibium]
 sp|A2SLD0.1|RL17_METPP RecName: Full=50S ribosomal protein L17 [Methylibium petroleiphilum 
PM1]
 gb|ABM96369.1| LSU ribosomal protein L17P [Methylibium petroleiphilum PM1]
 gb|EWS55303.1| 50S ribosomal protein L17 [Methylibium sp. T29]
 gb|EWS59548.1| 50S ribosomal protein L17 [Methylibium sp. T29-B]
Length=131

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M + L++ E I+TTV KAKE+RR+ + ++ L KE TL   R A
Sbjct  7    LRKLNRTSEHRLAMLRNMANSLIQSEAIKTTVPKAKELRRVVEPLITLAKEPTLANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
                R  DV+ KLF +L  RYK R GGYTR+L+   RVGD APMA++E +DR
Sbjct  67   FDRTRDRDVVAKLFNDLGPRYKARPGGYTRILKMGFRVGDNAPMAFVELVDR  118



>ref|WP_026354947.1| 50S ribosomal protein L17 [Massilia niastensis]
Length=131

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 81/125 (65%), Gaps = 0/125 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M   L++HE I+TTV KAKE+RR+ + ++ LGK  TL   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMTVSLLRHEAIKTTVPKAKELRRVVEPILTLGKTDTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R  +++ KLF EL  RY  R GGY R+L+   RVGD APMAY+E +DR       +
Sbjct  67   FARLRDREIVQKLFAELGPRYATRNGGYLRILKMGFRVGDNAPMAYVELLDRPEVGAADE  126

Query  383  PPTPQ  397
             PT +
Sbjct  127  APTAE  131



>ref|WP_028481914.1| 50S ribosomal protein L17 [Nesiotobacter exalbescens]
Length=141

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HR +M   M + L++HE+I TT+ KAKE+R +AD ++ LGK G L A R+A 
Sbjct  8    RKLNRTSSHRKAMFANMAAALIQHEQIVTTLPKAKELRPIADKLITLGKRGDLHARRQAI  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
              VR   ++ KLF  LA RYK+R GGYTR+L+   R GD+APMA IEF+DR+ E R
Sbjct  68   SQVRDVVMVRKLFETLAERYKDREGGYTRVLKAGFRHGDSAPMAVIEFVDRDVEAR  123



>ref|WP_025725598.1| 50S ribosomal protein L17 [Acholeplasma granularum]
Length=119

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 6/114 (5%)
 Frame = +2

Query  29   KLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAG  208
            +L R T  R ++LR +V+ L+ ++RI TT AKAK V+R+AD MV L K+GTL A R+AA 
Sbjct  6    RLRRTTDQREALLRDLVTDLIINDRITTTEAKAKSVQRVADKMVTLAKKGTLAARRQAAQ  65

Query  209  FVR------GDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
             VR      G D L KLF+ELA RY++R GGYTR+++T  R GDAAPMA IEFI
Sbjct  66   TVRLEEVKEGQDALQKLFSELAPRYQDRTGGYTRIIKTVPRRGDAAPMAIIEFI  119



>ref|WP_012565958.1| 50S ribosomal protein L17 [Rhodospirillum centenum]
 sp|B6IRT1.1|RL17_RHOCS RecName: Full=50S ribosomal protein L17 [Rhodospirillum centenum 
SW]
 gb|ACI98167.1| ribosomal protein L17 [Rhodospirillum centenum SW]
Length=139

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RK NR T HRL+M   M + L+KHE+I+TT+ KAK++R + + ++ LGK+G L   R A 
Sbjct  8    RKFNRTTSHRLAMFSNMANALIKHEQIKTTLPKAKDLRPIVERLITLGKKGGLANKRLAY  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
              +R  D++ KLFT LA RYK R GGYTR+L+   R GDAAPM  IE +DR+ E +
Sbjct  68   AELRDHDMVEKLFTTLAERYKGRPGGYTRVLKAGFRYGDAAPMGVIELVDRDPEAK  123



>ref|WP_009855685.1| 50S ribosomal protein L17 [Rubrivivax benzoatilyticus]
 gb|EGJ09118.1| 50S ribosomal protein L17P [Rubrivivax benzoatilyticus JA2 = 
ATCC BAA-35]
Length=130

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M + L++HE I+TTV KAKE+R + + ++ LGK  TL   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMANSLIRHEAIKTTVPKAKELRAVVEPLITLGKTPTLANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
                R  +V+ KLF EL  RY  R GGYTR+L+   RVGD APMA++E +DR
Sbjct  67   FDRTRDREVVTKLFNELGPRYATRPGGYTRILKMGFRVGDNAPMAFVELVDR  118



>ref|WP_011286114.1| 50S ribosomal protein L17 [Dechloromonas aromatica]
 sp|Q47J76.1|RL17_DECAR RecName: Full=50S ribosomal protein L17 [Dechloromonas aromatica 
RCB]
 gb|AAZ45105.1| LSU ribosomal protein L17P [Dechloromonas aromatica RCB]
Length=132

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M   L+KHE I+TTV KAKE+RR+ + ++ LGK  TL   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMTVSLLKHEAIKTTVPKAKELRRVVEPIITLGKNPTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D++ KLF E+  RY  R GGY R+L+   RVGD APMA++E +DR
Sbjct  67   FDRLRDRDIVVKLFAEIGPRYATRPGGYLRILKCGFRVGDNAPMAFVELLDR  118



