BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF023L14

Length=671
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     343   1e-113   Sesamum indicum [beniseed]
emb|CDP08481.1|  unnamed protein product                                342   2e-113   Coffea canephora [robusta coffee]
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     339   3e-112   Nelumbo nucifera [Indian lotus]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    338   1e-111   Sesamum indicum [beniseed]
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    334   3e-110   Solanum tuberosum [potatoes]
ref|NP_001265946.1|  Hop-interacting protein THI032                     334   3e-110   Solanum lycopersicum
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                334   4e-110   
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                333   7e-110   Medicago truncatula
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      333   8e-110   Genlisea aurea
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     333   1e-109   Nicotiana tomentosiformis
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    332   2e-109   
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  330   2e-109   Citrus sinensis [apfelsine]
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     332   3e-109   Nicotiana sylvestris
gb|AFK40703.1|  unknown                                                 332   3e-109   Medicago truncatula
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  331   6e-109   Citrus sinensis [apfelsine]
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             330   8e-109   Citrus clementina [clementine]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     330   9e-109   Fragaria vesca subsp. vesca
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    330   9e-109   Citrus sinensis [apfelsine]
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      329   2e-108   
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    329   2e-108   Phaseolus vulgaris [French bean]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             329   2e-108   Phaseolus vulgaris [French bean]
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     329   2e-108   Eucalyptus grandis [rose gum]
ref|NP_001237048.1|  enzymatic resistance protein                       329   3e-108   
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    329   3e-108   Glycine max [soybeans]
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    329   3e-108   Glycine max [soybeans]
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     328   5e-108   Gossypium hirsutum [American cotton]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     328   5e-108   Malus domestica [apple tree]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     328   6e-108   Pyrus x bretschneideri [bai li]
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     328   9e-108   Prunus mume [ume]
ref|XP_006369572.1|  hypothetical protein POPTR_0001s26020g             325   9e-108   
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       328   1e-107   Gossypium arboreum [tree cotton]
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      327   1e-107   Spirodela polyrhiza
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     323   2e-107   Peperomia prostrata
dbj|BAJ33858.1|  unnamed protein product                                328   3e-107   Eutrema halophilum
gb|KJB54389.1|  hypothetical protein B456_009G074800                    326   4e-107   Gossypium raimondii
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     326   4e-107   
ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    326   4e-107   Elaeis guineensis
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     326   4e-107   Populus euphratica
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           326   5e-107   Glycine max [soybeans]
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     325   7e-107   Phoenix dactylifera
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             325   7e-107   Prunus persica
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     325   8e-107   Glycine soja [wild soybean]
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    325   1e-106   
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       325   1e-106   Gossypium arboreum [tree cotton]
ref|XP_002313371.1|  aminotransferase 2 family protein                  325   1e-106   
gb|AGL09527.1|  alanine-glyoxylate aminotransferase                     320   1e-106   Piper nigrum
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    325   1e-106   Populus euphratica
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          325   1e-106   Amborella trichopoda
emb|CDY37208.1|  BnaA09g08290D                                          325   2e-106   Brassica napus [oilseed rape]
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             325   2e-106   Populus trichocarpa [western balsam poplar]
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             325   2e-106   
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             324   2e-106   
emb|CDX81443.1|  BnaC09g08540D                                          324   2e-106   
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    324   3e-106   Glycine max [soybeans]
gb|ABK96624.1|  unknown                                                 324   3e-106   Populus trichocarpa x Populus deltoides
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     323   5e-106   Brassica rapa
emb|CDX89604.1|  BnaC03g45180D                                          323   6e-106   
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    323   7e-106   Brassica rapa
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    323   9e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     318   1e-105   Calycanthus occidentalis [California-allspice]
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         322   2e-105   Jatropha curcas
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                320   2e-105   Morus notabilis
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             321   3e-105   Capsella rubella
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    321   4e-105   Cucumis melo [Oriental melon]
gb|ABQ81925.1|  aminotransferase 2                                      321   4e-105   Cucumis melo [Oriental melon]
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           321   5e-105   Cucumis melo [Oriental melon]
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     320   7e-105   Elaeis guineensis
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     320   7e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             320   7e-105   
gb|ABQ81922.1|  aminotransferase 2                                      320   1e-104   Cucumis sativus [cucumbers]
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     316   1e-104   Xymalos monospora
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    319   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    319   2e-104   Cucumis sativus [cucumbers]
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    319   2e-104   Camelina sativa [gold-of-pleasure]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  319   3e-104   Arabidopsis thaliana [mouse-ear cress]
gb|ABQ81924.1|  aminotransferase 2                                      318   4e-104   Cucumis sativus [cucumbers]
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     318   4e-104   Tarenaya hassleriana [spider flower]
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         318   5e-104   Ricinus communis
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    320   7e-104   Camelina sativa [gold-of-pleasure]
gb|AAL47679.1|  aminotransferase 1                                      318   7e-104   Cucumis melo [Oriental melon]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            318   7e-104   Cucumis melo [Oriental melon]
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     318   8e-104   Beta vulgaris subsp. vulgaris [field beet]
gb|AAQ56192.1|  aminotransferase 1                                      318   9e-104   Cucumis melo [Oriental melon]
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             317   1e-103   Fritillaria agrestis
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                317   3e-103   Cucumis melo [Oriental melon]
gb|AAQ56193.1|  aminotransferase 2                                      316   4e-103   Cucumis melo [Oriental melon]
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    316   4e-103   Cucumis sativus [cucumbers]
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     310   2e-102   Asarum caudatum
gb|ABR26028.1|  serine-glyoxylate aminotransferase                      305   2e-101   Oryza sativa Indica Group [Indian rice]
dbj|BAJ90006.1|  predicted protein                                      311   2e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     313   4e-101   Brachypodium distachyon [annual false brome]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     310   8e-101   Triticum urartu
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    310   1e-100   Setaria italica
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    309   4e-100   
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     308   4e-100   Vitis vinifera
emb|CAN84001.1|  hypothetical protein VITISV_007680                     307   1e-99    Vitis vinifera
ref|NP_001062170.1|  Os08g0502700                                       306   3e-99    
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    306   3e-99    Oryza brachyantha
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          303   7e-98    Sorghum bicolor [broomcorn]
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                     298   1e-97    Saururus cernuus [swamp lily]
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    298   4e-96    Cicer arietinum [garbanzo]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                297   6e-96    Medicago truncatula
gb|ABF70331.1|  aminotransferase 1                                      295   6e-95    Cucumis sativus [cucumbers]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              287   2e-92    
ref|NP_001148339.1|  LOC100281949                                       288   3e-92    Zea mays [maize]
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                     277   1e-89    Manekia incurva
gb|AGL09529.1|  alanine-glyoxylate aminotransferase                     272   4e-88    Thottea sp. JN-2013
gb|AGL09531.1|  alanine-glyoxylate aminotransferase                     271   2e-87    Zippelia begoniifolia
ref|XP_008666464.1|  PREDICTED: serine--glyoxylate aminotransfera...    262   2e-84    Zea mays [maize]
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     265   9e-84    Peperomia rupiseda
tpg|DAA47874.1|  TPA: hypothetical protein ZEAMMB73_131074              263   1e-83    
emb|CBI24214.3|  unnamed protein product                                263   7e-83    Vitis vinifera
gb|ABR16109.1|  unknown                                                 262   1e-82    Picea sitchensis
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     262   2e-82    Peperomia bracteata
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     261   2e-82    Peperomia aff. ovatopeltata JN-2011
gb|ACN39798.1|  unknown                                                 263   2e-82    Picea sitchensis
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     261   3e-82    Peperomia questionis
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     260   3e-82    Peperomia exclamationis
gb|ABK24112.1|  unknown                                                 262   4e-82    Picea sitchensis
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     259   4e-82    Peperomia schizandra
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     259   5e-82    Peperomia parvisagittata
ref|XP_001783551.1|  predicted protein                                  261   6e-82    
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     260   6e-82    Peperomia pseudoverruculosa
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     259   7e-82    Peperomia cerrateae
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     259   7e-82    Peperomia cerrateae
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     259   9e-82    Peperomia polycephala
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     260   9e-82    Peperomia schizandra
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     259   1e-81    Peperomia cerrateae
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     259   1e-81    Peperomia aff. gracillima JN-2011
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     259   1e-81    Peperomia putlaensis
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     258   2e-81    Peperomia elatior
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     258   2e-81    Peperomia wernerrauhii
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     258   2e-81    Peperomia aff. pinoi JN-2011
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     258   2e-81    Peperomia klopfensteinii
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     258   3e-81    Peperomia basiradicans
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     258   3e-81    Peperomia peruviana
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     258   3e-81    Peperomia peruviana
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     258   3e-81    Peperomia pugnicaudex
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     258   3e-81    Peperomia cyclaminoides
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     258   3e-81    Peperomia peruviana
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     258   3e-81    Peperomia parvifolia
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     258   4e-81    Peperomia peruviana
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     258   4e-81    Peperomia cyclaminoides
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     258   4e-81    Peperomia andina
ref|XP_001755667.1|  predicted protein                                  259   5e-81    
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     258   5e-81    Peperomia parvisagittata
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     258   5e-81    Peperomia bracteata
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     258   5e-81    Peperomia peruviana
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     258   5e-81    Peperomia verruculosa
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     258   6e-81    Peperomia bracteata
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             258   1e-80    Selaginella moellendorffii
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             258   1e-80    
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     257   1e-80    Peperomia chutanka
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     257   1e-80    Peperomia bracteata
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     257   1e-80    Peperomia bracteata
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     256   1e-80    Peperomia putlaensis
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     256   2e-80    Peperomia wernerrauhii
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     256   3e-80    Peperomia bracteata
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     255   6e-80    Peperomia cerrateae
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     254   7e-80    Peperomia aff. ovatopeltata JN-2011
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     254   1e-79    Peperomia sp. JN-2011
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     254   1e-79    Peperomia sp. JN-2011
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     253   2e-79    Peperomia sp. JN-2011
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     254   3e-79    Peperomia cerrateae
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     253   6e-79    Peperomia radiatinervosa
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     252   1e-78    Peperomia parvisagittata
ref|XP_001763095.1|  predicted protein                                  250   1e-77    
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                249   2e-77    Erythranthe guttata [common monkey flower]
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     239   6e-74    Peperomia ayacuchoana
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     239   1e-73    Peperomia bracteata
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     237   4e-73    Peperomia verruculosa
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     236   7e-73    Peperomia jalcaensis
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     236   9e-73    Peperomia cyclaminoides
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     236   1e-72    Peperomia peruviana
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     236   2e-72    Peperomia radiatinervosa
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     233   9e-72    Peperomia radiatinervosa
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             235   1e-71    Selaginella moellendorffii
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             234   2e-71    Selaginella moellendorffii
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     231   1e-70    Peperomia radiatinervosa
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     224   2e-68    Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     223   8e-68    Peperomia aff. ovatopeltata JN-2011
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     223   1e-67    Peperomia cavispicata
gb|ADO24297.1|  aminotransferase                                        215   1e-67    Valeriana jatamansi
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     220   1e-66    Peperomia cyclaminoides
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     218   5e-66    Peperomia sp. JN-2011
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     218   6e-66    Peperomia dolabella
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     218   7e-66    Peperomia peruviana
gb|ADG26437.1|  putative aminotransferase                               209   2e-65    Valeriana jatamansi
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     216   4e-65    Peperomia peruviana
ref|XP_005709273.1|  serine--glyoxylate transaminase                    218   6e-65    Galdieria sulphuraria
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     214   8e-65    Peperomia gigantea
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     213   2e-64    
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                209   2e-61    Methylobacterium sp. MB200
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                207   5e-61    Methylorubrum extorquens
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 208   5e-61    Coccomyxa subellipsoidea C-169
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                207   5e-61    
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      208   5e-61    Methylibium petroleiphilum PM1
ref|WP_020188076.1|  hypothetical protein                               207   6e-61    Methylopila sp. 73B
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                206   2e-60    Methylobacteriaceae
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                206   2e-60    Methylobacteriaceae
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                206   2e-60    Methylorubrum populi
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                206   2e-60    Methylopila sp. M107
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    206   3e-60    Methylibium
gb|KJB83533.1|  hypothetical protein B456_013G252200                    204   3e-60    Gossypium raimondii
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                204   7e-60    Methylocaldum szegediense
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                204   1e-59    Methylococcus capsulatus
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    203   2e-59    Methylobacterium aquaticum
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                202   3e-59    Methylomicrobium alcaliphilum
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                202   6e-59    Methylomicrobium buryatense
ref|WP_027156802.1|  serine--glyoxylate aminotransferase                202   7e-59    Methylobacter luteus
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                201   9e-59    Ensifer sp. BR816
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                201   1e-58    Sinorhizobium fredii
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                201   2e-58    Methylobacterium
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                200   4e-58    Methylobacterium sp. 77
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                199   6e-58    Methyloversatilis thermotolerans
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                199   7e-58    Sinorhizobium sp. CCBAU 05631
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                199   7e-58    Ensifer sojae
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                199   7e-58    Sinorhizobium meliloti
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                199   1e-57    Methylobacterium sp. 88A
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                198   1e-57    Methylomarinum vadi
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                198   1e-57    Methylobacterium
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                198   2e-57    
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                198   2e-57    Sinorhizobium fredii
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    197   2e-57    Methylomicrobium agile
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                198   2e-57    Sinorhizobium arboris
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                198   4e-57    Methylocapsa acidiphila
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    197   4e-57    Methylobacter
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                197   5e-57    Sinorhizobium fredii
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                197   5e-57    Rhizobium leucaenae
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    197   5e-57    Methylobacterium
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                197   5e-57    Rhizobium giardinii
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                197   5e-57    Methylobacter sp. BBA5.1
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                197   6e-57    Methylohalobius crimeensis
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                197   6e-57    Sinorhizobium/Ensifer group
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                196   8e-57    Methylocella silvestris
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                196   1e-56    Sinorhizobium americanum
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                197   1e-56    Methylobacterium nodulans
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                196   1e-56    Paraburkholderia oxyphila
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                196   2e-56    Methylobacter tundripaludum
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                196   2e-56    Sinorhizobium fredii
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                195   2e-56    Methylobacter tundripaludum
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                196   2e-56    Methylobacterium sp. B34
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                195   2e-56    Methylobacterium
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                196   2e-56    Caballeronia glathei
ref|WP_010687105.1|  Aminotransferase class V                           195   2e-56    Methylobacterium mesophilicum
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    195   3e-56    Methylobacterium
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                195   3e-56    Rhizobium sp. CF097
gb|AIQ91949.1|  Aminotransferase class V                                196   3e-56    Methylobacterium oryzae CBMB20
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                194   4e-56    Methylosarcina fibrata
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                194   4e-56    Methylosarcina lacus
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              196   4e-56    Volvox carteri f. nagariensis
ref|WP_023496630.1|  serine--glyoxylate aminotransferase SgaA           194   5e-56    Methyloglobulus morosus
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                194   7e-56    Methylobacterium
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 195   7e-56    Chlamydomonas reinhardtii
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                194   7e-56    Methylobacterium sp. WSM2598
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                194   8e-56    Paraburkholderia phymatum
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                194   8e-56    Methylobacterium sp. 4-46
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                194   8e-56    Mesorhizobium amorphae
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                194   9e-56    Paraburkholderia caribensis
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                194   9e-56    Paraburkholderia terrae
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                194   9e-56    Mesorhizobium sp. WSM3224
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                194   9e-56    Burkholderiaceae
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 195   9e-56    Chlamydomonas reinhardtii
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                194   9e-56    Paraburkholderia hospita
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                193   1e-55    Methylomonas methanica
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                194   1e-55    Burkholderia sp. UYPR1.413
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              194   1e-55    Chlorella variabilis
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                194   1e-55    Paraburkholderia sacchari
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                193   2e-55    Methyloversatilis universalis
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                193   2e-55    Methylocapsa aurea
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                192   2e-55    Mesorhizobium loti
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                193   2e-55    Paraburkholderia mimosarum
gb|ACN36238.1|  unknown                                                 191   3e-55    Zea mays [maize]
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                192   3e-55    Mesorhizobium loti
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                192   3e-55    Methylovulum miyakonense
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                192   6e-55    Methylosinus sp. LW4
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    191   6e-55    Mesorhizobium
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                191   6e-55    Mesorhizobium sp. L103C120A0
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                191   6e-55    Mesorhizobium sp. ORS 3324
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                191   7e-55    
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                191   7e-55    
ref|WP_009211467.1|  serine--glyoxylate aminotransferase                191   7e-55    
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                191   8e-55    
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                191   9e-55    
ref|WP_043774228.1|  serine--glyoxylate aminotransferase                191   1e-54    
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                191   2e-54    
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                191   2e-54    
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                190   2e-54    
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                190   2e-54    
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                190   2e-54    
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                190   3e-54    
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    190   3e-54    
ref|WP_024351906.1|  serine--glyoxylate aminotransferase                190   3e-54    
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                190   3e-54    
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                189   3e-54    
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                189   4e-54    
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                189   4e-54    
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                189   4e-54    
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                188   5e-54    
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    189   5e-54    
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    189   6e-54    
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                189   6e-54    
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                189   6e-54    
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                189   6e-54    
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                189   6e-54    
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    189   7e-54    
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    189   7e-54    
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                189   8e-54    
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                188   9e-54    
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                188   1e-53    
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    188   1e-53    
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                188   1e-53    
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                188   1e-53    
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                188   2e-53    
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                188   2e-53    
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                188   2e-53    
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                188   2e-53    
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                188   2e-53    
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    187   2e-53    
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    187   2e-53    
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                187   2e-53    
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                187   2e-53    
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                187   3e-53    
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                187   3e-53    
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                187   4e-53    
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                187   4e-53    
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                187   4e-53    
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                187   5e-53    
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                187   5e-53    
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                186   5e-53    
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                186   7e-53    
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                186   8e-53    
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                186   8e-53    
ref|WP_040618186.1|  serine--glyoxylate aminotransferase                186   1e-52    
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                186   1e-52    
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    186   1e-52    
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                185   2e-52    
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      185   2e-52    
ref|WP_037268413.1|  serine--glyoxylate aminotransferase                185   2e-52    
ref|WP_009817966.1|  serine--glyoxylate aminotransferase                185   2e-52    
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    185   2e-52    
ref|WP_037245168.1|  serine--glyoxylate aminotransferase                185   2e-52    
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                185   3e-52    
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                184   3e-52    
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                184   4e-52    
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                184   6e-52    
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    184   7e-52    
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        184   8e-52    
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                183   9e-52    
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                183   9e-52    
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                183   9e-52    
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_020592928.1|  hypothetical protein                               182   2e-51    
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     183   3e-51    
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        182   3e-51    
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                181   3e-51    
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 181   5e-51    
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                181   6e-51    
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                181   7e-51    
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                179   7e-51    
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                180   2e-50    
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                179   3e-50    
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                179   3e-50    
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                179   3e-50    
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                179   4e-50    
ref|WP_043870950.1|  serine--glyoxylate aminotransferase                176   4e-49    
ref|WP_006344742.1|  serine--glyoxylate aminotransferase                176   5e-49    
ref|WP_033390460.1|  serine--glyoxylate aminotransferase                176   7e-49    
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                175   9e-49    
ref|WP_037336675.1|  serine--glyoxylate aminotransferase                175   1e-48    
ref|WP_005162865.1|  Serine--glyoxylate aminotransferase                175   1e-48    
gb|ADO24296.1|  aminotransferase                                        166   1e-48    
ref|WP_019140317.1|  serine--glyoxylate aminotransferase                175   2e-48    
ref|WP_028431641.1|  serine--glyoxylate aminotransferase                174   2e-48    
gb|KIZ03753.1|  serine--glyoxylate transaminase                         175   3e-48    
ref|WP_020636555.1|  serine--glyoxylate aminotransferase                173   4e-48    
ref|WP_010239996.1|  serine--glyoxylate aminotransferase                173   4e-48    
ref|WP_007815045.1|  serine--glyoxylate aminotransferase                174   5e-48    
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                172   8e-48    
ref|WP_008280158.1|  serine--glyoxylate aminotransferase                172   2e-47    
ref|WP_029016266.1|  serine--glyoxylate aminotransferase                171   3e-47    
ref|WP_044852944.1|  serine--glyoxylate aminotransferase                171   3e-47    
ref|WP_025312373.1|  serine--glyoxylate aminotransferase                171   3e-47    
ref|WP_038514775.1|  serine--glyoxylate aminotransferase                171   4e-47    
ref|WP_014743098.1|  serine--glyoxylate aminotransferase                170   8e-47    
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     169   1e-46    
ref|WP_036336347.1|  serine--glyoxylate aminotransferase                169   1e-46    
ref|WP_017971680.1|  serine--glyoxylate aminotransferase                169   2e-46    
ref|WP_042195193.1|  serine--glyoxylate aminotransferase                169   2e-46    
ref|WP_013046086.1|  serine--glyoxylate aminotransferase                169   2e-46    
ref|WP_026641447.1|  serine--glyoxylate aminotransferase                169   2e-46    
ref|WP_006219842.1|  serine--glyoxylate aminotransferase                169   3e-46    
ref|WP_026847044.1|  serine--glyoxylate aminotransferase                168   3e-46    
gb|ACJ84853.1|  unknown                                                 159   4e-46    
ref|WP_006224393.1|  serine--glyoxylate aminotransferase                168   5e-46    
ref|WP_018260236.1|  serine--glyoxylate aminotransferase                168   5e-46    
ref|WP_024570173.1|  MULTISPECIES: serine--glyoxylate aminotransf...    168   5e-46    
ref|WP_012333270.1|  serine--glyoxylate aminotransferase                168   6e-46    
ref|WP_014869675.1|  serine--glyoxylate aminotransferase                167   9e-46    
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                167   1e-45    
gb|ABZ06421.1|  putative aminotransferase class-V                       165   1e-45    
ref|WP_037263007.1|  serine--glyoxylate aminotransferase                167   1e-45    
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                167   1e-45    
ref|WP_040742470.1|  serine--glyoxylate aminotransferase                167   1e-45    
ref|WP_008641541.1|  MULTISPECIES: Serine-glyoxylate aminotransfe...    167   1e-45    
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 166   1e-45    
ref|WP_015929396.1|  serine--glyoxylate aminotransferase                167   1e-45    
ref|WP_039689210.1|  serine--glyoxylate aminotransferase                167   2e-45    
ref|WP_019452138.1|  serine--glyoxylate aminotransferase                167   2e-45    
ref|WP_028435927.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_029455333.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_019015661.1|  hypothetical protein                               166   2e-45    
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    166   2e-45    
ref|WP_011520033.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_007351739.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_030358204.1|  MULTISPECIES: serine--glyoxylate aminotransf...    166   3e-45    
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_039396834.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_040829642.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_008546137.1|  serine--glyoxylate aminotransferase                166   4e-45    
ref|WP_008943383.1|  serine--glyoxylate aminotransferase                166   5e-45    
ref|WP_016640027.1|  putative Serine--glyoxylate aminotransferase       165   5e-45    
ref|WP_016574932.1|  Serine-glyoxylate aminotransferase                 165   6e-45    
ref|WP_043769964.1|  serine--glyoxylate aminotransferase                165   7e-45    
ref|WP_030566583.1|  serine--glyoxylate aminotransferase                165   8e-45    
ref|WP_030670113.1|  serine--glyoxylate aminotransferase                165   8e-45    
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                165   9e-45    
ref|WP_029048453.1|  serine--glyoxylate aminotransferase                165   9e-45    
ref|WP_044456571.1|  serine--glyoxylate aminotransferase                165   1e-44    
ref|WP_029454537.1|  serine--glyoxylate aminotransferase                164   1e-44    
ref|WP_031228637.1|  serine--glyoxylate aminotransferase                164   1e-44    
gb|AAY68344.1|  putative serine-pyruvate aminotransferase               164   1e-44    
ref|WP_042112271.1|  serine--glyoxylate aminotransferase                164   1e-44    
ref|WP_042997765.1|  serine--glyoxylate aminotransferase                164   1e-44    
ref|WP_042083882.1|  serine--glyoxylate aminotransferase                164   1e-44    
gb|EST32977.1|  serine--glyoxylate aminotransferase                     164   1e-44    
ref|WP_039596641.1|  serine--glyoxylate aminotransferase                164   2e-44    
ref|WP_020084034.1|  serine--glyoxylate aminotransferase                164   2e-44    
ref|WP_028356096.1|  serine--glyoxylate aminotransferase                164   3e-44    
ref|WP_033449479.1|  serine--glyoxylate aminotransferase                164   3e-44    
ref|WP_010929438.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_015040670.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_003815469.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_010808567.1|  aminotransferase class V                           163   3e-44    
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                163   4e-44    
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                163   4e-44    
gb|ACF06940.1|  aminotransferase class V                                160   4e-44    
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                163   4e-44    
ref|WP_035864362.1|  serine--glyoxylate aminotransferase                163   4e-44    
ref|WP_006156375.1|  serine--glyoxylate aminotransferase                163   4e-44    
ref|WP_013695939.1|  serine--glyoxylate aminotransferase                163   5e-44    
ref|WP_016353380.1|  serine-glyoxylate aminotransferase                 163   5e-44    
ref|WP_038008200.1|  MULTISPECIES: serine--glyoxylate aminotransf...    163   5e-44    
ref|WP_020666968.1|  serine--glyoxylate aminotransferase                162   5e-44    
ref|WP_014906063.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   7e-44    
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                162   7e-44    
ref|WP_043355494.1|  serine--glyoxylate aminotransferase                162   7e-44    
ref|WP_007004225.1|  serine--glyoxylate aminotransferase                162   7e-44    
ref|WP_030485989.1|  serine--glyoxylate aminotransferase                162   8e-44    
ref|WP_022540099.1|  serine--glyoxylate aminotransferase                162   9e-44    
ref|WP_028796360.1|  serine--glyoxylate aminotransferase                162   1e-43    
ref|WP_028232152.1|  serine--glyoxylate aminotransferase                162   1e-43    
gb|AIU26350.1|  serine--glyoxylate aminotransferase                     162   1e-43    
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                162   1e-43    
emb|CEG08571.1|  Soluble hydrogenase 42 kDa subunit                     162   1e-43    
ref|WP_041345074.1|  serine--glyoxylate aminotransferase                162   1e-43    
ref|WP_033453548.1|  serine--glyoxylate aminotransferase                162   1e-43    
ref|WP_009338917.1|  serine--glyoxylate aminotransferase                162   1e-43    
ref|WP_040808396.1|  serine--glyoxylate aminotransferase                162   1e-43    
ref|WP_004567895.1|  serine--glyoxylate aminotransferase                162   1e-43    
ref|WP_033449717.1|  serine--glyoxylate aminotransferase                162   1e-43    
ref|WP_003817883.1|  serine--glyoxylate aminotransferase                162   1e-43    
ref|WP_014982904.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                162   1e-43    
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                162   1e-43    
gb|ABA05667.1|  aminotransferase, class V                               162   1e-43    
ref|WP_007811273.1|  serine--glyoxylate aminotransferase                161   2e-43    
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    162   2e-43    
ref|WP_037929134.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_011454286.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_016417666.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_037459311.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_036178803.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_043547949.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_039365002.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_037247820.1|  serine--glyoxylate aminotransferase                161   2e-43    
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             162   2e-43    
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_029895536.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_039404613.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_002716388.1|  hypothetical protein                               161   2e-43    
ref|WP_027284153.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_028923528.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_023871906.1|  MULTISPECIES: serine--glyoxylate aminotransf...    161   3e-43    
ref|WP_020683672.1|  hypothetical protein                               161   3e-43    