>ref|WP_005906828.1| MULTISPECIES: 50S ribosomal protein L17 [Fusobacterium]
 gb|EEO41617.1| 50S ribosomal protein L17 [Fusobacterium nucleatum subsp. animalis 
7_1]
 gb|EEW95900.1| 50S ribosomal protein L17 [Fusobacterium nucleatum subsp. animalis 
3_1_33]
 gb|EFD81235.1| ribosomal protein L17 [Fusobacterium nucleatum subsp. animalis 
D11]
 gb|EGN64174.1| 50S ribosomal protein L17 [Fusobacterium nucleatum subsp. animalis 
21_1A]
 gb|EGN67252.1| ribosomal protein L17 [Fusobacterium nucleatum subsp. animalis 
11_3_2]
 gb|EGQ79075.1| 50S ribosomal protein L17 [Fusobacterium nucleatum subsp. animalis 
ATCC 51191]
 gb|EHO78736.1| 50S ribosomal protein L17 [Fusobacterium nucleatum subsp. animalis 
F0419]
 gb|AGM23200.1| 50S ribosomal protein L17 [Fusobacterium nucleatum subsp. animalis 
4_8]
 gb|EHG20292.2| 50S ribosomal protein L17 [Fusobacterium nucleatum subsp. polymorphum 
F0401]
 emb|CDA08379.1| 50S ribosomal protein L17 [Fusobacterium sp. CAG:649]
 gb|ERT33719.1| 50S ribosomal protein L17 [Fusobacterium nucleatum CTI-5]
 gb|ERT35167.1| 50S ribosomal protein L17 [Fusobacterium nucleatum CTI-3]
 gb|ERT40099.1| 50S ribosomal protein L17 [Fusobacterium nucleatum CTI-1]
 gb|EUB42483.1| ribosomal protein L17 [Fusobacterium sp. CM1]
Length=116

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R   HR +ML+ M   LVK ERIETTV +AKE+R+ A+ M+  GK+ TL A R A 
Sbjct  8    RKLGRRADHRKAMLKNMTISLVKAERIETTVTRAKELRKFAERMITFGKKNTLAARRNAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
             F+R D+ + K+F E+A +Y ER GGYTR+++T +R GD+A MA IE +
Sbjct  68   AFLRDDEAVAKIFNEIAPKYAERNGGYTRIIKTSVRKGDSAEMAIIELV  116



>ref|WP_044665971.1| 50S ribosomal protein L17 [Syntrophaceticus schinkii]
 emb|CEO90175.1| ribosomal protein L17 (BL15) [Syntrophaceticus schinkii]
Length=110

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            +RKL   T  R +MLR M + L+K ERIETT+ +AKEV+RLAD M+ LGK G L + R+A
Sbjct  1    MRKLGMRTDPRRAMLRNMTTSLIKEERIETTLTRAKEVQRLADKMISLGKRGDLHSRRQA  60

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
              ++  + V+ KLF E+A RY+ER+GGYTR+L+T  R GD+APMA++E +
Sbjct  61   MAYLLDETVVKKLFDEVAPRYEERSGGYTRILKTGYRHGDSAPMAFLELV  110



>ref|WP_028355423.1| 50S ribosomal protein L17 [Bordetella petrii]
Length=131

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+M R M   L+KHE I+TT+ KAKE+RR+ + ++ LGKE TL   R A
Sbjct  7    LRKLNRTSSHRLAMFRNMAVSLIKHEAIKTTLPKAKELRRVVEPLITLGKEPTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D + KLF E+  RY  R GGYTR+L+   R GD APMAY+E +DR
Sbjct  67   FARLRDRDAVVKLFAEIGPRYAARNGGYTRVLKMGFRQGDNAPMAYMELVDR  118



>ref|WP_009514907.1| MULTISPECIES: 50S ribosomal protein L17 [Hydrogenophaga]
 gb|EIK93045.1| 50S ribosomal protein L17 [Hydrogenophaga sp. PBC]
 emb|CDN88645.1| 50S ribosomal protein L17 [Hydrogenophaga intermedia]
Length=131

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M++ L+ HE I+TT+ KAKE+RR+ + M+ L KE T+   R A
Sbjct  7    LRKLNRTSEHRLAMLRNMMNSLLTHEAIKTTLPKAKELRRVVEPMITLAKEPTVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  DV+ KLF EL  R+K R GGYTR+L+   RVGD APMA +E +DR
Sbjct  67   FNRLRDRDVVVKLFNELGPRFKARPGGYTRILKMGFRVGDNAPMALVELVDR  118



>ref|WP_019902404.1| 50S ribosomal protein L17 [Chloroflexi bacterium SCGC AB-629-P13]
Length=117

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL+RP+G R+ M RT V+ L+KHERI TT AKAKE++ + + ++ LGK+G+L   R+A 
Sbjct  8    RKLSRPSGQRILMYRTQVTDLIKHERISTTEAKAKELKGMVEKIITLGKKGSLHHRRQAL  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
             FV  + ++ K+F ELA RY ER+GGYTR++R   R GD APMA +E +
Sbjct  68   AFVTEEQMVRKVFDELAIRYAERSGGYTRIIRMNNRKGDGAPMALLELV  116



>ref|WP_027289377.1| 50S ribosomal protein L17 [Rhodovibrio salinarum]
Length=141

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M   RKLNR   HR ++   M + L+KHE+I TT+ KAKE+RR+ D ++ +GK+G L + 
Sbjct  4    MKSGRKLNRTQSHRKALFANMATSLIKHEQIVTTLPKAKELRRVTDKLITMGKKGDLHSR  63

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
            RRAA  +R + +  KLF EL  RYK+R GGYTR+L+   R GD APMA IE +DR+
Sbjct  64   RRAASQLRDERMTKKLFDELGPRYKDRPGGYTRVLKAGFRQGDCAPMAVIELVDRD  119



>ref|WP_013382256.1| 50S ribosomal protein L17 [Eubacterium limosum]
 gb|ADO38949.1| ribosomal protein L17 [Eubacterium limosum KIST612]
Length=113

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  14   MTKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAA  193
            M   RKL RPT  R +MLR + + L++H RIETTV +AKEV+R+AD MV LGK G L A 
Sbjct  1    MAGYRKLGRPTDQRRAMLRNLTTSLLEHGRIETTVTRAKEVKRMADKMVTLGKRGDLHAR  60

Query  194  RRAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
            R+A  ++  DDV+  LF E+A +Y ER GGYTR+ R   R GD A MA IE +
Sbjct  61   RQALAYITKDDVVKSLFDEIAPKYAERQGGYTRIYRVGPRRGDGAEMAVIELV  113



>ref|WP_028557468.1| 50S ribosomal protein L17 [Paenibacillus sp. URHA0014]
Length=121

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 6/117 (5%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + +R ++ R +V+ L  HERI+TT AKAKE+R +A+ ++ L K G L A R+ A
Sbjct  4    RKLNRDSSNRKALFRDLVTDLFIHERIQTTEAKAKEIRSIAEKLITLAKRGDLHARRQVA  63

Query  206  GFVR------GDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
             FVR        D + KLF+ELA RY ER GGYTR+L+   R GDAAPM Y+E +DR
Sbjct  64   AFVRREVANENQDAIQKLFSELAPRYSERPGGYTRILKLGPRRGDAAPMVYLELVDR  120



>ref|WP_025872384.1| 50S ribosomal protein L17 [Methylobacillus glycogenes]
Length=131

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HRL+MLR M + L++HE I+TT+ KAKE+RR+A+ ++ LGKE TL   R A 
Sbjct  8    RKLNRTSSHRLAMLRNMANSLLRHEVIKTTLPKAKELRRVAEPLITLGKEATLANRRLAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
              +R  D++ KLF EL  RY+ R GGY R+L+   R GD APMA +E +DR
Sbjct  68   NRLRDRDIVGKLFNELGPRYQTRNGGYLRILKCGFRQGDNAPMALVELVDR  118



>ref|WP_028854827.1| 50S ribosomal protein L17 [Psychrilyobacter atlanticus]
Length=116

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R + HR +ML  +   L+  ERIETTV +AKE+R+ A+ MV LGK+G L + RRA 
Sbjct  8    RKLGRRSDHRKAMLMNLTISLINEERIETTVTRAKELRKFAERMVTLGKKGDLASRRRAL  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
             F+R  D + KLF E+A +Y ER GGYTR+++T IR GD++PMA IE +
Sbjct  68   AFLRDKDTVAKLFAEVAPKYTERKGGYTRIMKTGIRRGDSSPMAIIELV  116



>ref|WP_006116036.1| MULTISPECIES: 50S ribosomal protein L17 [Acetobacter]
 gb|EGE47948.1| 50S ribosomal protein L17 [Acetobacter pomorum DM001]
 gb|KDE21122.1| 50S ribosomal protein L17 [Acetobacter aceti 1023]
Length=141

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 83/129 (64%), Gaps = 1/129 (1%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL   + HR +M R M   L+KHE+I TT+ KAKE+R + + ++ LGK G L A R+A 
Sbjct  8    RKLGVTSSHRAAMFRNMAVALIKHEQITTTLPKAKELRPVVEKLITLGKRGDLHARRQAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR-QSK  382
              +R D ++ KLF  +A RYK R GGYTR+LR  +R GDAAPMA IE +DR+   + Q  
Sbjct  68   AMLRDDVIVKKLFAAIAERYKARNGGYTRVLRAGVRYGDAAPMAVIELVDRDVSAKGQDS  127

Query  383  PPTPQLPQR  409
             P P+  ++
Sbjct  128  GPRPEAEEK  136



>ref|WP_023406308.1| 50S ribosomal protein L17 [uncultured Desulfofustis sp. PB-SRB1]
 gb|ESQ12353.1| hypothetical protein N839_08480 [uncultured Desulfofustis sp. 
PB-SRB1]
Length=129

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R + HR +M R MV+ L +HERI TT  +AKEVR +A+ M+ L K G L A R+A 
Sbjct  8    RKLGRNSSHRQAMFRNMVTSLFEHERIVTTEQRAKEVRPIAEKMITLAKRGDLHARRQAL  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENEL  370
             ++R   V+ KLF E++ +Y +RAGGYTR++RT  R GDAAPMA IE ++ + +L
Sbjct  68   SYIRSKSVVAKLFDEISDQYADRAGGYTRIIRTGTRRGDAAPMAIIELVEYQEDL  122



>ref|WP_005350112.1| MULTISPECIES: 50S ribosomal protein L17 [Aeromonas]
 gb|ENY72676.1| 50S ribosomal protein L17 [Aeromonas diversa 2478-85]
Length=127

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+LNR + HR +M R M S LV+HE I+TT+ KAKE+RR+ + ++ L K  ++   R A 
Sbjct  8    RQLNRNSSHRQAMFRNMASSLVRHEIIKTTLPKAKELRRVVEPLITLAKTDSVANRRLAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               R ++V+ KLF EL  RY+ERAGGYTR+L+   R GD APMAYIE +DR
Sbjct  68   ARTRDNEVVAKLFNELGKRYQERAGGYTRILKCGFRAGDNAPMAYIELVDR  118



>ref|WP_014426578.1| 50S ribosomal protein L17 [Rubrivivax gelatinosus]
 dbj|BAL93702.1| 50S ribosomal protein L17 RplQ [Rubrivivax gelatinosus IL144]
Length=131

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M + L++HE I+TTV KAKE+R + + ++ LGK  TL   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMANSLIRHEAIKTTVPKAKELRAVVEPLITLGKTPTLANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
                R  +V+ KLF EL  RY  R GGYTR+L+   RVGD APMA++E +DR
Sbjct  67   FDRTRDREVVSKLFNELGPRYATRPGGYTRILKMGFRVGDNAPMAFVELVDR  118



>ref|WP_014015763.1| MULTISPECIES: 50S ribosomal protein L17 [Megasphaera]
 emb|CCC73025.1| 50S ribosomal protein L17 [Megasphaera elsdenii DSM 20460]
 gb|EPP14462.1| 50S ribosomal protein L17 [Megasphaera sp. NM10]
 gb|EPP17527.1| 50S ribosomal protein L17 [Megasphaera sp. BL7]
 emb|CDF04218.1| 50S ribosomal protein L17 [Megasphaera elsdenii CAG:570]
 gb|KGI89630.1| 50S ribosomal protein L17 [Megasphaera elsdenii]
Length=112