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   343 bits (879),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/172 (95%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIPDQV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLDVLASK+AED AHTIKAICIVHNETATGVTNNLATVRK+LDHYQHPAL 
Sbjct  121  ANLDVLASKIAEDKAHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALF  172



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   342 bits (877),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TK LLEDVKKIFKT SG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTESG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLAEDTAHTIKAICIVHNETATGVTNNLATVRK+LDHY HPAL 
Sbjct  121  ANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKILDHYNHPALF  172



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLA DTAHTIKAICIVHNETATGVTNNLATVRK+LDHY+HPAL 
Sbjct  121  ANLDILASKLAADTAHTIKAICIVHNETATGVTNNLATVRKILDHYRHPALF  172



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKT SG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTASG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIV+FLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVTFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL++LASK+AED  HTIKAICIVHNETATGVTNNLATVRK+LDHYQHPAL 
Sbjct  121  ANLEILASKIAEDREHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALF  172



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL+VLASK+AED +HTIKA+CIVHNETATGVTNNLATVRK+LDHYQHPAL 
Sbjct  121  ANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLATVRKILDHYQHPALF  172



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL+VLASK+AED +HTIKA+CIVHNETATGVTNNLATVRK+LDHYQHPAL 
Sbjct  121  ANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLATVRKILDHYQHPALF  172



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   334 bits (856),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+LD+L SKLA D+AHTIKAICIVHNETATGVTNNLA VR+LLD YQHPALL
Sbjct  121  ADLDILESKLASDSAHTIKAICIVHNETATGVTNNLAKVRQLLDAYQHPALL  172



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   333 bits (854),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+LD+L SKLA D+AHTIKAICIVHNETATGVTNNLA VR+LLD YQHPALL
Sbjct  121  ADLDILESKLASDSAHTIKAICIVHNETATGVTNNLAKVRQLLDAYQHPALL  172



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   333 bits (854),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+LD+LASK+A+D  H IKAICIVHNETATGVTNNLATVRK+LD YQHPAL 
Sbjct  121  ADLDILASKIAQDKDHAIKAICIVHNETATGVTNNLATVRKILDQYQHPALF  172



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+L+ LASK+A D +HTIKAICIVHNETATGVTNNLATVRK+LDHYQHPALL
Sbjct  121  ADLEALASKIAADKSHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALL  172



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   332 bits (851),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PT GTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLFPTXGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGKG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+L SKLA D+AHTIKAICIVHNETATGVTNNLA VR++LD YQHPALL
Sbjct  121  ANLDILESKLASDSAHTIKAICIVHNETATGVTNNLAKVRQILDAYQHPALL  172



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+ VRKLLD Y+HPAL 
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLSKVRKLLDEYRHPALF  172



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   332 bits (850),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+L+ LASK+A D +HTIKAICIVHNETATGVTNNLATVRK+LDHYQHPAL 
Sbjct  121  ADLEALASKIAADKSHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALF  172



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   332 bits (850),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWES LTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESVLTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+LD+L SKLA D+AHTIKAICIVHNETATGVTNNLA VR+LLD YQHPALL
Sbjct  121  ADLDILESKLASDSAHTIKAICIVHNETATGVTNNLAKVRQLLDAYQHPALL  172



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   331 bits (848),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+ VRKLLD Y+HPAL 
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLSKVRKLLDEYRHPALF  172



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   330 bits (847),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVQIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+ VRKLLD Y+HPAL 
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLSKVRKLLDEYRHPALF  172



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   330 bits (847),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD V APGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKTT+G
Sbjct  1    MDNVYAPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLATVRK+LDHY+HPAL 
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLATVRKILDHYRHPALF  172



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   330 bits (847),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+ VRKLLD Y+HPAL 
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLSKVRKLLDDYRHPALF  172



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   329 bits (844),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVK IFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKMIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL++LA KLA D  HTIKAICIVHNETATGVTNNLATVRKLLDHY+HPALL
Sbjct  121  ANLEILAEKLASDYTHTIKAICIVHNETATGVTNNLATVRKLLDHYRHPALL  172



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   329 bits (844),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVL SK+A DTAHTIKAICIVHNETATGVTNNLA VR++LD Y+HPALL
Sbjct  121  AKLDVLESKIASDTAHTIKAICIVHNETATGVTNNLAKVRQILDSYKHPALL  172



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   329 bits (844),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVL SK+A DTAHTIKAICIVHNETATGVTNNLA VR++LD Y+HPALL
Sbjct  121  AKLDVLESKIASDTAHTIKAICIVHNETATGVTNNLAKVRQILDSYKHPALL  172



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   329 bits (844),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIPDQVIRAM RNNEDYRSPA+PALTK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPDQVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR +SF+IGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTISFMIGQFSLLWIDQQQRLGFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLA DTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y+HPAL 
Sbjct  121  ANLDILASKLAADTAHTIKAVCIVHNETATGVTNNLARVRKILDDYRHPALF  172



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   329 bits (844),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA VR++LD YQHPALL
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYQHPALL  172



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   329 bits (843),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA VR++LD YQHPALL
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYQHPALL  172



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   329 bits (843),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA VR++LD YQHPALL
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYQHPALL  172



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   328 bits (842),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLDVLA KLA D  HTIKAICIVHNETATGVTNNLATVRKLLDHY HPALL
Sbjct  121  ANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALL  172



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   328 bits (842),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLDVL SK+AEDTAHTIKAICIVHNETATGVTNNLA VRK+LD+Y HPAL 
Sbjct  121  ANLDVLESKIAEDTAHTIKAICIVHNETATGVTNNLAKVRKILDNYMHPALF  172



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   328 bits (842),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKQIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLDVL SK+AEDTAHTIKAICIVHNETATGVTNNLA VRK+LD+Y HPAL 
Sbjct  121  ANLDVLESKIAEDTAHTIKAICIVHNETATGVTNNLAKVRKILDNYMHPALF  172



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   328 bits (840),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLAEDTAHTIKAICIVHNETATGVTNNLA VR++LD Y+HPAL 
Sbjct  121  ANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLAQVRRILDEYRHPALF  172



>ref|XP_006369572.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66141.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=321

 Score =   325 bits (833),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y+HPAL 
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALF  172



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR V+FLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVTFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LA KLA D +HTIKAICIVHNETATG+TNNLATVRKLLDHY+HPALL
Sbjct  121  ANLDILAEKLAADHSHTIKAICIVHNETATGITNNLATVRKLLDHYRHPALL  172



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGLG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLDVLA KLA D +H+IKAICIVHNETATGVTNNLATVRKLLD Y+HPALL
Sbjct  121  ANLDVLAEKLAADHSHSIKAICIVHNETATGVTNNLATVRKLLDDYRHPALL  172



>gb|AGL09526.1| alanine-glyoxylate aminotransferase, partial [Peperomia prostrata]
Length=289

 Score =   323 bits (828),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSGTPF+IP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFIIP  60

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            TTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+L
Sbjct  61   TTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDIL  120

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ASKLA DTAH+IKAICIVHNETATGVTNNLATVRK+LDHY HP+LL
Sbjct  121  ASKLASDTAHSIKAICIVHNETATGVTNNLATVRKILDHYNHPSLL  166



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = +3

Query  153  KMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTS  332
            KMDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTS
Sbjct  37   KMDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTS  96

Query  333  GTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQ  512
            GTPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQ
Sbjct  97   GTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQ  156

Query  513  GANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            GANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALL
Sbjct  157  GANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALL  209



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKT++G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LA KLA D +HTIKAICIVHNETATGVTNNLATVRKLLDHY+HPALL
Sbjct  121  ANLDILAEKLAADHSHTIKAICIVHNETATGVTNNLATVRKLLDHYRHPALL  172



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPAVPA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+L SK+AEDTAHTIKAICIVHNETATGVTNNLA VRK+L++Y+HPAL 
Sbjct  121  ANLDILESKIAEDTAHTIKAICIVHNETATGVTNNLAKVRKILBNYRHPALF  172



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTL+EDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLIEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LA KLA DTAHTIKAICIVHNETATGVTNNLATVR LLD Y HPALL
Sbjct  121  ANLDMLAMKLATDTAHTIKAICIVHNETATGVTNNLATVRNLLDEYNHPALL  172



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y+HPALL
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALL  172



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   326 bits (835),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA VR++LD Y+HPALL
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYRHPALL  172



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   325 bits (834),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LA KLA D AHTIKAICIVHNETATGVTNNL+ VR LLD Y+HPALL
Sbjct  121  ANLDILAMKLAADRAHTIKAICIVHNETATGVTNNLSAVRNLLDEYRHPALL  172



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   325 bits (834),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T F+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TSFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLAEDTAHTIKAICIVHNETATGVTNNLA VR++LD Y+HPAL 
Sbjct  121  ANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLAQVRRILDEYRHPALF  172



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   325 bits (834),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA VR++LD Y+HPALL
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYRHPALL  172



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+L SK+AEDTAHTIKAICIVHNETATGVTNNLA VRK+LD+Y+HPAL 
Sbjct  121  ANLDILESKIAEDTAHTIKAICIVHNETATGVTNNLAKVRKILDNYRHPALF  172



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   APG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDNFYAPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLDVLA KLA D  HTIKAICIVHNETATGVTNNLATVRKLLDHY HPALL
Sbjct  121  ANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALL  172



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y HPAL 
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYSHPALF  172



>gb|AGL09527.1| alanine-glyoxylate aminotransferase, partial [Piper nigrum]
Length=275

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  60

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            TTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+L
Sbjct  61   TTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDIL  120

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ASKLA DT HTIKAICIVHNETATGVTNNL TVRK+LD Y HPALL
Sbjct  121  ASKLASDTTHTIKAICIVHNETATGVTNNLLTVRKILDQYNHPALL  166



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y HPAL+
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYSHPALV  172



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   325 bits (832),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSP DRIVSFL+GQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPRDRIVSFLMGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD LASKLAED  HTIKAICIVHNETATGVTNNLATVR++LD  +HPALL
Sbjct  121  ANLDALASKLAEDRGHTIKAICIVHNETATGVTNNLATVRRILDDLRHPALL  172



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL++D  HTIKAICIVHNETATGVTN+++ VR +LDHY+HPALL
Sbjct  121  ANLQVLASKLSQDQNHTIKAICIVHNETATGVTNDISAVRTILDHYKHPALL  172



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y+HPAL 
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALF  172



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALL
Sbjct  121  ANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALL  172



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y+HPAL 
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALF  172



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QV+RAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVVRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL++D  HTIKAICIVHNETATGVTN+++ VR +LDHY+HPALL
Sbjct  121  ANLQVLASKLSQDQNHTIKAICIVHNETATGVTNDISAVRTILDHYKHPALL  172



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   324 bits (831),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVL SK+A DT+HTIKAICI HNETATGVTN+LA VR++LD Y+HPALL
Sbjct  121  AKLDVLESKIASDTSHTIKAICIAHNETATGVTNDLAKVRQILDSYRHPALL  172



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   324 bits (830),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            AN D+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y HPAL 
Sbjct  121  ANFDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYSHPALF  172



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   323 bits (829),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLA+KL++D  HTIKAICIVHNETATGVTN+++ VR +LDHY+HPALL
Sbjct  121  ANLQVLAAKLSQDQNHTIKAICIVHNETATGVTNDISAVRTILDHYKHPALL  172



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   323 bits (828),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALL
Sbjct  121  ANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALL  172



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   323 bits (828),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALL
Sbjct  121  ANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALL  172



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   323 bits (827),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+  APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDFFYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+LD LASKLA D +H+IKA+CIVHNETATGVTNNLATVRKLLD + HPALL
Sbjct  121  ADLDALASKLAADWSHSIKAVCIVHNETATGVTNNLATVRKLLDEHNHPALL  172



>gb|AGL09524.1| alanine-glyoxylate aminotransferase, partial [Calycanthus occidentalis]
Length=289

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTK LLEDVKKIFKTT+ TPF+IP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTTATPFVIP  60

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ES+WGQGANLDVL
Sbjct  61   TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESDWGQGANLDVL  120

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ASKLA DTAHTIKAICIVHNETATGVTNNLA VRKLLD Y+HPAL 
Sbjct  121  ASKLAADTAHTIKAICIVHNETATGVTNNLAAVRKLLDEYRHPALF  166



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   322 bits (825),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LA KLA DTAHTIKA+CIVHNETATGVTNNLATVR++LD Y+HPAL 
Sbjct  121  ANLDILAEKLAADTAHTIKAVCIVHNETATGVTNNLATVRRILDDYRHPALF  172



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TK LLEDVK IFKTTSG
Sbjct  1    MDYVNGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKVLLEDVKMIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL+VL +KLAED AH+IKAICIVHNETATGVTNNLA VR+LLD Y HPALL
Sbjct  121  ANLEVLEAKLAEDRAHSIKAICIVHNETATGVTNNLAKVRQLLDDYGHPALL  172



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   321 bits (823),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL+ED +H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALL
Sbjct  121  ANLQVLASKLSEDASHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALL  172



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   321 bits (823),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL 
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALF  172



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   321 bits (822),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL 
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALF  172



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   321 bits (822),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL 
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALF  172



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   320 bits (821),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 162/173 (94%), Gaps = 1/173 (1%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES-EWGQ  512
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ES EWGQ
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESGEWGQ  120

Query  513  GANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            GANLD+LA+KLA D A+TIKAICIVHNETATGVTNNLA VR LLD Y+HPALL
Sbjct  121  GANLDILATKLAADRAYTIKAICIVHNETATGVTNNLAAVRNLLDEYRHPALL  173



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   320 bits (821),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+V  PG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDFVYGPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFRVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+LD LASKL  D +HTIKA+CIVHNETATGVTN+LA VRKLLD Y+HPALL
Sbjct  121  ADLDALASKLEADRSHTIKAVCIVHNETATGVTNDLAAVRKLLDEYRHPALL  172



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   320 bits (821),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL++D  HTIKAICIVHNETATGVTN+++ VR LLDHY+HPALL
Sbjct  121  ANLQVLASKLSQDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALL  172



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKT+SG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTSSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL 
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALF  172



>gb|AGL09530.1| alanine-glyoxylate aminotransferase, partial [Xymalos monospora]
Length=289

 Score =   316 bits (809),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTK LLEDVKKIFKT +GTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTATGTPFLIP  60

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            TTGTGAWES LTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL
Sbjct  61   TTGTGAWESTLTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  120

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ASKLA D AHTIKAICIVHNETATGVTNNLA VRK+LD Y+HPAL 
Sbjct  121  ASKLAADRAHTIKAICIVHNETATGVTNNLAAVRKILDDYRHPALF  166



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALL
Sbjct  121  ANLQVLASKLSQDENHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALL  172



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ES+WG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESDWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL 
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALF  172



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALL
Sbjct  121  ANLQVLASKLSQDENHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALL  172



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL++D  HTIKAICIVHNETATGVTN+++ VR LLDHY+HPALL
Sbjct  121  ANLQVLASKLSQDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALL  172



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   318 bits (816),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF  PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFSFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL 
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALF  172



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   318 bits (816),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG+G
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+L VL+SKL++D  HTIKAICIVHNETATGVTN+++ VR LLDHY HPALL
Sbjct  121  ADLQVLSSKLSQDPQHTIKAICIVHNETATGVTNDISAVRALLDHYNHPALL  172



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   318 bits (815),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL F+VDVV+S+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFDVDVVKSQWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD+LASKLA D+AHTIKA+CIVHNETATGVTN+LA VRK+LD Y+HPAL 
Sbjct  121  ANLDILASKLAADSAHTIKAVCIVHNETATGVTNDLAKVRKILDDYRHPALF  172



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALL
Sbjct  121  ANLQVLASKLSQDENHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALL  172



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   318 bits (814),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLDVL SKLA D  HTIKAICIVHNETATGVTN+L+ VR LLD Y+HPALL
Sbjct  121  ANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALL  172



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   318 bits (814),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++L  Y+HPAL 
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILHEYRHPALF  172



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   318 bits (814),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQ+RL FNVDV+ESEWG+G
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQKRLGFNVDVIESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+L+ ++SK+A DTAHT+KAICIVHNETATGVTNNLATVR++LDHY HPALL
Sbjct  121  ADLEAMSSKIAADTAHTVKAICIVHNETATGVTNNLATVRRILDHYNHPALL  172



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   318 bits (814),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLDVL SKLA D  HTIKAICIVHNETATGVTN+L+ VR LLD Y+HPALL
Sbjct  121  ANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALL  172



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYR+PA+PALTKTLLEDVKK+FKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRAPAIPALTKTLLEDVKKLFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGD IVSFLIGQFSLLWIDQQQRL F VDV+ESEWGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDTIVSFLIGQFSLLWIDQQQRLKFKVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLD LASKLA D  HTIKA+CIVHNETATGVTNNLA VRKLLD Y HPALL
Sbjct  121  ANLDELASKLAADRTHTIKAVCIVHNETATGVTNNLAAVRKLLDDYNHPALL  172



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPAL KTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALAKTLLEDVKKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLDVL SKLA D  HTIKAICIVHNETATGVTN+L+ VR LLD Y+HPALL
Sbjct  121  ANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALL  172



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   316 bits (809),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWID+QQRLNF VDV+ESEWG+G
Sbjct  61   TLFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDRQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL 
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALF  172



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   316 bits (809),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANLDVL SKLA D   TIKAICIVHNETATGVTN+L+ VR LLD Y+HPALL
Sbjct  121  ANLDVLESKLAADGGQTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALL  172



>gb|AGL09523.1| alanine-glyoxylate aminotransferase, partial [Asarum caudatum]
Length=289

 Score =   310 bits (795),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFLIP  60

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            TTGTGAWESALTNTLSPGD+ VSFLIGQFSLLWIDQQQRL FNV+V+ESEWGQGANLD+L
Sbjct  61   TTGTGAWESALTNTLSPGDQTVSFLIGQFSLLWIDQQQRLKFNVNVIESEWGQGANLDIL  120

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ASKLA D+ H IKAICIVHNETATGVTNNLA VRK+LD Y+HPAL 
Sbjct  121  ASKLAADSEHKIKAICIVHNETATGVTNNLAAVRKILDDYKHPALF  166



>gb|ABR26028.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=198

 Score =   305 bits (780),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PFL PTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG GA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGYGA  122

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +L  L  KL +D +H+IKAICIVHNETATGVTN+L+ VRK+LD ++HPALL
Sbjct  123  DLAALDYKLRQDPSHSIKAICIVHNETATGVTNDLSAVRKILDKHRHPALL  173



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+VDVVES+WG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+L VL SKL  D+ HTIKAICIVHNETATGVTN+L  VRKLLD Y+HPALL
Sbjct  121  ADLGVLESKLRSDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALL  172



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  144  EGEKMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFK  323
            E  KMDYV  PGRNHLFVPGPVNIPD VIRAM+R NEDYRSPAVPALTKTLLEDVKKIFK
Sbjct  57   ENSKMDYVYGPGRNHLFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFK  116

Query  324  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            TT+GTPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRLNF VDVVES+
Sbjct  117  TTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESD  176

Query  504  WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            WG GA+L  L +KL++D AHTIKA+CIVHNETATGVTN+L  VRKLLD Y+HPALL
Sbjct  177  WGHGADLGALETKLSQDAAHTIKAVCIVHNETATGVTNDLHAVRKLLDAYRHPALL  232



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   310 bits (794),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+VDVVES+WG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+L  L SKL  D+ HTIKAICIVHNETATGVTN+L  VRKLLD Y+HPALL
Sbjct  121  ADLGALESKLRTDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALL  172



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WG+GA
Sbjct  63   PFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGRGA  122

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +LDVL +KL +DTAHTIKAI IVHNETATGVTN+LATVRKLLD Y+HPAL+
Sbjct  123  DLDVLEAKLRQDTAHTIKAIAIVHNETATGVTNDLATVRKLLDTYRHPALI  173



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  38   DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  97

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WG+GA
Sbjct  98   PFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGRGA  157

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +LDVL +KL +DTAHTIKAI IVHNETATGVTN+LATVRKLLD Y+HPAL+
Sbjct  158  DLDVLEAKLRQDTAHTIKAIAIVHNETATGVTNDLATVRKLLDTYRHPALI  208



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   308 bits (789),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1    MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL++LA K+A D AHTIKA+CIVHNETATGVTNNLA VR++LD Y+HPAL 
Sbjct  121  ANLEILAEKIAADRAHTIKAVCIVHNETATGVTNNLAAVRRILDEYRHPALF  172



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1    MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ANL++LA K+A D AHTIKA+CIVHNETATGVTNNLA VR++LD Y HPAL 
Sbjct  121  ANLEILAEKIAADRAHTIKAVCIVHNETATGVTNNLAAVRRILDEYXHPALF  172



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PFL PTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG GA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGYGA  122

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +L  L  KL +D +H+IKAICIVHNETATGVTN+L+ VRK+LD ++HPALL
Sbjct  123  DLAALDYKLRQDPSHSIKAICIVHNETATGVTNDLSAVRKILDKHRHPALL  173



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DY   PGRNHLFVPGPVNIPDQVIRAM R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYAYGPGRNHLFVPGPVNIPDQVIRAMNRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVES+WGQGA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESDWGQGA  122