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R +  R ++LR++V+ L +HERIETT AKAKE+R++AD M+ L K G L A R+  
Sbjct  4    RKLGRDSSARKALLRSIVTSLFQHERIETTEAKAKELRKVADKMLTLAKRGDLHARRQVL  63

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
             ++  +DV+ KLF E+A +YK+R GGYTR+++T +R GDAAPM  IE +
Sbjct  64   AYMMDEDVVKKLFDEIAPKYKDRQGGYTRIIKTGVRQGDAAPMVIIELV  112



>emb|CBA31527.1| 50S ribosomal protein L17 [Curvibacter putative symbiont of Hydra 
magnipapillata]
Length=131

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M++ L++HE I+TTV KAKE+RR+ + M+ L KE T+   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMMNSLIEHEVIKTTVPKAKELRRVVEPMITLAKEATVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENEL  370
               +R  D + KLF  L  R+K R GGYTR+L+   RVGD APMA +E ++R +E+
Sbjct  67   FDRLRDRDSVTKLFDVLGPRFKARPGGYTRILKMGFRVGDNAPMALVELVERSSEV  122



>ref|WP_038501174.1| 50S ribosomal protein L17 [Basilea psittacipulmonis]
 gb|AIL33289.1| 50S ribosomal protein L17 [Basilea psittacipulmonis DSM 24701]
Length=125

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+M R M   L++HE I+TT+ KAKE+RR+ + ++ L KE T+   R A
Sbjct  7    LRKLNRTSSHRLAMFRNMSVSLIQHEAIKTTLPKAKELRRVVEPLITLAKEPTVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENE  367
               +R  + + KLF EL  R+KER GGYTR+L+   R GD APMAY+E +DR  E
Sbjct  67   FARLRSHEAVAKLFNELGPRFKERKGGYTRILKMGFRQGDNAPMAYMELVDRAAE  121



>ref|WP_011390413.1| 50S ribosomal protein L17 [Rhodospirillum rubrum]
 ref|YP_427747.1| 50S ribosomal protein L17 [Rhodospirillum rubrum ATCC 11170]
 sp|Q2RQY5.1|RL17_RHORT RecName: Full=50S ribosomal protein L17 [Rhodospirillum rubrum 
ATCC 11170]
 gb|ABC23460.1| LSU ribosomal protein L17P [Rhodospirillum rubrum ATCC 11170]
 gb|AEO49198.1| 50S ribosomal protein L17 [Rhodospirillum rubrum F11]
Length=140

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HR +M   M + L+KHE+I+TT+ KAK++R +A+ ++ LGK GTL   R+A 
Sbjct  8    RKLNRTSSHRKAMFANMAASLLKHEQIKTTLPKAKDLRPIAEKLITLGKGGTLHDRRQAH  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRE  361
              +R D V+ KLF  L  RYK+R GGY+R+L+   R GDAAPMA IE +DR+
Sbjct  68   AILRDDAVVAKLFAVLGPRYKDRQGGYSRILKAGFRYGDAAPMAVIELVDRD  119



>ref|WP_037445251.1| 50S ribosomal protein L17 [Shewanella sp. YQH10]
 gb|KFZ36354.1| 50S ribosomal protein L17 [Shewanella sp. YQH10]
Length=132

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+LNR + HR +M R M S LV+HE I+TTV KAKE+RR+ + ++ L K  ++   R A 
Sbjct  8    RQLNRNSSHRQAMFRNMASSLVRHEIIKTTVVKAKELRRVVEPLITLAKSDSVANRRLAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               R  +V+ KLFTEL  RY+ERAGGYTR+L+  +R GD APMAYIE + R
Sbjct  68   ARTRDQEVVGKLFTELGPRYQERAGGYTRILKCGLRAGDKAPMAYIELVGR  118



>ref|WP_013520733.1| 50S ribosomal protein L17 [Alicycliphilus denitrificans]
 gb|ADV01663.1| ribosomal protein L17 [Alicycliphilus denitrificans BC]
Length=129

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+ML+ M++ L++HE I+TT+ KAKE+RR+ + M+ L KE ++   R A
Sbjct  7    LRKLNRTSSHRLAMLQNMMNSLIEHEAIKTTLPKAKELRRVIEPMITLAKEDSVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENE  367
               +R  D + KLF +L  R+K R GGYTR+L+   RVGD APMA++E +DR  E
Sbjct  67   FNRLRDRDSVTKLFNDLGPRFKARPGGYTRILKMGFRVGDNAPMAFVELVDRAEE  121



>ref|WP_037485050.1| 50S ribosomal protein L17 [Sphaerotilus natans]
 gb|KDB50742.1| 50S ribosomal protein L17 [Sphaerotilus natans subsp. natans 
DSM 6575]
Length=131

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M + L++HE I+TTV KAKE+RR+ + ++ L KE TL   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMANSLIEHEAIKTTVPKAKELRRVVEPLITLAKEPTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R  D + KLF  L  R++ R GGYTR+L+   RVGD APMA++E +DR
Sbjct  67   FDRLRNRDNVVKLFNVLGPRFQTRPGGYTRILKMGFRVGDNAPMAFVELVDR  118



>ref|WP_015827891.1| 50S ribosomal protein L17 [Hirschia baltica]
 gb|ACT59741.1| ribosomal protein L17 [Hirschia baltica ATCC 49814]
Length=141

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HR +M   M + LV+HE+I TT+ KAKE+R   D +V LGK+G L A R+A 
Sbjct  8    RKLNRTSEHRKAMFANMAASLVQHEQISTTLPKAKELRSFVDKLVTLGKKGDLAARRQAI  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
              +R  +++ KLF  LA RYK+R GGYTR+L+   R GD APMA IE +DR+ E +
Sbjct  68   SKMRDKEMVQKLFDVLADRYKDREGGYTRVLKAGYRYGDNAPMAVIELVDRDVEAK  123