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +L  L  KL  D +HTIKAICIVHNETATGVTN+L+ VRKLLD ++HPALL
Sbjct  123  DLAALDYKLRGDPSHTIKAICIVHNETATGVTNDLSAVRKLLDKHRHPALL  173



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   303 bits (775),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGRNHLFVPGPVNIPD VIRAM R NEDYRSPA+PALTK LLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDPVIRAMNRQNEDYRSPAIPALTKVLLEDVKRIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDVVES+WG GA
Sbjct  63   PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFDVDVVESDWGHGA  122

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +LD L  KL +DT HTIKA+ IVHNETATGVTN+LA VR LLD Y HPALL
Sbjct  123  DLDALERKLRDDTLHTIKAVAIVHNETATGVTNDLAAVRTLLDAYAHPALL  173



>gb|AGL09528.1| alanine-glyoxylate aminotransferase, partial [Saururus cernuus]
Length=279

 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  207  VNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESAL  386
            VNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESAL
Sbjct  1    VNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESAL  60

Query  387  TNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHT  566
            TNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQGANLD+LASKLA DTAHT
Sbjct  61   TNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESEWGQGANLDILASKLAADTAHT  120

Query  567  IKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            IKAICIVHNETATGVTNNLATVRK+LD Y HPALL
Sbjct  121  IKAICIVHNETATGVTNNLATVRKILDDYGHPALL  155



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGR+HLFVPGP NIP+QVIRAM RNNE++R+PA+PALTK LL+DVKKIFKTTSG
Sbjct  1    MDYVYGPGRSHLFVPGPSNIPEQVIRAMNRNNENHRTPAIPALTKALLDDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIP+TGTGAWESALTNTLSPGD+IVSFL+GQFSLLWI+QQ++LNF VDVVESEWGQ 
Sbjct  61   IPFLIPSTGTGAWESALTNTLSPGDQIVSFLMGQFSLLWIEQQKKLNFKVDVVESEWGQD  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+LD L SKLA D +HTIKAICIVHNETATGVTN+L  +RK+LD+Y+HPAL+
Sbjct  121  ADLDALESKLASDKSHTIKAICIVHNETATGVTNDLPKLRKILDYYKHPALV  172



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   297 bits (761),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+   PGRNHLFVPGP NIP+ VIRAM RNNE++R+PA+  LTKTLL+DVKKIFKTTSG
Sbjct  1    MDFAYGPGRNHLFVPGPTNIPEHVIRAMNRNNENHRTPAITTLTKTLLDDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWI+QQ+RLNF VDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIEQQKRLNFKVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+LD L SKLA D  HTIKAICIVHNET TGVTN+L  VRK+LD YQHPAL+
Sbjct  121  ADLDALESKLASDKTHTIKAICIVHNETTTGVTNDLTKVRKILDKYQHPALI  172



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   295 bits (754),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GR +  VPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+GT FLIPT
Sbjct  1    GRGNSIVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAGTTFLIPT  60

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQGANLDVL 
Sbjct  61   TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLE  120

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            SKLA D   TIKAICIVHNETATGVTN+L+ VR LLD Y+HPALL
Sbjct  121  SKLAADGGQTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALL  165



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGA  122

Query  519  NLDVLASKLAEDT-AHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +L  L  +L ED   H IKA+ IVHNETATGVTN+LA VR LLD + HPALL
Sbjct  123  DLAALERRLREDAPRHAIKAVAIVHNETATGVTNDLAAVRALLDKHAHPALL  174



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGA  122

Query  519  NLDVLASKLAEDT-AHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +L  L  +L ED   H IKA+ IVHNETATGVTN+LA VR LLD + HPALL
Sbjct  123  DLAALERRLREDAPRHAIKAVAIVHNETATGVTNDLAAVRALLDKHAHPALL  174



>gb|AGL09525.1| alanine-glyoxylate aminotransferase, partial [Manekia incurva]
Length=267

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  243  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVS  422
            RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSP DRIVS
Sbjct  2    RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPCDRIVS  61

Query  423  FLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETA  602
            FLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+LASKLA DT HTIKAICIVHNETA
Sbjct  62   FLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDILASKLASDTTHTIKAICIVHNETA  121

Query  603  TGVTNNLATVRKLLDHYQHPALL  671
            TGVTNNLATVRK+LD Y+HPALL
Sbjct  122  TGVTNNLATVRKILDTYKHPALL  144



>gb|AGL09529.1| alanine-glyoxylate aminotransferase, partial [Thottea sp. JN-2013]
Length=252

 Score =   272 bits (696),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  243  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVS  422
            RNNEDYRSPAVP LTKTLLEDVKKIFKTT+GTPFLIPTTGTGAWESALTNTLSPGDRIVS
Sbjct  1    RNNEDYRSPAVPLLTKTLLEDVKKIFKTTAGTPFLIPTTGTGAWESALTNTLSPGDRIVS  60

Query  423  FLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETA  602
            FLIGQFSLLWIDQQQRLNFNVDVVES+WG+GA+L+VLASKLA DT+HTIKAIC+VHNETA
Sbjct  61   FLIGQFSLLWIDQQQRLNFNVDVVESDWGRGADLEVLASKLAADTSHTIKAICLVHNETA  120

Query  603  TGVTNNLATVRKLLDHYQHPALL  671
            TGVTNNLA VR++LDHY HPAL 
Sbjct  121  TGVTNNLAAVRRILDHYGHPALF  143



>gb|AGL09531.1| alanine-glyoxylate aminotransferase, partial [Zippelia begoniifolia]
Length=259

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +3

Query  252  EDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI  431
            EDYRSPAVPALTKTLL+DVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI
Sbjct  1    EDYRSPAVPALTKTLLQDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI  60

Query  432  GQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGV  611
            GQFSLLWIDQQQRL FNVDVVES+WGQGANLD+LASKLA DT+HTIKAICIVHNETATGV
Sbjct  61   GQFSLLWIDQQQRLGFNVDVVESDWGQGANLDILASKLASDTSHTIKAICIVHNETATGV  120

Query  612  TNNLATVRKLLDHYQHPALL  671
            TNNLATVR +LD Y+HPALL
Sbjct  121  TNNLATVRNILDTYKHPALL  140



>ref|XP_008666464.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
Length=229

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = +3

Query  189  LFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTG  368
            +FVPGPVNIP  V RAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GTPF+IPTTGTG
Sbjct  1    MFVPGPVNIPGPVNRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGTPFMIPTTGTG  60

Query  369  AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLA  548
             WESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA+L  L  +L 
Sbjct  61   VWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGADLAALERRLR  120

Query  549  EDT-AHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +D   H IKA+ IVHNETATGVTN+LA VR LLD + HPALL
Sbjct  121  DDAPRHAIKAVAIVHNETATGVTNDLAAVRALLDKHAHPALL  162



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   265 bits (677),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDRI+SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRIISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LDHY HPALL
Sbjct  121  LATVRKILDHYNHPALL  137



>tpg|DAA47874.1| TPA: hypothetical protein ZEAMMB73_131074 [Zea mays]
Length=290

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = +3

Query  189  LFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTG  368
            +FVPGPVNIP  V RAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GTPF+IPTTGTG
Sbjct  1    MFVPGPVNIPGPVNRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGTPFMIPTTGTG  60

Query  369  AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLA  548
             WESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA+L  L  +L 
Sbjct  61   VWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGADLAALERRLR  120

Query  549  EDTA-HTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +D   H IKA+ IVHNETATGVTN+LA VR LLD + HPALL
Sbjct  121  DDAPRHAIKAVAIVHNETATGVTNDLAAVRALLDKHAHPALL  162



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  237  MTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRI  416
            M RNNEDYR+P +PALTK LLEDVKKIFKTT+GTPFLIPTTGTGAWESALTNTLSPGDR 
Sbjct  1    MNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRT  60

Query  417  VSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNE  596
            VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQGANL++LA K+A D AHTIKA+CIVHNE
Sbjct  61   VSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQGANLEILAEKIAADRAHTIKAVCIVHNE  120

Query  597  TATGVTNNLATVRKLLDHYQHPALL  671
            TATGVTNNLA VR++LD Y+HPAL 
Sbjct  121  TATGVTNNLAAVRRILDEYRHPALF  145



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +L++L +KL  D  H +KAIC VHNETATGVTNNLA +R ++D   HPAL 
Sbjct  121  VDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALF  172



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +L++L +KL  D  H +KAIC VHNETATGVTNNLA +R ++D   HPAL 
Sbjct  121  VDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALF  172



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD    PGRN LFVPGPVNIP+ V+ AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLHAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +L++L +KL  D  H +KAIC VHNETATGVTNNLA +R ++D   HPAL 
Sbjct  121  VDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALF  172



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+T + 
Sbjct  1    MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKEIFRTKTA  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T F+ PTTGTGAWESALTNTLSPGD+I+SF +GQFSLLWIDQ QR NF+VDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGAG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +LDVL  KL  D +H++KA+C+VHNET+TGVTN++  VR++LD   HPALL
Sbjct  121  IDLDVLKQKLVSDRSHSVKAVCVVHNETSTGVTNDIGAVRRVLDEANHPALL  172



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   259 bits (662),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   259 bits (662),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANLD+L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLDILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD Y HPALL
Sbjct  121  LATVRKILDDYNHPALL  137



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   260 bits (664),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD Y HPALL
Sbjct  121  LATVRKILDXYNHPALL  137



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKMLDNYNHPALL  137



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQ RL FNVDVVES+WG GANL+++ASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQTRLGFNVDVVESDWGLGANLEIMASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LDHY HPALL
Sbjct  121  LATVRKILDHYNHPALL  137



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTT GTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTXGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LDHY HPALL
Sbjct  121  LATVRKILDHYNHPALL  137



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD Y HPALL
Sbjct  121  LATVRKILDDYNHPALL  137



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD Y HPALL
Sbjct  121  LATVRKILDDYNHPALL  137



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD Y HPALL
Sbjct  121  LATVRKILDDYNHPALL  137



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD Y HPALL
Sbjct  121  LATVRKILDDYNHPALL  137



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   258 bits (660),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   259 bits (663),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+TT+ 
Sbjct  1    MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKQIFRTTTA  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T F+ PTTGTGAWESALTNTLSPGD+I+SF +GQFSLLWIDQ QR NF+VDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +LD L  KL  D +H++KA+C+VHNET+TGVTN++  +R+++D  +HPALL
Sbjct  121  VDLDNLKQKLQSDWSHSVKAVCVVHNETSTGVTNDIGAIRRVMDEARHPALL  172



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD Y HPALL
Sbjct  121  LATVRKILDDYNHPALL  137



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   258 bits (659),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1    MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T F+ PTTGTGAWESALTNTLSPGD+IVSF +GQFSLLWIDQ QRL FNVDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+L++L +KLA D  H IKAICIVHNET+TGVTN++ ++R LLD ++HPALL
Sbjct  121  ADLNILNAKLAMDYNHEIKAICIVHNETSTGVTNSIPSIRALLDKHKHPALL  172



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1    MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T F+ PTTGTGAWESALTNTLSPGD+IVSF +GQFSLLWIDQ QRL FNVDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+L++L +KLA D  H IKAICIVHNET+TGVTN++ ++R LLD ++HPALL
Sbjct  121  ADLNILNAKLAMDYNHEIKAICIVHNETSTGVTNSIPSIRALLDKHKHPALL  172



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQ+RL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQERLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPAL KTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALAKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVH ETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDVAHTIKAICIVHXETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVR +LD+Y HPALL
Sbjct  121  LATVRNILDNYNHPALL  137



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK LD+Y HPALL
Sbjct  121  LATVRKXLDNYNHPALL  137



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGT F+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTSFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA + AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASNAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD++ HPALL
Sbjct  121  LATVRKILDNHNHPALL  137



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   254 bits (648),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDXAHXIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVR +LD+Y HPALL
Sbjct  121  LATVRXILDNYNHPALL  137



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD   HPALL
Sbjct  121  LATVRKILDDCNHPALL  137



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD   HPALL
Sbjct  121  LATVRKILDDCNHPALL  137



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D A +IKA+CIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAXSIKAVCIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSG PF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGAPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD++ HPALL
Sbjct  121  LATVRKILDNHNHPALL  137



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL  +VDVVES+WG GANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGLDVDVVESDWGHGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTT G PF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTPGIPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGV NN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVANN  120

Query  621  LATVRKLLDHYQHPALL  671
            LATVRK+LD+Y HPALL
Sbjct  121  LATVRKILDNYNHPALL  137



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+   APGRNHLFVPGP NIPD+V++AM RNNED+RSP  PAL K++LEDVK +F+T +G
Sbjct  1    MELFPAPGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ P++GTGAWESALTNT+SPGDRI+   +GQF +LWI+   RL+FNVDV+E EWG+G
Sbjct  61   TPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +L++L  KL  D  H +KA+C+VHNET+TGVTN+L+ VRK LD  +HPALL
Sbjct  121  IDLEILKQKLQSDHTHAVKAVCVVHNETSTGVTNDLSAVRKALDEARHPALL  172



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  282  LTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQ  461
            LTK LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQ
Sbjct  1    LTKNLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQ  60

Query  462  QQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKL  641
            QQRL FNVDVVES+WG GA+LD LASK+AEDTAHTIKA+CIVHNETATGVTNNLATVRK+
Sbjct  61   QQRLKFNVDVVESDWGAGADLDALASKIAEDTAHTIKAVCIVHNETATGVTNNLATVRKI  120

Query  642  LDHYQHPALL  671
            LDHYQHPAL 
Sbjct  121  LDHYQHPALF  130



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +3

Query  294  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  473
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  474  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHY  653
             FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y
Sbjct  61   GFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNY  120

Query  654  QHPALL  671
             HPALL
Sbjct  121  NHPALL  126



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  294  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  473
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  474  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHY  653
             FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNNLATVRK+LD+Y
Sbjct  61   GFNVDVVESDWGHGANLEILASKLASDVAHTIKAICIVHNETATGVTNNLATVRKILDNY  120

Query  654  QHPALL  671
             HPALL
Sbjct  121  NHPALL  126



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  294  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  473
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  474  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHY  653
             FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y
Sbjct  61   GFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNY  120

Query  654  QHPALL  671
             HPALL
Sbjct  121  NHPALL  126



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  297  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  476
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  477  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQ  656
            FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y 
Sbjct  61   FNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNYN  120

Query  657  HPALL  671
            HPALL
Sbjct  121  HPALL  125



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   236 bits (602),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  297  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  476
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  477  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQ  656
            FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y 
Sbjct  61   FNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNYN  120

Query  657  HPALL  671
            HPALL
Sbjct  121  HPALL  125



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  297  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  476
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  477  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQ  656
            FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD Y 
Sbjct  61   FNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDDYN  120

Query  657  HPALL  671
            HPALL
Sbjct  121  HPALL  125



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  KTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQ  467
            KTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGD  +SFLIGQFSLLWIDQQQ
Sbjct  1    KTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDXTISFLIGQFSLLWIDQQQ  60

Query  468  RLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLD  647
            RL F VDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD
Sbjct  61   RLGFXVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILD  120

Query  648  HYQHPALL  671
            +Y HPALL
Sbjct  121  NYNHPALL  128



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   233 bits (595),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  294  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  473
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  474  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHY  653
             FNVDVVES+WG GANL++LAS LA D  H+IKAICIVHNETATGVTNNLATVRK+LD+Y
Sbjct  61   GFNVDVVESDWGHGANLEILASXLASDAGHSIKAICIVHNETATGVTNNLATVRKILDNY  120

Query  654  QHPALL  671
             HPALL
Sbjct  121  NHPALL  126



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1    MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTG WE A  NTLS GDR+++F+ GQFS LW  Q Q+L+F+VD V+ +WG G
Sbjct  61   TPFIIPTTGTGGWECAAVNTLSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +L VL SKL  D  H IKA+C+VHNET+TG+  NL  VR +LD  QHPALL
Sbjct  121  VDLGVLDSKLRADEEHRIKAVCVVHNETSTGININLGVVRAILDSNQHPALL  172



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1    MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTG WE A  NTLS GDR+++F+ GQFS LW  Q Q+L+F+VD V+ +WG G
Sbjct  61   TPFIIPTTGTGGWECAAVNTLSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +L VL SKL  D  H IKA+C+VHNET+TG+  NL  VR +LD  QHPALL
Sbjct  121  VDLGVLDSKLRADEEHRIKAVCVVHNETSTGININLGVVRAILDLNQHPALL  172



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  297  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  476
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  477  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQ  656
            F VDVVES+WG GANL++LASKLA D  H+IKAICIVHNETATGVTNNLATVRK+LD+Y 
Sbjct  61   FIVDVVESDWGHGANLEILASKLASDAGHSIKAICIVHNETATGVTNNLATVRKILDNYN  120

Query  657  HPALL  671
            HPALL
Sbjct  121  HPALL  125



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +3

Query  312  KIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV  491
            KIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDV
Sbjct  1    KIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDV  60

Query  492  VESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            VES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLAT RK+LD Y HPALL
Sbjct  61   VESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLATARKILDDYNHPALL  120



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  321  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  500
            KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1    KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  501  EWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNNLATVRK+LD+Y HPALL
Sbjct  61   DWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNNLATVRKILDNYNHPALL  117



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  321  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  500
            KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1    KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  501  EWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNNLATVRK+LD+Y HPALL
Sbjct  61   DWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNNLATVRKILDNYNHPALL  117



>gb|ADO24297.1| aminotransferase [Valeriana jatamansi]
Length=116

 Score =   215 bits (548),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   A GRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            TPFL PTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQQRL FNVDVVESE
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQQRLGFNVDVVESE  116



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  321  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  500
            KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1    KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  501  EWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            +WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y HPALL
Sbjct  61   DWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNYNHPALL  117



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  330  SGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWG  509
            SGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WG
Sbjct  1    SGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWG  60

Query  510  QGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            QGANL++LASKLA D AHTIKAICIVHNETATGVTNNLATVRK+LD+Y HPALL
Sbjct  61   QGANLEILASKLASDAAHTIKAICIVHNETATGVTNNLATVRKILDNYNHPALL  114



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   218 bits (554),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +3

Query  324  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            TTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1    TTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  504  WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y HPALL
Sbjct  61   WGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNYNHPALL  116



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   218 bits (555),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +3

Query  324  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            TTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1    TTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  504  WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD Y HPALL
Sbjct  61   WGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDDYNHPALL  116



>gb|ADG26437.1| putative aminotransferase [Valeriana jatamansi]
Length=116

 Score =   209 bits (533),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   A GRNH+FVPG VNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHMFVPGLVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            TPFL PTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQQRLGFNVDVVESK  116



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +3

Query  324  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            T SGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1    TXSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  504  WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD Y HPALL
Sbjct  61   WGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDDYNHPALL  116



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G+N L VPGP N+PD+V+RAM RN+ED+RSP  PAL KT+LE++K +F TT G  F+ P 
Sbjct  5    GKNFLMVPGPTNVPDRVLRAMHRNSEDHRSPDFPALAKTVLENIKWVFGTTKGRSFIFPA  64

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+ALTNTL+ GD+++S   GQFS LWID  QRL   V +++ +WG+G  +D+L+
Sbjct  65   SGTGAWEAALTNTLNKGDKVISVRFGQFSHLWIDMMQRLGLEVTILDVDWGEGIPIDILS  124

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            S +A+DT H  +A+C+VHNET TGVT ++A VR +LD Y HPALL
Sbjct  125  SYIAQDTRHEYQAVCVVHNETTTGVTTDIAAVRNILDRYHHPALL  169



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   214 bits (546),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  333  GTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQ  512
            GTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WGQ
Sbjct  1    GTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQ  60

Query  513  GANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y HPALL
Sbjct  61   GANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNYNHPALL  113



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFN  482
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFS  109



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESALTNTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLARGDKVLTARYGQFSHLWIDMAQRLGLDVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A  D +   L  D  H IKA+ +VHNETATGVT+N+  VRK +D   HPA+L
Sbjct  121  AKADKIEEALRADKDHQIKAVMVVHNETATGVTSNIGAVRKAIDAAGHPAML  172



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESAL+NTL+ GD++V+   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVVAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A  + +   L  D  H IKA+ +VHNETATGVT+N+  VRK +D   HPALL
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGAVRKAIDAAGHPALL  172



>ref|XP_005648727.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24183.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
Length=434

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 120/166 (72%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHL VPGPVNI +QV+RAM R ++++R P  P   + +LED K IFKTT GTPF+ P
Sbjct  41   PGRNHLAVPGPVNIHEQVMRAMDRPSQNHRDPWFPPFFQQILEDTKYIFKTTEGTPFIFP  100

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
             TGTG WE ALTNTLSPGD++V+F  GQFS LWID  QRL  +V VVE EWG GA+   L
Sbjct  101  GTGTGGWEVALTNTLSPGDKVVTFRYGQFSHLWIDMMQRLGLDVQVVEVEWGGGADEAKL  160

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
               L  DT   IKA+ +VHNET TGVT+++  VR+++D   HPALL
Sbjct  161  EQILKADTDKKIKAVAVVHNETTTGVTSDIGQVRQVMDSVSHPALL  206



>ref|WP_041930245.1| serine--glyoxylate aminotransferase, partial [Methylibium petroleiphilum]
Length=395

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPIIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
              LA+D  H IKA+   HNETATGVT+++A VRK LD  +HPALL
Sbjct  123  EILAKDKGHKIKAVIATHNETATGVTSDIAGVRKALDDARHPALL  167



>gb|ABM96214.1| serine-glyoxylate aminotransferase [Methylibium petroleiphilum 
PM1]
Length=415

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPIIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
              LA+D  H IKA+   HNETATGVT+++A VRK LD  +HPALL
Sbjct  123  EILAKDKGHKIKAVIATHNETATGVTSDIAGVRKALDDARHPALL  167



>ref|WP_020188076.1| hypothetical protein [Methylopila sp. 73B]
Length=402

 Score =   207 bits (527),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK+FKT  G  F+ P
Sbjct  5    PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVFKTKDGQVFIFP  64

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTG WE+ALTNTL+PGD++++   GQFS LW D  QRL  +V + E EWG GA+ + +
Sbjct  65   SSGTGGWEAALTNTLAPGDKVLTARFGQFSHLWTDMAQRLGLDVQIQEEEWGTGAHEEKI  124

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
               L  DTAH IKA+ +VHNETATGVT+N+  +RK +D  +HPALL
Sbjct  125  EEALVADTAHEIKAVMVVHNETATGVTSNIGAIRKAMDAAKHPALL  170



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESAL+NTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVLAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A  + +   L  D  H IKA+ +VHNETATGVT+N+  VRK +D   HPALL
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGAVRKAIDAAGHPALL  172



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESAL+NTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVLAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A  + +   L  D  H IKA+ +VHNETATGVT+N+  VRK +D   HPALL
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGAVRKAIDAAGHPALL  172



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESALTNTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLARGDKVLTSRYGQFSHLWIDMAQRLGLDVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A  + +   L  D  H IKA+ +VHNETATGVT+N+  VRK +D   HPA+L
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGAVRKAIDAAGHPAML  172



>ref|WP_026362994.1| serine--glyoxylate aminotransferase [Methylopila sp. M107]
Length=402

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK++KTT G  F+ P
Sbjct  5    PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVYKTTEGQVFIFP  64

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTG WE+AL NTL+PGD++++   GQFS LW D  QRL  +V ++E EWG GA+ + +
Sbjct  65   SSGTGGWEAALANTLAPGDKVLNSRFGQFSHLWTDMAQRLGLDVQILEEEWGTGAHEEKI  124

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
               L  D AH IKA+ +VHNETATGVT+N+  +RK +D  +HPALL
Sbjct  125  EEALVADKAHEIKAVMVVHNETATGVTSNIGAIRKAIDAAKHPALL  170



>ref|WP_036230592.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylibium]
 gb|EWS54025.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29]
 gb|EWS61014.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29-B]
Length=415

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTNGTPIIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
              L++D  H IKA+   HNETATGVT+++A VRK LD  +HPALL
Sbjct  123  EILSKDKGHRIKAVIATHNETATGVTSDIAGVRKALDDARHPALL  167



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  342  FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGAN  521
             L    GTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQGAN
Sbjct  4    LLFCILGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQGAN  63

Query  522  LDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            LDVLA KLA D  HTIKAICIVHNETATGVTNNLATVRKLLDHY HPALL
Sbjct  64   LDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALL  113