>ref|WP_012812772.1| 50S ribosomal protein L17 [Acetobacter pasteurianus]
 ref|YP_008393223.1| 50S ribosomal protein L17 [Acetobacter pasteurianus 386B]
 dbj|BAH99105.1| LSU ribosomal protein L17P [Acetobacter pasteurianus IFO 3283-01]
 dbj|BAI02156.1| LSU ribosomal protein L17P [Acetobacter pasteurianus IFO 3283-03]
 dbj|BAI05204.1| LSU ribosomal protein L17P [Acetobacter pasteurianus IFO 3283-07]
 dbj|BAI08251.1| LSU ribosomal protein L17P [Acetobacter pasteurianus IFO 3283-22]
 dbj|BAI11299.1| LSU ribosomal protein L17P [Acetobacter pasteurianus IFO 3283-26]
 dbj|BAI14347.1| LSU ribosomal protein L17P [Acetobacter pasteurianus IFO 3283-32]
 dbj|BAI17393.1| LSU ribosomal protein L17P [Acetobacter pasteurianus IFO 3283-01-42C]
 dbj|BAI20377.1| LSU ribosomal protein L17P [Acetobacter pasteurianus IFO 3283-12]
 emb|CCT60504.1| 50S ribosomal protein L17 [Acetobacter pasteurianus 386B]
Length=141

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 83/129 (64%), Gaps = 1/129 (1%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL   + HR +M R M   L+KHE+I TT+ KAKE+R + + ++ LGK G L A R+A 
Sbjct  8    RKLGVTSSHRAAMFRNMAVALIKHEQITTTLPKAKELRPVVEKLITLGKRGDLHARRQAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR-QSK  382
              +R D ++ KLF  +A RYK R GGYTR+LR  +R GDAAPMA IE +DR+   + Q  
Sbjct  68   AVLRDDVIVKKLFAAIAERYKARNGGYTRVLRAGVRYGDAAPMAVIELVDRDVSAKGQDS  127

Query  383  PPTPQLPQR  409
             P P+  ++
Sbjct  128  GPRPEAEEK  136



>ref|WP_014840642.1| 50S ribosomal protein L17 [Taylorella equigenitalis]
 ref|YP_006503160.1| 50S ribosomal protein L17 [Taylorella equigenitalis ATCC 35865]
 gb|AFN36553.1| 50S ribosomal protein L17 [Taylorella equigenitalis ATCC 35865]
Length=129

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+M R M   L++HE I+TT+ KAKE+RR+ + ++ L KE ++   R A
Sbjct  7    LRKLNRTSSHRLAMFRNMSVSLIQHEAIKTTLPKAKELRRIIEPLITLAKENSVANQRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R    + KLF EL  R+KER GGYTR+L+   R GD APMAY+EF+DR
Sbjct  67   FARLRDRAAVAKLFNELGPRFKERPGGYTRVLKMGFRQGDNAPMAYMEFVDR  118



>ref|WP_029196442.1| 50S ribosomal protein L17 [Paenibacillus alginolyticus]
Length=121

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 79/117 (68%), Gaps = 6/117 (5%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + +R ++ R +V+ L  HERI+TT AKAKE+R +A+ ++ L K G L A R+ A
Sbjct  4    RKLNRDSSNRKALFRDLVTDLFIHERIQTTEAKAKEIRSIAEKLITLAKRGDLHARRQVA  63

Query  206  GFVR------GDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
             FVR        D + KLF++LA RY ER GGYTR+L+   R GDAAPM Y+E +DR
Sbjct  64   AFVRREAADENQDAIQKLFSDLATRYSERPGGYTRILKLGPRRGDAAPMVYLELVDR  120



>ref|WP_013521704.1| 50S ribosomal protein L17 [Taylorella equigenitalis]
 ref|YP_004129611.1| 50S ribosomal protein L17 [Taylorella equigenitalis MCE9]
 ref|YP_007826181.1| 50S ribosomal protein L17 [Taylorella equigenitalis 14/56]
 gb|ADU91468.1| LSU ribosomal protein L17p [Taylorella equigenitalis MCE9]
 emb|CCG18116.1| 50S ribosomal protein L17 [Taylorella equigenitalis 14/56]
 gb|KGK33812.1| 50S ribosomal protein L17 [Taylorella equigenitalis]
Length=129

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+M R M   L++HE I+TT+ KAKE+RR+ + ++ L KE ++   R A
Sbjct  7    LRKLNRTSSHRLAMFRNMSVSLIQHEAIKTTLPKAKELRRIIEPLITLAKENSVANQRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R    + KLF EL  R+KER GGYTR+L+   R GD APMAY+EF+DR
Sbjct  67   FARLRDRAAVAKLFNELGPRFKERPGGYTRVLKMGFRQGDNAPMAYMEFVDR  118



>ref|XP_005756603.1| mitochondrial ribosomal protein L17, partial [Emiliania huxleyi 
CCMP1516]
 ref|XP_005762547.1| hypothetical protein EMIHUDRAFT_59642, partial [Emiliania huxleyi 
CCMP1516]
 ref|XP_005789770.1| mitochondrial ribosomal protein L17, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD04174.1| mitochondrial ribosomal protein L17, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD10118.1| hypothetical protein EMIHUDRAFT_59642, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD37341.1| mitochondrial ribosomal protein L17, partial [Emiliania huxleyi 
CCMP1516]
Length=126

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +2

Query  29   KLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAG  208
            +L R   HR +MLR +V  L++HERI+TT A+A+E+RR+AD ++  GK+GT  A  +A  
Sbjct  1    RLGRGRAHRWAMLRNLVKSLIEHERIKTTHARARELRRVADRVINFGKQGTAHARVQAGK  60