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   204 bits (519),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGR HL+VPGP NIPD ++ AM    ED+R P  P L + LLED+KKIF+T SG  F+ P
Sbjct  2    PGRTHLYVPGPTNIPDSILSAMHVPMEDHRRPDFPELIQPLLEDLKKIFQTKSGQCFIFP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
             TGT  WE ALTNTLSPGD+++++  GQFS LWID  +RL F+V+  E  WG+G  LD L
Sbjct  62   ATGTAGWEIALTNTLSPGDKVLAYRFGQFSHLWIDMARRLGFDVEYEEVPWGEGVPLDRL  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             ++L  DT H IKA+ I HNETATGVT++LA VRK LD   HPA+ 
Sbjct  122  EARLKADTKHEIKALLICHNETATGVTSDLAGVRKALDAANHPAMF  167



>ref|WP_010960683.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus]
 gb|AAU92322.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus 
str. Bath]
Length=395

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHL+VPGP NIPD V+ AM    ED+R P  PAL   LLE++KK+F+T +G  F+ P
Sbjct  2    PGRNHLYVPGPTNIPDAVLSAMHVPMEDHRRPDFPALVTPLLENLKKVFRTEAGQCFIFP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
             TGT  WE AL+NTLSPGD+++S+  GQFS LWID  +RL   V+  E  WGQG  LD L
Sbjct  62   ATGTAGWEIALSNTLSPGDKVLSYRFGQFSHLWIDLARRLGLEVEYEEVPWGQGVPLDRL  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             ++L  DTAH IKA+ I HNETATGVTN+L  VRK +D   HPAL 
Sbjct  122  EARLKADTAHEIKAVLICHNETATGVTNDLPAVRKAIDAAGHPALF  167



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 119/166 (72%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRN LFVPGP NIPD+V RAM   +ED+RS A P LT  L E+ KKIFK+  G  FL P
Sbjct  7    PGRNFLFVPGPTNIPDRVQRAMIVPSEDHRSSAFPELTLPLFEETKKIFKSREGQIFLFP  66

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
             TGTGAWE+ALTNTLSPGDR+++   GQFS LWID  +R+  +V+V E EWG+GA+ D +
Sbjct  67   ATGTGAWEAALTNTLSPGDRVLAPRYGQFSTLWIDLARRVGLDVEVQEEEWGKGADPDRI  126

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
               L  D  H IKA+ +VHNET TGVT+++  VRK +D   HPA+L
Sbjct  127  EEALRADREHRIKAVLVVHNETTTGVTSDIGAVRKAIDAAGHPAML  172



>ref|WP_014149643.1| serine--glyoxylate aminotransferase [Methylomicrobium alcaliphilum]
 ref|YP_004918468.1| serine-glyoxylate aminotransferase [Methylomicrobium alcaliphilum 
20Z]
 emb|CCE24883.1| Serine-glyoxylate aminotransferase [Methylomicrobium alcaliphilum 
20Z]
Length=387

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 118/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTLSPGD+++ +  GQFS LW    +RL+F V V+E  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWAAMAKRLDFEVIVIERPWGEGIPLDDLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L ED  H IKAI   HNETATGVT+++  VRK +D   HPALL
Sbjct  123  ARLKEDGKHEIKAILATHNETATGVTSDIGGVRKAMDAAGHPALL  167



>ref|WP_017840623.1| serine--glyoxylate aminotransferase [Methylomicrobium buryatense]
Length=387

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTLSPGD+++ +  GQFS LW    +RL F V V+E  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWAAMAKRLGFEVIVIERPWGEGIPLDDLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L ED  H IKAI   HNETATGVT+++  VRK +D   HPALL
Sbjct  123  ARLKEDGQHEIKAILATHNETATGVTSDIGGVRKAMDAAGHPALL  167



>ref|WP_027156802.1| serine--glyoxylate aminotransferase [Methylobacter luteus]
Length=388

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL FNV++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFNVEIHQETWGKGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L EDT H IKA+   HNETATGVT+++  VRK +D   HPALL
Sbjct  123  ARLKEDTKHEIKAVLATHNETATGVTSDIGGVRKAMDAANHPALL  167



>ref|WP_018238561.1| serine--glyoxylate aminotransferase [Ensifer sp. BR816]
Length=396

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PG NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK   G  F+ P
Sbjct  2    PGYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNQDGRVFIYP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ 
Sbjct  62   SSGTGAWEAAMTNVLSPGDRLLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELY  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A +LA D AH IKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  122  AERLAADKAHEIKAVFVTHNETATGVTSDVAAVRAALDACGHPALL  167



>ref|WP_014762956.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 gb|AFL50786.1| serine--glyoxylate aminotransferase SgaA [Sinorhizobium fredii 
USDA 257]
Length=396

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  SG  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNHSGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLRFEVDCIDREWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +LA D AH IKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  ERLAADKAHKIKAVFVTHNETATGVTSDVAAVRASLDACGHPALL  167



>ref|WP_007559580.1| serine--glyoxylate aminotransferase [Methylobacterium sp. GXF4]
 gb|EIZ86366.1| class V aminotransferase [Methylobacterium sp. GXF4]
Length=402

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLF+PGP NIPD+V+RAM   +ED+RSP  P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPDRVLRAMHVPSEDHRSPGFPELVKPLLQDAKIVFGSTAG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDKVLTSRYGQFSHLWVDMAQRLGLDVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+   +   L  D  H IKA+ +VHNETATGVT+++A VRK LD   HPALL
Sbjct  121  ADPQKIEEALRADKDHAIKAVMVVHNETATGVTSDIAAVRKALDAAGHPALL  172



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 118/172 (69%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   PALTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPALTKPLFEETKAVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WE+ALTNTL  GD++++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWEAALTNTLHRGDKVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+ + +   L  DT H IKA+  VHNETATGVT+++  VRK +D   HPALL
Sbjct  121  ASPERIEEALRADTNHEIKAVMTVHNETATGVTSDIGAVRKAIDAAGHPALL  172



>ref|WP_018410273.1| serine--glyoxylate aminotransferase [Methyloversatilis sp. NVD]
Length=396

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 114/165 (69%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHLFVPGP N+PD+V+RAM    ED+RSP  P LTK++L D+KK+FKTT GT    P 
Sbjct  6    GRNHLFVPGPTNVPDRVLRAMVVAQEDHRSPKFPELTKSVLADLKKVFKTTEGTILTFPA  65

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTG WE+ALTNTLSPGD+++    GQFS LW D  QRL F V +++ EWG G   D   
Sbjct  66   SGTGMWEAALTNTLSPGDKVLCSRFGQFSHLWADMAQRLGFEVQILDVEWGTGVPYDQYE  125

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
              L  D  H IKA+    NETATGVT+++  VR+ +D+  HPALL
Sbjct  126  EVLRADKEHKIKAVLACQNETATGVTSDIGRVRRAMDNANHPALL  170



>ref|WP_037416404.1| serine--glyoxylate aminotransferase [Sinorhizobium sp. CCBAU 
05631]
Length=396

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  D+K++FK  SG  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADIKRVFKNQSGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN L PGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLYPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +LA D AHTIKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  DRLAADKAHTIKAVFVTHNETATGVTSDVAAVRAALDACGHPALL  167



>ref|WP_034858116.1| serine--glyoxylate aminotransferase [Ensifer sojae]
Length=396

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 118/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNENGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +L+ D AH+IKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  ERLSADKAHSIKAVFVTHNETATGVTSDVAAVRAALDACNHPALL  167



>ref|WP_003535479.1| serine--glyoxylate aminotransferase [Sinorhizobium meliloti]
 gb|EHK74228.1| serine--glyoxylate aminotransferase [Sinorhizobium meliloti CCNWSX0020]
Length=396

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 116/165 (70%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKKIFK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFSDVKKIFKNQNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D   RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAARLGFEVDCIDREWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +L+ D AH IKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  ERLSADKAHKIKAVFVTHNETATGVTSDVAAVRAALDACAHPALL  167



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 115/172 (67%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESALTNTL  GD +++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLHRGDTVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            AN   +   L  DT H IKA+  VHNETATGVT+++  VRK +D   HPALL
Sbjct  121  ANPQRIEEALRADTNHEIKAVMTVHNETATGVTSDIGAVRKAIDAAGHPALL  172



>ref|WP_031434945.1| serine--glyoxylate aminotransferase [Methylomarinum vadi]
Length=388

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHLF+PGP N P +V+ AM    ED+RSP  P L K +LED+KK+F+T +G  F+ P 
Sbjct  3    GRNHLFIPGPTNTPHEVLSAMHVPMEDHRSPDFPKLLKPVLEDLKKVFRTETGQAFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTLSPGD+++ +  GQFS LW+D  +RL  +V+  E EWG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWMDMAKRLGLDVEFHEVEWGKGIPLDALE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L ED  H IKA+   HNETATGVT+++A VRK +D   HPALL
Sbjct  123  TRLKEDGNHEIKAVLATHNETATGVTSDIAGVRKAMDAANHPALL  167



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 115/172 (67%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESALTNTL  GD +++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLHRGDTVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            AN   +   L  DT H IKA+  VHNETATGVT+++  VRK +D   HPALL
Sbjct  121  ANPQRIEEALRADTNHEIKAVMTVHNETATGVTSDIGAVRKAIDAAGHPALL  172



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGR+ LFVPGP N+PD+++RAM    ED+R+P  P LTK +LED+KKIFKTT+G  F+ P
Sbjct  10   PGRHFLFVPGPTNVPDRILRAMHVPMEDHRNPTFPDLTKPILEDLKKIFKTTTGQCFVYP  69

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            +TGTG WE+ALTNTLSPGD+++    GQFS LW D  QR+  +V V++ EWG G + + +
Sbjct  70   STGTGGWEAALTNTLSPGDKVIVSRYGQFSALWTDLAQRIGLDVQVIDEEWGTGTHPEHI  129

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             + L  D  H IK + +V NETATGVT+++  VRK +D  +HPALL
Sbjct  130  HAILEADKEHKIKGVLVVQNETATGVTSDVGAVRKAMDAAKHPALL  175



>ref|WP_014329402.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 emb|CCE96968.1| serine-glyoxylate aminotransferase-related [Sinorhizobium fredii 
HH103]
Length=396

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +LA D AH IKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  ERLAADKAHKIKAVFVTHNETATGVTSDVAAVRAALDACGHPALL  167



>ref|WP_005371842.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylomicrobium]
 gb|EIC29744.1| serine-pyruvate aminotransferase/archaeal aspartate aminotransferase 
[Methylomicrobium album BG8]
Length=388

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 118/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM    ED+RSP  PA+ K LLED+KK+F+T  G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPAIFKPLLEDMKKVFRTEKGQCFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVIIYRFGQFSHLWAEMAKRLGFDVEIHQETWGKGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L ED  H IKA+   HNETATGVT+++A VRK LD   HPALL
Sbjct  123  ARLKEDKNHEIKAVLATHNETATGVTSDIAGVRKALDAAGHPALL  167



>ref|WP_027999163.1| serine--glyoxylate aminotransferase [Sinorhizobium arboris]
Length=396

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 116/165 (70%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  +D+ A
Sbjct  63   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVDLYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +LA D  H IKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  ERLAADETHQIKAVFVTHNETATGVTSDVAAVRAALDAVDHPALL  167



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 119/166 (72%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGR+ LFVPGP N+PD+V RAM    ED+RS   P LT  L ED+KK+FK+  G  F+ P
Sbjct  2    PGRHFLFVPGPTNVPDRVQRAMLVAMEDHRSSKFPELTLPLFEDLKKVFKSVDGQVFIFP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE++L+NTLSPGD++++   GQFS LWID  QRL  +V V+E EWG G   + +
Sbjct  62   SSGTGAWEASLSNTLSPGDKVLASRFGQFSHLWIDLAQRLGLDVQVLEEEWGTGVKPEKI  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             + L ED +H IKA+  VHNETATGVT+++  VRK +D   HPALL
Sbjct  122  EAILREDKSHQIKAVLAVHNETATGVTSDIGAVRKAIDAANHPALL  167



>ref|WP_027147316.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacter]
Length=388

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFVFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEAWGKGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L ED+ H IKA+   HNETATGVT+++  VRK ++   HPALL
Sbjct  123  ARLKEDSQHEIKAVLATHNETATGVTSDIGGVRKAMNAANHPALL  167



>ref|WP_040961132.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
Length=396

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 116/165 (70%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  + + A
Sbjct  63   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVKLYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +LA D AH IKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  ERLAADKAHKIKAVFVTHNETATGVTSDVAAVRAALDACGHPALL  167



>ref|WP_028755163.1| serine--glyoxylate aminotransferase [Rhizobium leucaenae]
Length=396

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 116/165 (70%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNHNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +L  D AH IKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  ERLVADKAHKIKAVFVTHNETATGVTSDVAAVRAALDACGHPALL  167



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTNG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDKVLTARYGQFSHLWVDMAQRLGLDVIVQEEEWGAG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+   +   L  D  H IKA+ +VHNETATGVT+++  VRK +D   HPALL
Sbjct  121  ADPQKIEEALRADKDHAIKAVMVVHNETATGVTSDIGAVRKAIDAAGHPALL  172



>ref|WP_018329867.1| serine--glyoxylate aminotransferase [Rhizobium giardinii]
Length=396

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PG NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  D++++FK  +G  F+ P
Sbjct  2    PGYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADLRRVFKNQNGRVFIYP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+A+TN LSPGD ++    GQFS LW+D  +RL F VD ++ EWG G  +++ 
Sbjct  62   SSGTGAWEAAMTNVLSPGDHVLMSRFGQFSHLWVDMAERLGFKVDCIDMEWGTGVPVELY  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A +L  D AHTIKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  122  AERLTGDKAHTIKAVFVTHNETATGVTSDVAAVRAALDACNHPALL  167



>ref|WP_036253086.1| serine--glyoxylate aminotransferase [Methylobacter sp. BBA5.1]
Length=388

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFVFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQETWGKGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L ED+ H IKA+   HNETATGVT+++  VRK ++   HPALL
Sbjct  123  ARLKEDSQHEIKAVLATHNETATGVTSDIGGVRKAMNAANHPALL  167



>ref|WP_022947294.1| serine--glyoxylate aminotransferase [Methylohalobius crimeensis]
Length=395

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 114/165 (69%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL+VPGP N PD V+ AM    ED+R+P    L K LLED+KK+F+T  G  FL P 
Sbjct  3    GRNHLYVPGPTNAPDSVLSAMHVPMEDHRAPDFSELVKPLLEDLKKVFRTEKGQVFLFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE A+TNTLSPGD+++S+  GQFS LWI   QR+  +V+  E  WG+G  L+ L 
Sbjct  63   TGTAGWEVAMTNTLSPGDKVLSYRFGQFSHLWIQSAQRMGLDVEYHEVPWGEGVPLEHLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +L EDT H IK + I HNETATGVTN+LA +R++LD   HPAL 
Sbjct  123  QRLQEDTNHEIKGLLICHNETATGVTNDLAAIRRILDATGHPALF  167



>ref|WP_026616975.1| serine--glyoxylate aminotransferase [Ensifer sp. TW10]
Length=396

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DV+K+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVRKVFKNQNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +LA D AH I+A+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  ERLAADKAHEIQAVFVTHNETATGVTSDVAAVRAALDACGHPALL  167



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGR+ LFVPGP N+P++V RAM    ED+RSP  P LT  L +D+KKI+KT  G  FL P
Sbjct  2    PGRHFLFVPGPTNVPERVARAMVVPMEDHRSPKFPELTLPLFQDLKKIYKTKDGQVFLFP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWESA  NTLSPGD+++    GQFS LWID  QR+ F+V ++E EWG G   + +
Sbjct  62   SSGTGAWESAFNNTLSPGDKVLMSRFGQFSHLWIDMAQRMGFDVQILEEEWGTGVKPEKI  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
               L  D +H IKA+   HNETATGV +++A VRK +D   HPALL
Sbjct  122  EEILRADKSHQIKAVTATHNETATGVASDIAAVRKAMDAAGHPALL  167



>ref|WP_037384071.1| serine--glyoxylate aminotransferase [Ensifer americanum]
 gb|KEC78847.1| serine-glyoxylate aminotransferase [Sinorhizobium americanum 
CCGM7]
Length=395

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP++V +AM    ED RSP  P LT  L  D+K++FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPERVRQAMNLPMEDMRSPRYPELTLPLFADIKQVFKNKTGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +LA D AH IKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  ERLAADEAHEIKAVFVTHNETATGVTSDVAAVRAALDACGHPALL  167



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 119/166 (72%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+ P
Sbjct  7    PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENMKKVFKSKDGQVFIFP  66

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+ALTNTLSPGDR+++   GQFS LWID  QR+  +V + + EWG GAN D +
Sbjct  67   SSGTGAWEAALTNTLSPGDRVLASRFGQFSTLWIDLAQRVGLDVVIQDEEWGTGANPDRI  126

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
               L  D  H IKA+ IVHNETATGVT+++  VR+ +D   HPA+L
Sbjct  127  EEALRADRDHRIKAVLIVHNETATGVTSDIGAVRRAIDAANHPAML  172



>ref|WP_028223486.1| serine--glyoxylate aminotransferase [Burkholderia oxyphila]
Length=421

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+ P
Sbjct  10   PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSTRFPELANGVLSDLKRLYKTTSGQPFIFP  69

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F V++VE +WG+G  ++ +
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVARFGQFSHLWADMAQRLGFEVEIVEVDWGEGVPVERI  129

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
               L  D  H IK I   HNETATGVT+++  +R  +D+  HPALL
Sbjct  130  EEVLKADKKHQIKGILACHNETATGVTSDIGALRHAMDNAHHPALL  175



>ref|WP_006890572.1| serine--glyoxylate aminotransferase [Methylobacter tundripaludum]
 gb|EGW22602.1| Serine--glyoxylate transaminase [Methylobacter tundripaludum 
SV96]
Length=388

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P++++ AM  N ED+RSP  P L   LL+D+KKIFKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPNEILNAMHVNMEDHRSPVFPKLLTPLLQDLKKIFKTETGQAFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD + 
Sbjct  63   TGTAGWEVALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEVWGKGIPLDRME  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L EDT H IKA+   HNETATGVT+++  VRK L+   HPALL
Sbjct  123  ARLKEDTNHEIKAVLATHNETATGVTSDIGGVRKALNAANHPALL  167



>ref|WP_012709136.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 ref|YP_002827132.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii NGR234]
 gb|ACP26379.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii NGR234]
Length=395

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 115/165 (70%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+Q+ +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQIRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL   VD ++ EWG G  +D+  
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGLEVDCLDREWGTGVPVDLYT  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
             +LA D AH IKA+ + HNETATGVT+++A VR  LD   HPALL
Sbjct  123  ERLAADKAHRIKAVFVTHNETATGVTSDVAAVRAALDASGHPALL  167



>ref|WP_031437003.1| serine--glyoxylate aminotransferase [Methylobacter tundripaludum]
Length=388

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P++++ AM  N ED+RSP  P L   LL+D+KKIFKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPNEILNAMHVNMEDHRSPVFPKLLTPLLQDLKKIFKTETGQAFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD + 
Sbjct  63   TGTAGWEVALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEVWGKGIPLDRME  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L EDT H IKA+   HNETATGVT+++  VRK L+   HPALL
Sbjct  123  ARLKEDTNHEIKAVLATHNETATGVTSDIGGVRKALNAANHPALL  167



>ref|WP_042673896.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B34]
Length=402

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTAG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T  L P++GTG WESAL+NTL  GD +++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDTVLTSRYGQFSHLWVDMAQRLGLDVVVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+   +   L  D  H IKA+ +VHNETATGVT+++  VRK +D   HPALL
Sbjct  121  ADPQKIEEALRADKDHKIKAVMVVHNETATGVTSDIGAVRKAIDAAGHPALL  172



>ref|WP_020092657.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 285MFTsu5.1]
Length=402

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTAG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T  L P++GTG WESAL+NTL  GD +++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDTVLTSRYGQFSHLWVDMAQRLGLDVVVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+   +   L  D  H IKA+ +VHNETATGVT+++  VRK +D   HPALL
Sbjct  121  ADPQKIEEALRADKDHKIKAVMVVHNETATGVTSDIGAVRKAIDAAGHPALL  172



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRN L VPGP NIPDQV+R+M  + ED+RS   P L   +L D+K ++KTT+G PF+ P
Sbjct  10   PGRNFLAVPGPTNIPDQVLRSMVVSMEDHRSSKFPELANGVLSDLKALYKTTTGQPFIFP  69

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+ALTNTLSPGD++V    GQFS LW D   RL F V +V+ EWG+G  ++ +
Sbjct  70   SSGTGAWEAALTNTLSPGDKVVVARFGQFSHLWADMAHRLGFEVQIVDVEWGEGVPVERI  129

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
               L  D  HTIK I   HNETATGVT+++  +R  +D+ +HPALL
Sbjct  130  EEILRADKQHTIKGILACHNETATGVTSDIGALRAAMDNARHPALL  175



>ref|WP_010687105.1| Aminotransferase class V [Methylobacterium mesophilicum]
 gb|EMS39671.1| Aminotransferase class V [Methylobacterium mesophilicum SR1.6/6]
Length=402

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTNG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V + EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDKVLTARYGQFSHLWVDMAQRLGLDVIVQDEEWGAG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+   +   L  D  H IKA+ +VHNETATGVT+++  VRK +D   HPALL
Sbjct  121  ADPQKIEEALRADKDHAIKAVMVVHNETATGVTSDIGAVRKAIDAAGHPALL  172



>ref|WP_043385155.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
Length=402

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 0/172 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTAG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T  L P++GTG WESAL+NTL  GD +++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDTVLTSRYGQFSHLWVDMAQRLGLDVVVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A+   +   L  D  H IKA+ +VHNETATGVT+++  VRK +D   HPALL
Sbjct  121  ADPQKIEEALRADKDHKIKAVMVVHNETATGVTSDIGAVRKAIDAAGHPALL  172



>ref|WP_037131645.1| serine--glyoxylate aminotransferase [Rhizobium sp. CF097]
Length=396

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PG +HLF+PGP NIP+QV +AM    ED RS   P LT  L  DVKK+FK  +G  F+ P
Sbjct  2    PGYSHLFIPGPTNIPEQVRQAMNLPMEDMRSSRYPELTLPLFADVKKVFKNQNGRVFIYP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ 
Sbjct  62   SSGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFVVDCLDREWGTGVPVELY  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            A +LA D AH IKA+ + HNETATGVT+++A VR  L+   HPALL
Sbjct  122  AERLAADKAHEIKAVFVTHNETATGVTSDVAAVRAALEACDHPALL  167



>gb|AIQ91949.1| Aminotransferase class V [Methylobacterium oryzae CBMB20]
Length=443

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 120/175 (69%), Gaps = 0/175 (0%)
 Frame = +3

Query  147  GEKMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKT  326
            G  M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +
Sbjct  39   GNIMAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGS  98

Query  327  TSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEW  506
            T+GT  L P++GTG WESAL+NTL  GD +++   GQFS LW+D  QRL  +V V E EW
Sbjct  99   TAGTVILFPSSGTGIWESALSNTLCRGDTVLTSRYGQFSHLWVDMAQRLGLDVVVQEEEW  158

Query  507  GQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            G GA+   +   L  D  H IKA+ +VHNETATGVT+++  VRK +D   HPALL
Sbjct  159  GTGADPQKIEEALRADKDHKIKAVMVVHNETATGVTSDIGAVRKAIDAAGHPALL  213



>ref|WP_026223456.1| serine--glyoxylate aminotransferase [Methylosarcina fibrata]
Length=390

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM    ED+RSP  P L K LLED+KK+F+T  G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPTLFKPLLEDLKKVFRTEDGQCFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEVALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQETWGRGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L ED  H IKA+   HNETATGVT+++A VRK L+   HPALL
Sbjct  123  ARLKEDKNHEIKAVLATHNETATGVTSDIAGVRKALNSADHPALL  167



>ref|WP_024298006.1| serine--glyoxylate aminotransferase [Methylosarcina lacus]
Length=388

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 116/165 (70%), Gaps = 0/165 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM    ED+RSP  P L K LLED+KKIF+T +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPTLFKPLLEDMKKIFRTENGQCFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQETWGKGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  671
            ++L ED  H IKA+   HNETATGVT+++  VRK LD   HPA L
Sbjct  123  ARLKEDKNHEIKAVLATHNETATGVTSDIGGVRKALDAASHPAFL  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780