Query  209  FVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSKPP  388
            +V     L KLFT LA RYK+R GGYTR+L+T  R+GD++PM+++E +DR     ++ P 
Sbjct  61   YVSTRPELVKLFTILAERYKDRPGGYTRVLKTYPRIGDSSPMSFVELVDRPLHTLRTPPT  120

Query  389  TPQLPQ  406
              + PQ
Sbjct  121  LAEQPQ  126



>ref|WP_024048912.1| 50S ribosomal protein L17 [Negativicoccus succinicivorans]
 gb|ETI86075.1| 50S ribosomal protein L17 [Negativicoccus succinicivorans DORA_17_25]
 gb|KGF09486.1| 50S ribosomal protein L17 [Clostridiales bacterium S5-A11]
Length=112

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  29   KLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAG  208
            KL R T  R ++LR MV+ L++HERIETT  KAKE+RR+AD M+ LGK G L A R+A  
Sbjct  5    KLGRNTAARKALLRNMVTSLLQHERIETTETKAKELRRVADQMITLGKRGDLHARRQALA  64

Query  209  FVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
            F+  + ++ KLF E+A +Y +R GGYTR+L+   R GDAAPMA IE +
Sbjct  65   FIMDEGIVSKLFGEIAEKYADREGGYTRVLKIGPRKGDAAPMAIIELV  112



>ref|WP_036240376.1| 50S ribosomal protein L17 [Massilia sp. JS1662]
 gb|KGF78428.1| 50S ribosomal protein L17 [Massilia sp. JS1662]
Length=131

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 80/125 (64%), Gaps = 0/125 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M   L++HE I+TT+ KAKE+R++ + ++ LGK  TL   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMTVSLLRHEAIKTTLPKAKELRKVVEPIITLGKNDTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R  +++ KLF E+  RY  R GGY R+L+   RVGD APMA++E +DR        
Sbjct  67   FARLRDREIVQKLFAEIGPRYNARPGGYIRILKMGFRVGDNAPMAFVELVDRPEVTSADD  126

Query  383  PPTPQ  397
             PT +
Sbjct  127  APTAE  131



>ref|WP_008945184.1| 50S ribosomal protein L17 [Oceanibaculum indicum]
 gb|EKE73589.1| 50S ribosomal protein L17 [Oceanibaculum indicum P24]
Length=141

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 77/116 (66%), Gaps = 0/116 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HR +M   M + L+KHE+I+TT+ KAKE+R + + ++ LGK G + A R+  
Sbjct  8    RKLNRTSSHRQAMFSNMAAALIKHEQIKTTLPKAKELRPVVEKLITLGKRGGIHARRQVF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
             F+R D    KLF  L  RY ER GGYTR+L+   R GDAAPMA IE +DR+ E +
Sbjct  68   AFLRDDATTAKLFETLGQRYSERPGGYTRVLKAGFRYGDAAPMAIIELVDRDPEAK  123



>ref|WP_025860218.1| 50S ribosomal protein L17 [Acetobacter papayae]
Length=141

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 82/126 (65%), Gaps = 1/126 (1%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL   + HR +M R M   L+KHE+I TT+ KAKE+R + + ++ LGK G L A R+A 
Sbjct  8    RKLGVTSSHRAAMFRNMAVALIKHEQITTTLPKAKELRPVVEKLITLGKRGDLHARRQAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR-QSK  382
              +R D ++ KLF  +A RYK R GGYTR+LR  +R GDAAPMA IE +DR+   + Q  
Sbjct  68   AQLRDDVIVRKLFAAVAERYKGRNGGYTRVLRAGVRYGDAAPMAVIELVDRDVSAKGQDS  127

Query  383  PPTPQL  400
             P PQ+
Sbjct  128  GPRPQV  133



>ref|WP_019090056.1| 50S ribosomal protein L17 [Acetobacter pasteurianus]
Length=141

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 83/129 (64%), Gaps = 1/129 (1%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL   + HR +M R M   L+KHE+I TT+ KAKE+R + + ++ LGK G L A R+A 
Sbjct  8    RKLGVTSSHRAAMFRNMAVALIKHEQITTTLPKAKELRPVVEKLITLGKRGDLHARRQAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR-QSK  382
              +R D ++ KLF  +A RYK R+GGY R+LR  +R GDAAPMA IE +DR+   + Q  
Sbjct  68   AMLRDDVIVKKLFAAIAERYKARSGGYARVLRAGVRYGDAAPMAVIELVDRDVSAKGQDS  127

Query  383  PPTPQLPQR  409
             P P+  ++
Sbjct  128  GPRPEAEEK  136



>ref|WP_018995992.1| 50S ribosomal protein L17 [Hirschia maritima]
Length=141

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKLNR + HR +M   M + LV+HE+I TT+ KAKE+R   D +V LGK+G L A R+A 
Sbjct  8    RKLNRTSEHRKAMFANMAASLVQHEQISTTLPKAKELRSFMDKLVTLGKKGDLAARRQAI  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELR  373
              +R  +++ KLF  LA RYK+R GGYTR+L+   R GD APMA IE +DR+ + +
Sbjct  68   SKMRDKEMVQKLFDVLAERYKDREGGYTRVLKAGYRYGDNAPMAVIELVDRDEDAK  123



>ref|WP_028601641.1| 50S ribosomal protein L17 [Ottowia thiooxydans]
Length=130

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HR +MLR M++ L++HE I+TT+ KAKE+RR+ + M+ L K  T+   R A
Sbjct  7    LRKLNRTSAHRQAMLRNMMNSLIEHEAIKTTLPKAKELRRVIEPMITLAKVSTVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               +R DD + KLF +L  R+  R GGYTR+L+   RVGD APMA++E +DR
Sbjct  67   FARLRDDDSVKKLFNDLGPRFNARPGGYTRILKMGFRVGDNAPMAFVELVDR  118



>ref|WP_043810870.1| 50S ribosomal protein L17 [Rubrivivax gelatinosus]
Length=131

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M + L++HE I+TTV KAKE+R + + ++ LGK  TL   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMANSLIRHEAIKTTVPKAKELRAVVEPLITLGKTPTLANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
                R  +V+ KLF EL  RY  R GGYTR+L+   RVGD APMA++E +DR
Sbjct  67   FDRTRDREVVTKLFNELGPRYAARPGGYTRILKMGFRVGDNAPMAFVELVDR  118



>gb|AFK40244.1| unknown [Lotus japonicus]
Length=166

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 92/142 (65%), Gaps = 0/142 (0%)
 Frame = -2

Query  472  LLFRGCKLPTEPRLCPGIHgwslw*lwsgWF*LSKFIFPINELNIGHRCSITHTYscs*q  293
            +LFR CKLP E R CPGI+G SLW L S W  L K IF INEL++ H CSI H+ +   +
Sbjct  21   ILFRRCKLPGETRSCPGINGCSLWCLRSWWLCLPKLIFSINELDVSHWCSIAHSNTGPKK  80

Query  292  psvstssffvSIGQFCK*FVKNIIPTHKASSTPCST*SSLFPKLHHIISKPTNFLGFSDC  113
              VSTSS  V I QFCK  VK+I+ ++K SS PC T SSL  KL+H+I KP+N L   + 
Sbjct  81   SGVSTSSILVPISQFCKKLVKDIVSSYKTSSAPCRTFSSLLSKLYHVIRKPSNLLSLGNS  140

Query  112  GLYTLMLHQLRNHRPEHGKSMA  47
            G    +LHQLR H  EHG S+ 
Sbjct  141  GFNAFVLHQLRYHGSEHGHSVT  162



>gb|EIE89565.1| hypothetical protein RO3G_14276 [Rhizopus delemar RA 99-880]
Length=190

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 85/119 (71%), Gaps = 1/119 (1%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            +R+LNR +GHR ++LR +VS LV+H RIETTVAKAK ++ +AD M+ LGK+G + A ++A
Sbjct  7    IRRLNRSSGHRNALLRNLVSSLVEHGRIETTVAKAKTIQPIADAMITLGKKGDVEAKKQA  66

Query  203  AGFVRGDDV-LHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQ  376
              ++   DV + +LF ELA R+  R GGYTR+ R   R GD APMA IE+ID   +L++
Sbjct  67   LSYLNSRDVTIPRLFNELAPRFFNRQGGYTRIQRIGKRYGDNAPMAVIEYIDGPTDLKK  125



>ref|WP_034109565.1| 50S ribosomal protein L17 [Comamonadaceae bacterium BICA1-1]
Length=135

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR T HRL+MLR M++ L+ HE I+TTV KAKE+RR+ + M+ L K  T+   R A
Sbjct  7    LRKLNRTTSHRLAMLRNMMNSLLTHEAIQTTVPKAKELRRVVEPMITLAKVATVANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENEL  370
               +R  DV+ KLF  L  R+  R GGYTR+L+T  RVGD APMA IE +DR + +
Sbjct  67   FDRLRDRDVVVKLFDVLGPRFNARPGGYTRILKTGFRVGDNAPMALIELVDRGDAV  122



>ref|WP_026637580.1| 50S ribosomal protein L17 [Duganella zoogloeoides]
Length=132

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 81/125 (65%), Gaps = 0/125 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M   L++HE I+TT+ KAKE+RR+ + ++ LGK  TL   R A
Sbjct  7    LRKLNRTSSHRLAMLRNMTVSLLRHEAIKTTLPKAKELRRVVEPILTLGKVDTLANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENELRQSK  382
               +R  +++ KLF+EL  RY  R GGY R+L+   RVGD APMAY+E +DR        
Sbjct  67   FSRLRDREIVGKLFSELGPRYANRNGGYLRILKMGFRVGDNAPMAYVELLDRPEATDIDA  126

Query  383  PPTPQ  397
             PT +
Sbjct  127  APTAE  131



>ref|WP_044505149.1| 50S ribosomal protein L17 [Megasphaera sp. NP3]
Length=112

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R +  R ++LR++V+ L +HERIETT AKAKE+R++AD M+ L K G L A R+  
Sbjct  4    RKLGRDSSARKALLRSIVTSLFQHERIETTEAKAKELRKVADKMLTLAKRGDLHARRQVL  63

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
             +V  +DV+ KLF E+A +Y +R GGYTR+++T +R GDAAPM  IE +
Sbjct  64   AYVMDEDVVKKLFDEIAPKYTDRQGGYTRIIKTGVRQGDAAPMVIIELV  112



>ref|WP_014752483.1| MULTISPECIES: 50S ribosomal protein L17 [Advenella]
 gb|AFK64392.1| 50S ribosomal protein L17 [Advenella kashmirensis WT001]
 gb|ETF04502.1| 50S ribosomal protein L17 [Advenella kashmirensis W13003]
 gb|AHG65944.1| 50S ribosomal protein L17 [Advenella mimigardefordensis DPN7]
Length=129

 Score =   116 bits (290),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = +2

Query  17   TKLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAAR  196
            + LRKLNR + HRL+M R M   L++HE I+TT+ KAKE+RR+ + ++ L KE TL   R
Sbjct  5    SGLRKLNRTSSHRLAMFRNMSVSLIQHEAIKTTLPKAKELRRVIEPLITLAKEPTLANKR  64

Query  197  RAAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
             A   +R  D + KLF E+  RYKER GGYTR+L+   R GD APMA++E +DR
Sbjct  65   LAFARLRDRDAVVKLFAEIGPRYKERNGGYTRVLKMGFRQGDNAPMAFMELVDR  118



>ref|WP_008540452.1| 50S ribosomal protein L17 [Sutterella parvirubra]
 gb|EHY32499.1| ribosomal protein L17 [Sutterella parvirubra YIT 11816]
Length=131

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HRL+MLR M+  L+KHE I+TT+ KAKE+RR+ + M+ L KE T+   R A
Sbjct  7    LRKLNRTSAHRLAMLRNMMCSLIKHEAIKTTLPKAKELRRVVEPMITLAKEPTVANKRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDRENE  367
               +R  +V+ KLF E+  R+  R GGYTR+L+   RVGD APMAY+E  +R  E
Sbjct  67   FNRLRDREVVVKLFDEIGPRFANRQGGYTRILKMGFRVGDNAPMAYMELTERAAE  121



>ref|WP_020376669.1| 50S ribosomal protein L17 [Sulfobacillus thermosulfidooxidans]
Length=114

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R  GHR +MLR +V+  ++ ERIETTV +AKEV R+ ++M+ L K G L A R+A 
Sbjct  6    RKLGRIGGHRRAMLRNLVTSTLREERIETTVTRAKEVNRVVEHMITLAKRGDLAARRQAL  65

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
             +V  +DV+ KLFT +  RY++R GGYTR++RT  R GDAAPMA +E +
Sbjct  66   AYVLDEDVVTKLFTTIGPRYQDRTGGYTRIMRTGFRRGDAAPMAILELV  114



>ref|WP_025495801.1| 50S ribosomal protein L17 [Burkholderiales bacterium JGI 0001003-A5]
Length=131

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   LRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRA  202
            LRKLNR + HR +MLR M + L+ HE I+TTV KAKE+RR+ + ++ L KE TL   R A
Sbjct  7    LRKLNRTSEHRQAMLRNMCNSLITHEAIKTTVPKAKELRRVVEPLITLAKEPTLANRRLA  66

Query  203  AGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
                R  DV+ KLF EL  RY  R GGYTR+L+   R+GD APMA++E +DR
Sbjct  67   FDRTRDRDVVTKLFGELGPRYNARPGGYTRILKMGFRIGDNAPMAFVELVDR  118



>ref|XP_009621221.1| PREDICTED: 50S ribosomal protein L17, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=201

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  20   KLRKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARR  199
            K+ KLNRP   R ++LR + +QL+KH RI+TT A+A+ VR+  D M+ L K+GTL   R+
Sbjct  91   KVPKLNRPPDQRRALLRGLTTQLLKHGRIKTTKARARAVRKYVDKMITLAKDGTLHKRRQ  150

Query  200  AAGFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
            A GF+    ++H LFTE+  RY ER GGYTR++RT  R GD APMAYIE +
Sbjct  151  ALGFIYEKQIVHALFTEVPERYGERNGGYTRIIRTLPRRGDNAPMAYIELV  201



>ref|WP_007419207.1| 50S ribosomal protein L17 [Idiomarina sp. A28L]
 gb|EGN76141.1| ribosomal protein L17 [Idiomarina sp. A28L]
Length=133

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+LNR + HR +M R M S LV+HE I+TTV KAKE+RR+ + ++ L KE ++   R A 
Sbjct  8    RQLNRNSSHRQAMFRNMASSLVRHEVIKTTVPKAKELRRVIEPLITLAKEDSVANRRLAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               R  +V+ KLF EL  R+ ER GGYTR+L+   R GD APMAYIE IDR
Sbjct  68   ARTRDKEVVGKLFNELGPRFSERPGGYTRILKCGFRAGDNAPMAYIELIDR  118



>ref|WP_007644470.1| MULTISPECIES: 50S ribosomal protein L17 [Shewanella]
 ref|NP_715897.1| 50S ribosomal protein L17 RplQ [Shewanella oneidensis MR-1]
 sp|Q8EK46.1|RL17_SHEON RecName: Full=50S ribosomal protein L17 [Shewanella oneidensis 
MR-1]
 sp|A4YBV7.1|RL17_SHEPC RecName: Full=50S ribosomal protein L17 [Shewanella putrefaciens 
CN-32]
 sp|A1REE0.1|RL17_SHESW RecName: Full=50S ribosomal protein L17 [Shewanella sp. W3-18-1]
 gb|AAN53342.1| 50S ribosomal protein L17 RplQ [Shewanella oneidensis MR-1]
 gb|ABG91719.1| ribosomal protein L17 [Shewanella putrefaciens 200]
 gb|ABM23035.1| LSU ribosomal protein L17P [Shewanella sp. W3-18-1]
 gb|ABP77440.1| LSU ribosomal protein L17P [Shewanella putrefaciens CN-32]
 gb|ADV52680.1| ribosomal protein L17 [Shewanella putrefaciens 200]
 gb|EGM71803.1| LSU ribosomal protein L17p [Shewanella sp. HN-41]
Length=131

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            R+LNR + HR +M R M S LV+HE I+TTVAKAKE+RR+ + ++ L K  ++   R A 
Sbjct  8    RQLNRNSSHRQAMFRNMASSLVRHEIIKTTVAKAKELRRVVEPLITLAKSDSVANRRLAF  67

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFIDR  358
               R  +V+ KLFTEL  RY+ER GGYTR+L+  +R GD APMAYIE + R
Sbjct  68   ARTRDAEVVGKLFTELGPRYQERPGGYTRILKCGLRAGDKAPMAYIELVGR  118



>ref|WP_023053331.1| 50S ribosomal protein L17 [Megasphaera sp. BV3C16-1]
 gb|ERT60550.1| ribosomal protein L17 [Megasphaera sp. BV3C16-1]
Length=112

 Score =   115 bits (288),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  26   RKLNRPTGHRLSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAA  205
            RKL R +  R ++LR++V+ L +HERIETT AKAKE+R++AD M+ L K G L A R+  
Sbjct  4    RKLGRDSSARRALLRSIVTSLFQHERIETTEAKAKELRKIADKMLTLAKRGDLHARRQVM  63

Query  206  GFVRGDDVLHKLFTELAYRYKERAGGYTRLLRTRIRVGDAAPMAYIEFI  352
             ++  +DV+ KLF E+A +Y++R GGYTR+++T +R GDAAPM  IE +
Sbjct  64   AYMMNEDVVKKLFDEVAPKYQDRQGGYTRIIKTGVRQGDAAPMVIIELV  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875